2M4EA

Solution nmr structure of vv2_0175 from vibrio vulnificus, nesg target vnr1 and csgid target idp91333
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
86
structure length
86
Chain Sequence
MSKTAKLNNEEKLVKKALEIGGKMAKMQGFDLPQSPQPVRVKAVYLFLVDAKQIAPLPDSKLDGANIKHRLALWIHAALPDNDPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Solution NMR structure of VV2_0175 from Vibrio vulnificus, NESG target VnR1 and CSGID target IDP91333
rcsb
source organism Vibrio vulnificus
molecule tags Unknown function
total genus 27
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2m4eA00
2M4EA
chains in the Genus database with same CATH superfamily
3HTKC 1YARO 4MS2A 1WASA 1OXKA 1TFOB 1WTYA 1FMWA 2NSFA 3JSZA 4K1OA 2RSEB 3SXYA 4MVOA 1GGQA 4E18A 4KBLA 1NBBA 2YL0A 3N2ZB 1R4TA 1ZU5A 2X51A 3VF0A 3C7JA 4M63A 3W4YA 2C03A 3OA1A 2HSBA 3UGPA 2LD6A 5KYUA 3VM6A 1TWGA 1JR8A 3CSKA 3DJNB 3EQLF 3TJ5A 5AC5A 2F22A 4L6RA 3JZ0A 2CYDA 3UMHA 5KYXB 3DXJF 3QVYA 3C62A 4D4NA 1RMVA 1E84A 4G7ZF 2ICWG 3MFNA 3DI5A 4QDLA 4G78A 2VCCA 3GM2A 3ABMC 3RF3A 4ER9A 3FAPB 3JT1A 4XEVA 1OCCC 2R03A 1H9TA 2BE5F 1RKEA 5BQGA 3FMSA 3MYFA 4NTAA 4WGZA 1RKEB 4XEKA 4R32A 1ZHZA 2HSQA 4YL1A 2A68F 2Y3GA 2WVQA 3T6GB 3GM1A 4U9DA 3B0VC 3QZCA 4JJFA 2A1DD 1LE4A 2XLDA 1WN0A 2B0JA 4OINF 3NRHA 3LLIA 2QNLA 1G8XA 3DAFA 2AP3A 4G7HF 1ORJA 1C03A 1D1CA 2AU5A 2Q9AA 3RH3A 2LFDA 4BJ6A 4BJ6C 3EG9A 3POVA 2Q4FA 2AWCA 4MVSA 2WVOA 2Q9BA 4AL1A 4IGGA 2MYSA 2VCBA 4NC3A 4OIRF 1T01A 1CPQA 2G3VA 4KNWA 2NUTA 2YQYA 3VRCA 4IJJA 4PK4A 4ULVA 4C3BA 3M4CA 3B29A 2ZD9A 4PJJA 4CSAA 4CSAC 1FMVA 5JUAA 1A7EA 1KU2A 4XLNF 3CEXA 2IYLD 2XLVA 4P9TA 4DVZA 3A11A 2OEXA 5FZTA 4YT2A 5JS5A 1QSPA 2EILC 5A6JA 1M56C 1JOGA 1M6TA 4NY3A 4AE4B 1WWPA 4JZAA 3KL4A 1WATA 2OU6A 3B9QA 1CGME 2EIJC 1YVIA 1LI5A 5L0JA 2YL3A 1FFTC 1OQCA 1NLXA 1G4US 1RJ9A 3FAJA 4O7GA 3NMJA 4YT4A 4EBBA 4MVUA 1HMOA 3S9OA 3O55A 2AVKA 2J9VA 3BEHA 3JCUQ 4A2NB 1V54C 1N1CA 1PD0A 4N6HA 4YJWA 3G4ZA 1HW2A 1OW7A 1ST6A 4CS9C 3H2VA 4RD9A 3EGDA 4CS9A 3X2QC 3S0XA 4I3MA 4X0RA 3U8PA 3EFOA 3EZIA 3IEEA 2TMVP 4CDAA 2EIKC 1EA8A 1CPRA 1OR3A 5EGYA 4XPXA 1OKKD 2KNHA 4MW8A 2YZSA 4J7TA 3CQZA 1U6HA 3JRMO 1LVKA 3EHMA 1ZW3A 5T1DB 2CW0F 2LFFA 2UUIA 4J7YA 5B1AC 1QLEC 2UUHA 3K1IA 3K1IC 4LDKA 3ZG1A 1I4ZA 4RDAA 3U0CA 3LEOA 4Q4ZF 2KSFA 1Z6AA 2J7PA 4I1OB 3RQGA 1W2WA 2P6VA 1O3UA 2R7QA 4MW3A 4YL0A 1TQGA 4Z9HA 2I8BA 3L34A 4E7ZA 4RBNA 2KK1A 1D0YA 1RXQA 1YA7O 2KC3A 4MVZA 4FAPB 3HNIA 3VYWA 4Q5SF 4CS7A 1PV3A 2QE9A 3UNGC 4O6MA 3RQFA 2Y3HA 3HNKA 4H4KC 1L3PA 3K6BA 2OQMA 1OW8A 3ASNC 2LSEA 2ZXOA 3T9OA 5B1BC 3DMDA 1HE1A 4HFKB 1I5NA 4U5GA 4PJNA 4Z9IA 2R05A 5KYWA 1HW1A 3KPHA 3LNRA 4OD4A 4EIYA 2GAQA 3LUTB 2PX0A 2VH3A 2ZXWC 4DXWA 5DVWA 2ZPAA 1BDJB 3VAYA 4JJGA 2EPLX 2J9UA 4XPWA 5BUOA 1EI7A 2HMQA 3EGXA 3EZHA 1VLTA 5COMA 2XM4A 3S84A 4XLPF 4PFOA 4FWVA 2YHSA 1ZHTA 2LP4A 1M2VB 4JKVA 4C3EA 1F1MA 1LIHA 2H7OA 2P0NA 4O79A 2Q7RA 3X1OA 2J45A 4EWCA 3DZAA 3U3FA 3AG3C 3O39A 4WJ0A 4W8PA 2QTVA 2KJGA 4A4AA 3NKEA 5DLJA 3AG2C 2R7RA 1H6GA 2KYHA 1PCXA 1BBHA 1U0BB 3CAXA 3RKOF 3S29A 5JT4A 1RKCA 2L6HA 3HKKA 4QI0A 2YLGA 4U5EE 5DQTA 5A6KA 2LCHA 1NZEA 3RFYA 3SP1A 5L0CA 4OIPF 2W9YA 4EHPA 3JYHA 1A41A 2CNWA 2EPNA 2XL6A 4XWJA 4U9EA 3AJMA 1HMDA 5COGA 3U9MA 1NG1A 3HNJA 2XXAB 4K7BA 4ZLCA 2IXPA 1L7CA 5KYXA 2HZ8A 2PBEA 3V5YA 4Z9JA 3NYJA 4D4XA 3IQTA 1T5OA 3MLGA 3EH2A 3RYLA 5L3VA 3I5PA 4PJLA 1G5ZA 1DOWA 2G3KA 3LJBA 1Z3IX 2LQGA 2A6HF 3FHDA 3HLZA 4IAOA 1Z23A 2B0HA 4E0IA 2GA0A 1C17M 1R5ID 1Y6DA 1BZ4A 3L8IA 3GEIA 3BRJA 3WG7C 1TKNA 2XLWA 1K05A 3AQCA 3UR3C 4JRZA 3S28A 3KMIA 4B6IA 3PHF2 4H54A 3DE9A 4U5CE 3LESA 3R2PA 3W8HA 2RD9A 1I4YA 1CGNA 4YK5A 2KGOA 3GWLA 5D92A 2PX3A 1MMDA 2WZFA 1T9KA 4CJOA 4NQFA 2R25A 1MMNA 1YZCA 4BG0A 2OJED 1UFBA 3NYMA 4MQ9F 1YLMA 4DBRA 5L0HA 5HSWA 3NDBB 4E0HA 1YAUO 5T3TA 2R7TA 4NCQA 3ATPA 4XPYA 1A0BA 4U5FE 3U2LA 4F4BA 3RVZA 1A7VA 2HMZA 1Q0FA 4JE9A 2FFHA 4LERA 3UMIA 1YDIA 2XM0A 4U5HA 4CIHA 4FX5A 5TJ5E 4FESA 3ABLC 4KI2A 1V55C 1OR2A 2JD3A 3AQBA 2J0WA 4U5BE 5JSLA 4AE4A 3S90A 1QKRA 3KH2A 1TWAA 3FOOA 3ZVRA 4CBEA 3TOLA 4GQHA 3F46A 3SXKA 5E2QA 4HE8D 1ORYA 3UMKA 2CCYA 3GODA 2XL8A 1SF8A 4AK9A 3EPVA 3ZC4A 4MTGA 1J8MF 1NU9C 1YZAA 2VC9A 4XQ1A 2R02A 3SNHA 3RIPA 2GDCA 3CZ6A 3G4XA 3UGOA 4GEHA 2BC5A 2MHRA 2Y69C 4O6NA 2D4UA 4W8KA 4OIQF 4LDQA 2BL2A 2Q9CA 4BJ5C 4BJ5A 5CI8A 1QZXA 4HEAJ 3ZTZA 3LAYA 3AOUA 4NTBA 2O9XA 3M4BA 5A69A 4IRUA 4AX2A 2Y3DA 1YYXA 1SZIA 2P1AA 4MTFA 1SMYF 5CIVA 4CIPA 5JVEA 2R7VA 3B71A 1APCA 2ZXRA 3Q6NA 3U2MA 1E86A 2VB6A 2L6GA 1Y4CA 4JEAA 2Q3TA 1LM3B 3M15A 1Q0KA 4LLCA 3ZDLA 4AL0A 2A69F 5AC4A 4ONSA 4QI2A 2AWYA 3NKDA 1EQ1A 1XZQA 1JMWA 1OKKA 2NUPB 3LS1A 4E17A 2OKUA 3QMKA 2GWWA 2NSGA 2IXNA 2HFIA 1NFOA 4XEFA 2EPOA 3QVZA 3SEOA 3ZQYA 3K7DA 2QLAA 4MNDA 1SR2A 3L8JA 5DS4A 3C8GB 5F5FA 4BEJA 3IQ6A 3Q7LA 3ZIBA 4JURI 1VMAA 3O6XA 4JC7A 5JLIA 1H9GA 1M2OA 1MNDA 4YWQA 1E2XA 1AVOB 2WVNA 4IWBA 1J8YF 4NTFA 5CI9A 2R9RB 1FFHA 1OW6A 4UDVA 2YVKA 1VTMP 4IAQA 5KYYB 1B68A 1RCPA 1NSGB 1MMGA 1NFNA 1WGWA 2EPKX 3NG1A 3ITFA 1ZU4A 2I15A 1H7IA 4OD5A 4PACA 4OIOF 1QPUA 2WL8A 1JPNA 1M57C 3RQEA 1ZHXA 3U8VA 1D1BA 1M2VA 2CDQA 4DRJB 4J30B 4LDRA 1FAPB 1ZHWA 1FTSA 3GEEA 4N4WA 4CDYA 3MX3A 3NMIA 2OCCC 2GFHA 2R7SA 5A6BD 1OXBA 2Y39A 1S7ZA 3N24A 3JRTA 2XRHA 3TJ6A 3DM5A 1JAFA 2HS5A 3C18A 1UG7A 1Q0MA 3RVYA 1S05A 2VASA 3HJCA 3IQCA 3N0TA 2HV7A 3OWTA 3ECSA 3DAGA 1EKYA 1JPJA 1QQ3A 2IXMA 4EBJA 2M4EA 1YYJA 1BR1A 1LS1A 2W4BA 1T6UA 3IPMO 5DQZA 2QUPA 5L0IA 2XXAA 1Z7Qc 1TFKB 2X0CA 1E85A 3W2VA 2JX0A 4LACB 2EIMC 3DKAA 4YT5A 3GANA 3U5SA 4C3DA 5DS5A 4JTCB 1GQAA 2IOQA 1TWCA 2OJQA 1SYQA 1VK5A 4C7OB 2L6FA 3WAQA 3Q6MA 1ORSC 1G4WR 3LS0A 3M79A 3V5ZA 5L0FA 2LIGA 2FAPB 2DGJA 4J32B 1ZHYA 1Z63A 2MWQA 1ZVZA 4G0HA 2J0XA 4CX9A 5BQHA 3C8ZA 2XLMA 1HE9A 3KKBA 1LKXA 1T6QA 3JTLO 5AGFA 2H7BA 4BJTA 5KYUB 3PCVA 4GYTA 2YWAA 3SZRA 5KYNA 4P6IC 2Y3BA 2QY9A 3U9JA 4JW1A 3KYJA 4BPMA 2EPMX 4I1MA 1LS4A 4N6CA 2R7OA 1KTMA 4PFPA 3J06A 4WGYA 1BR4A 5T3WA 3H65A 3SYNA 3I4UA 3R7CA 3QTHA 3GWNA 2WZGA 3NYLA 3B0PA 3GORA 4CDVA 1MMAA 3M1CB 5B3SC 5BQIA 4ZLDA 4MVRA 2P61A 3V7OA 2KQ9A 3FXHA 3S27A 4IB4A 3ZTMA 2CGEA 3T6JA 3V5XA 4YL3A 1XZPA 5DS6A 3FVYA 4PR9A 5EK0A 1KNYA 1LPEA 2XS8A 1HY5A 1T6IA 3QW0A 4WABA 3SXMA 5F28E 4E7SA 1OCZC 4EKWA 1OCOC 2NPUA 4IARA 3TOMA 2J9BA 5A6AA 4KC9A 3B0UX 5FCLA 3EG9B 4I44A 3AG4C 5GPGB 4BEMJ 3TULA 1QVXA 2J9WA 3F47A 1TWHA 4BJ1A 4ANJA 5EHHA 2IBFA 5HV9A 2NUTB 4Q7CA 2HJ3A 2L7AA 4YN0B 1DOVA 5E33A 1VOMA 1E83A 3PMRA 3ZSUA 2PF4E 3Q7GA 5L0GA 1D1AA 3NMKA 2W4MA 2W45A 2XLOA 1LI7A 4G7OF 2ETSA 4MVMA 1U89A 3AGUA 2PP4A 5L3QA 4ULWA 2NUPA 3C8GD 3DM9B 4N06A 5D91A 3SXZA 3FDQA 2A6EF 4JEBA 2DYSC 2XLHA 2HKVA 3U3BA 4DRIB 3E9VA 4DBQA 1RJ9B 2EINC 1O87A 2J8WA 1PD1A 3ZWIA 4EBKA 3AG1C 1D0XA 3GM3A 4DVYP 1IW7F 1ZYRF 2IXOA 1NU7D 2G62A 4YT8A 2XL4A 4XTKA 3C8GA 2Q00A 1AEPA 2PFDA 2YL7A 1FR0A 1K40A 3T6BA 2V3CC 5JP7A 1C02A 1O5HA 2YRFA 2XSEA 1VB5A 3AGTA 3G50A 4KNVA 3EHNA 2R7UA 3EGDB 3ZQVA 2FGYA 1V4AA 1CGOA 3W2WA 1WOLA 2DI3A 3EFOB 2H8AA 3A9CA 3K33A 2HJMA 3RW0A 4JTDB 3C63A 1IZMA 2J7PD 2VCAA 3H2UA 3DJUB 3O10A 2NG1A 3TQOA 3L0IA 2V26A 3WODF 2L9JA 2M64A 3L1MA 4JCHA 3K66A 5KYYA 2J46A 1Z5ZA 4DRHB 1VLSA 4CJGA 3JSEO 5F5HA 4DOZA 1MNEA 1BR2A 2KW3C 1YJGA 2HUJA 2WB7A 1YA9A 3MYIA 4JIOA 2P7VA 1VYIA 3QW1A 1XWJA 2C04A 2DB4A 2E87A 3GEHA 5E3CA 3TD7A 4PJMA 2PNOA 4LLEA 3DWWA 1Q0GA 2JPUA 1MQVA 3ABKC 3EJNA 1AUEA 4MTOA 2WZLA 2R7XA 3TK0A 2YL1A 2LK4A 5L0DA 3MBGA 1V74B 3IQ5A 3LNMB 4JTAB 4P9FA 1Q0DA 2R7WA 4HFFB 3WHNA 1VYKA 3K1HA 3LEVA 4EUKB 5B3IA 2OG2A 5IY5C 3OEOA 1FNTc 1OCRC 2YKZA 3DD7A 4CS8A 4CS8C 3HNLA 5K0IA 3FOPA 3PDMP 2ZXPA 4O6YA 4K0DA 4U5DE 2YLIA 1LE2A 1ZZPA 256BA 2H7VC 4JCZA 5KYWB 1TR2A 2D5RB 2YLDA 3I5QA 3US6A 2OOCA 5A6BA 1GM5A 3KYIA 2Z15A 1A7DA 4DJ9A 2HV6A 3T4RA 3E70C 3LLKA 2IM8A 2XS1A 4MVQA 5JRAA 4JVSA 5E3AA 3EGXB 5COFA 3IHUA 2DYRC 3EH1A 4C7OA 2XLEA 1GS9A 2ASRA 3ASOC 1D0ZA 2A0UA 2YEVA 1JRAA 2A0BA 1ZW2A 2L81A 1K04A 3JYYA 3W8IA 3DE8A 2OEVA 2CNWD
chains in the Genus database with same CATH topology
3HTKC 3JSZA 1FMWA 4KBLA 3N2ZB 1ZU5A 2X51A 4M63A 2C03A 3OA1A 3UGPA 5KYUA 1TWGA 3DJNB 3CSKA 3EQLF 3UMHA 5KYXB 3DXJF 4G7ZF 4QDLA 3ABMC 3JT1A 1OCCC 2BE5F 1ZHZA 2A68F 2Y3GA 2WVQA 3B0VC 3QZCA 4JJFA 2A1DD 4OINF 2B0JA 3NRHA 3LLIA 1G8XA 3DAFA 4G7HF 4BJ6C 1D1CA 2Q9AA 3RH3A 4BJ6A 3EG9A 3POVA 2WVOA 2Q9BA 2MYSA 4OIRF 2G3VA 2NUTA 4KNWA 4IJJA 4PK4A 4C3BA 4CSAC 4PJJA 4CSAA 1FMVA 1KU2A 4XLNF 4DVZA 2IYLD 4YT2A 2EILC 1M56C 4NY3A 4AE4B 4JZAA 3KL4A 3B9QA 2EIJC 1FFTC 1RJ9A 3FAJA 4O7GA 4YT4A 4EBBA 2J9VA 3JCUQ 4A2NB 1V54C 1N1CA 1PD0A 4YJWA 1ST6A 4CS9C 4CS9A 4RD9A 3EGDA 3S0XA 3X2QC 4I3MA 4X0RA 3EFOA 3EZIA 3IEEA 2EIKC 5EGYA 1OKKD 2KNHA 2YZSA 3CQZA 1LVKA 3EHMA 5T1DB 2CW0F 5B1AC 1QLEC 3K1IC 3ZG1A 4RDAA 4Q4ZF 1Z6AA 2J7PA 4I1OB 1W2WA 2P6VA 2R7QA 4E7ZA 2I8BA 3L34A 4RBNA 1D0YA 4Q5SF 3VYWA 4CS7A 3UNGC 4O6MA 2Y3HA 4H4KC 3K6BA 3ASNC 2LSEA 2ZXOA 5B1BC 3DMDA 4HFKB 4U5GA 4PJNA 5KYWA 3LNRA 4OD4A 2PX0A 2VH3A 2ZXWC 5DVWA 2ZPAA 5BUOA 3VAYA 4JJGA 2J9UA 3EGXA 3EZHA 4XLPF 4PFOA 4FWVA 2YHSA 1ZHTA 1M2VB 4C3EA 2H7OA 4O79A 3X1OA 2J45A 4EWCA 3DZAA 3AG3C 3O39A 4WJ0A 2QTVA 2KJGA 3NKEA 5DLJA 3AG2C 2R7RA 1PCXA 3S29A 3RKOF 4QI0A 5DQTA 4U5EE 1NZEA 3RFYA 3SP1A 4OIPF 2W9YA 3JYHA 2CNWA 4XWJA 1NG1A 2XXAB 4K7BA 4ZLCA 2IXPA 5KYXA 3NYJA 3MLGA 3EH2A 3RYLA 5L3VA 3I5PA 4PJLA 2G3KA 3LJBA 1Z3IX 3FHDA 2A6HF 4IAOA 3HLZA 1Z23A 3WG7C 1TKNA 3AQCA 3UR3C 3S28A 4B6IA 3KMIA 3PHF2 4U5CE 3LESA 3W8HA 2KGOA 5D92A 2PX3A 1MMDA 2WZFA 1MMNA 4BG0A 3NYMA 4MQ9F 4DBRA 5HSWA 3NDBB 5T3TA 2R7TA 4U5FE 4F4BA 2FFHA 4LERA 3UMIA 4U5HA 4CIHA 4FX5A 4FESA 3ABLC 1V55C 2JD3A 3AQBA 2J0WA 4U5BE 4AE4A 3KH2A 1TWAA 3ZVRA 4CBEA 3F46A 5E2QA 4HE8D 3UMKA 3GODA 1SF8A 4AK9A 3EPVA 3ZC4A 1J8MF 1NU9C 3SNHA 3RIPA 3CZ6A 3UGOA 4GEHA 2Y69C 4O6NA 4W8KA 4OIQF 2Q9CA 4BJ5C 4BJ5A 5CI8A 1QZXA 4HEAJ 3LAYA 2O9XA 4IRUA 4AX2A 2Y3DA 1SZIA 1SMYF 2R7VA 2ZXRA 3Q6NA 2VB6A 2Q3TA 4LLCA 2A69F 4QI2A 3NKDA 2NUPB 1OKKA 3LS1A 3QMKA 2IXNA 3SEOA 3K7DA 4MNDA 5DS4A 5F5FA 4BEJA 3Q7LA 3ZIBA 4JURI 1VMAA 3O6XA 1M2OA 1MNDA 4YWQA 2WVNA 4IWBA 1J8YF 5CI9A 1FFHA 5KYYB 1MMGA 1WGWA 3NG1A 3ITFA 1ZU4A 4OD5A 4OIOF 2WL8A 1JPNA 1M57C 1ZHXA 1D1BA 1M2VA 2CDQA 4J30B 1ZHWA 1FTSA 3MX3A 2OCCC 2GFHA 2R7SA 2Y39A 1S7ZA 3N24A 3JRTA 2XRHA 3DM5A 2VASA 3HJCA 3N0TA 2HV7A 3OWTA 3ECSA 3DAGA 1JPJA 2IXMA 2M4EA 1BR1A 1LS1A 2W4BA 5DQZA 2XXAA 3W2VA 4LACB 2EIMC 4YT5A 4C3DA 3GANA 5DS5A 2IOQA 1TWCA 1VK5A 4C7OB 3Q6MA 3LS0A 4J32B 2DGJA 1ZHYA 1Z63A 2MWQA 4G0HA 2J0XA 3KKBA 1LKXA 2H7BA 4BJTA 5KYUB 4GYTA 3SZRA 5KYNA 4P6IC 2Y3BA 2QY9A 4JW1A 4I1MA 2R7OA 4PFPA 1BR4A 5T3WA 3H65A 3SYNA 3I4UA 2WZGA 3NYLA 3B0PA 5B3SC 1MMAA 3M1CB 4ZLDA 3V7OA 2KQ9A 3S27A 2CGEA 3T6JA 5DS6A 3FVYA 4E7SA 1OCZC 1OCOC 4KC9A 3B0UX 5FCLA 3EG9B 4I44A 3AG4C 2J9WA 3F47A 1TWHA 4BJ1A 4ANJA 5EHHA 2NUTB 4Q7CA 4YN0B 5E33A 1VOMA 3PMRA 3ZSUA 2PF4E 3Q7GA 1D1AA 2W4MA 2W45A 4G7OF 2PP4A 5L3QA 4ULWA 2NUPA 5D91A 3DM9B 4N06A 3FDQA 2A6EF 2DYSC 3E9VA 1RJ9B 2EINC 1O87A 1PD1A 3AG1C 1D0XA 4DVYP 1IW7F 1ZYRF 2IXOA 1NU7D 2G62A 4YT8A 2XL4A 4XTKA 2PFDA 3T6BA 1O5HA 2XSEA 4KNVA 3EHNA 2R7UA 3EGDB 4DBQA 2FGYA 3W2WA 4KI2A 3EFOB 3K33A 1IZMA 2J7PD 3WODF 3DJUB 2V3CC 2NG1A 3L0IA 2V26A 2L9JA 4JCHA 3K66A 5KYYA 2J46A 1Z5ZA 5F5HA 4DOZA 1MNEA 1BR2A 2KW3C 2WB7A 2P7VA 1VYIA 2C04A 2E87A 5E3CA 3TD7A 4PJMA 4LLEA 3ABKC 3EJNA 2WZLA 2R7XA 2R7WA 4HFFB 1VYKA 3K1HA 3LEVA 5IY5C 2OG2A 3OEOA 1OCRC 4CS8C 3DD7A 4CS8A 2ZXPA 4O6YA 4K0DA 4U5DE 2H7VC 5KYWB 1TR2A 2D5RB 3I5QA 2Z15A 2HV6A 3T4RA 3E70C 3LLKA 4JVSA 5E3AA 3EGXB 2DYRC 3EH1A 4C7OA 3ASOC 1D0ZA 2YEVA 2L81A 3W8IA 2CNWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4E A; 
#chains in the Genus database with same CATH topology
 3HTK C;  1YAR O;  4MS2 A;  1WAS A;  1OXK A;  1TFO B;  1WTY A;  1FMW A;  2NSF A;  3JSZ A;  4K1O A;  2RSE B;  3SXY A;  4MVO A;  1GGQ A;  4E18 A;  4KBL A;  1NBB A;  2YL0 A;  3N2Z B;  1R4T A;  1ZU5 A;  2X51 A;  3VF0 A;  3C7J A;  4M63 A;  3W4Y A;  2C03 A;  3OA1 A;  2HSB A;  3UGP A;  2LD6 A;  5KYU A;  3VM6 A;  1TWG A;  1JR8 A;  3CSK A;  3DJN B;  3EQL F;  3TJ5 A;  5AC5 A;  2F22 A;  4L6R A;  3JZ0 A;  2CYD A;  3UMH A;  5KYX B;  3DXJ F;  3QVY A;  3C62 A;  4D4N A;  1RMV A;  1E84 A;  4G7Z F;  2ICW G;  3MFN A;  3DI5 A;  4QDL A;  4G78 A;  2VCC A;  3GM2 A;  3ABM C;  3RF3 A;  4ER9 A;  3FAP B;  3JT1 A;  4XEV A;  1OCC C;  2R03 A;  1H9T A;  2BE5 F;  1RKE A;  5BQG A;  3FMS A;  3MYF A;  4NTA A;  4WGZ A;  1RKE B;  4XEK A;  4R32 A;  1ZHZ A;  2HSQ A;  4YL1 A;  2A68 F;  2Y3G A;  2WVQ A;  3T6G B;  3GM1 A;  4U9D A;  3B0V C;  3QZC A;  4JJF A;  2A1D D;  1LE4 A;  2XLD A;  1WN0 A;  2B0J A;  4OIN F;  3NRH A;  3LLI A;  2QNL A;  1G8X A;  3DAF A;  2AP3 A;  4G7H F;  1ORJ A;  1C03 A;  1D1C A;  2AU5 A;  2Q9A A;  3RH3 A;  2LFD A;  4BJ6 A;  4BJ6 C;  3EG9 A;  3POV A;  2Q4F A;  2AWC A;  4MVS A;  2WVO A;  2Q9B A;  4AL1 A;  4IGG A;  2MYS A;  2VCB A;  4NC3 A;  4OIR F;  1T01 A;  1CPQ A;  2G3V A;  4KNW A;  2NUT A;  2YQY A;  3VRC A;  4IJJ A;  4PK4 A;  4ULV A;  4C3B A;  3M4C A;  3B29 A;  2ZD9 A;  4PJJ A;  4CSA A;  4CSA C;  1FMV A;  5JUA A;  1A7E A;  1KU2 A;  4XLN F;  3CEX A;  2IYL D;  2XLV A;  4P9T A;  4DVZ A;  3A11 A;  2OEX A;  5FZT A;  4YT2 A;  5JS5 A;  1QSP A;  2EIL C;  5A6J A;  1M56 C;  1JOG A;  1M6T A;  4NY3 A;  4AE4 B;  1WWP A;  4JZA A;  3KL4 A;  1WAT A;  2OU6 A;  3B9Q A;  1CGM E;  2EIJ C;  1YVI A;  1LI5 A;  5L0J A;  2YL3 A;  1FFT C;  1OQC A;  1NLX A;  1G4U S;  1RJ9 A;  3FAJ A;  4O7G A;  3NMJ A;  4YT4 A;  4EBB A;  4MVU A;  1HMO A;  3S9O A;  3O55 A;  2AVK A;  2J9V A;  3BEH A;  3JCU Q;  4A2N B;  1V54 C;  1N1C A;  1PD0 A;  4N6H A;  4YJW A;  3G4Z A;  1HW2 A;  1OW7 A;  1ST6 A;  4CS9 C;  3H2V A;  4RD9 A;  3EGD A;  4CS9 A;  3X2Q C;  3S0X A;  4I3M A;  4X0R A;  3U8P A;  3EFO A;  3EZI A;  3IEE A;  2TMV P;  4CDA A;  2EIK C;  1EA8 A;  1CPR A;  1OR3 A;  5EGY A;  4XPX A;  1OKK D;  2KNH A;  4MW8 A;  2YZS A;  4J7T A;  3CQZ A;  1U6H A;  3JRM O;  1LVK A;  3EHM A;  1ZW3 A;  5T1D B;  2CW0 F;  2LFF A;  2UUI A;  4J7Y A;  5B1A C;  1QLE C;  2UUH A;  3K1I A;  3K1I C;  4LDK A;  3ZG1 A;  1I4Z A;  4RDA A;  3U0C A;  3LEO A;  4Q4Z F;  2KSF A;  1Z6A A;  2J7P A;  4I1O B;  3RQG A;  1W2W A;  2P6V A;  1O3U A;  2R7Q A;  4MW3 A;  4YL0 A;  1TQG A;  4Z9H A;  2I8B A;  3L34 A;  4E7Z A;  4RBN A;  2KK1 A;  1D0Y A;  1RXQ A;  1YA7 O;  2KC3 A;  4MVZ A;  4FAP B;  3HNI A;  3VYW A;  4Q5S F;  4CS7 A;  1PV3 A;  2QE9 A;  3UNG C;  4O6M A;  3RQF A;  2Y3H A;  3HNK A;  4H4K C;  1L3P A;  3K6B A;  2OQM A;  1OW8 A;  3ASN C;  2LSE A;  2ZXO A;  3T9O A;  5B1B C;  3DMD A;  1HE1 A;  4HFK B;  1I5N A;  4U5G A;  4PJN A;  4Z9I A;  2R05 A;  5KYW A;  1HW1 A;  3KPH A;  3LNR A;  4OD4 A;  4EIY A;  2GAQ A;  3LUT B;  2PX0 A;  2VH3 A;  2ZXW C;  4DXW A;  5DVW A;  2ZPA A;  1BDJ B;  3VAY A;  4JJG A;  2EPL X;  2J9U A;  4XPW A;  5BUO A;  1EI7 A;  2HMQ A;  3EGX A;  3EZH A;  1VLT A;  5COM A;  2XM4 A;  3S84 A;  4XLP F;  4PFO A;  4FWV A;  2YHS A;  1ZHT A;  2LP4 A;  1M2V B;  4JKV A;  4C3E A;  1F1M A;  1LIH A;  2H7O A;  2P0N A;  4O79 A;  2Q7R A;  3X1O A;  2J45 A;  4EWC A;  3DZA A;  3U3F A;  3AG3 C;  3O39 A;  4WJ0 A;  4W8P A;  2QTV A;  2KJG A;  4A4A A;  3NKE A;  5DLJ A;  3AG2 C;  2R7R A;  1H6G A;  2KYH A;  1PCX A;  1BBH A;  1U0B B;  3CAX A;  3RKO F;  3S29 A;  5JT4 A;  1RKC A;  2L6H A;  3HKK A;  4QI0 A;  2YLG A;  4U5E E;  5DQT A;  5A6K A;  2LCH A;  1NZE A;  3RFY A;  3SP1 A;  5L0C A;  4OIP F;  2W9Y A;  4EHP A;  3JYH A;  1A41 A;  2CNW A;  2EPN A;  2XL6 A;  4XWJ A;  4U9E A;  3AJM A;  1HMD A;  5COG A;  3U9M A;  1NG1 A;  3HNJ A;  2XXA B;  4K7B A;  4ZLC A;  2IXP A;  1L7C A;  5KYX A;  2HZ8 A;  2PBE A;  3V5Y A;  4Z9J A;  3NYJ A;  4D4X A;  3IQT A;  1T5O A;  3MLG A;  3EH2 A;  3RYL A;  5L3V A;  3I5P A;  4PJL A;  1G5Z A;  1DOW A;  2G3K A;  3LJB A;  1Z3I X;  2LQG A;  2A6H F;  3FHD A;  3HLZ A;  4IAO A;  1Z23 A;  2B0H A;  4E0I A;  2GA0 A;  1C17 M;  1R5I D;  1Y6D A;  1BZ4 A;  3L8I A;  3GEI A;  3BRJ A;  3WG7 C;  1TKN A;  2XLW A;  1K05 A;  3AQC A;  3UR3 C;  4JRZ A;  3S28 A;  3KMI A;  4B6I A;  3PHF 2;  4H54 A;  3DE9 A;  4U5C E;  3LES A;  3R2P A;  3W8H A;  2RD9 A;  1I4Y A;  1CGN A;  4YK5 A;  2KGO A;  3GWL A;  5D92 A;  2PX3 A;  1MMD A;  2WZF A;  1T9K A;  4CJO A;  4NQF A;  2R25 A;  1MMN A;  1YZC A;  4BG0 A;  2OJE D;  1UFB A;  3NYM A;  4MQ9 F;  1YLM A;  4DBR A;  5L0H A;  5HSW A;  3NDB B;  4E0H A;  1YAU O;  5T3T A;  2R7T A;  4NCQ A;  3ATP A;  4XPY A;  1A0B A;  4U5F E;  3U2L A;  4F4B A;  3RVZ A;  1A7V A;  2HMZ A;  1Q0F A;  4JE9 A;  2FFH A;  4LER A;  3UMI A;  1YDI A;  2XM0 A;  4U5H A;  4CIH A;  4FX5 A;  5TJ5 E;  4FES A;  3ABL C;  4KI2 A;  1V55 C;  1OR2 A;  2JD3 A;  3AQB A;  2J0W A;  4U5B E;  5JSL A;  4AE4 A;  3S90 A;  1QKR A;  3KH2 A;  1TWA A;  3FOO A;  3ZVR A;  4CBE A;  3TOL A;  4GQH A;  3F46 A;  3SXK A;  5E2Q A;  4HE8 D;  1ORY A;  3UMK A;  2CCY A;  3GOD A;  2XL8 A;  1SF8 A;  4AK9 A;  3EPV A;  3ZC4 A;  4MTG A;  1J8M F;  1NU9 C;  1YZA A;  2VC9 A;  4XQ1 A;  2R02 A;  3SNH A;  3RIP A;  2GDC A;  3CZ6 A;  3G4X A;  3UGO A;  4GEH A;  2BC5 A;  2MHR A;  2Y69 C;  4O6N A;  2D4U A;  4W8K A;  4OIQ F;  4LDQ A;  2BL2 A;  2Q9C A;  4BJ5 C;  4BJ5 A;  5CI8 A;  1QZX A;  4HEA J;  3ZTZ A;  3LAY A;  3AOU A;  4NTB A;  2O9X A;  3M4B A;  5A69 A;  4IRU A;  4AX2 A;  2Y3D A;  1YYX A;  1SZI A;  2P1A A;  4MTF A;  1SMY F;  5CIV A;  4CIP A;  5JVE A;  2R7V A;  3B71 A;  1APC A;  2ZXR A;  3Q6N A;  3U2M A;  1E86 A;  2VB6 A;  2L6G A;  1Y4C A;  4JEA A;  2Q3T A;  1LM3 B;  3M15 A;  1Q0K A;  4LLC A;  3ZDL A;  4AL0 A;  2A69 F;  5AC4 A;  4ONS A;  4QI2 A;  2AWY A;  3NKD A;  1EQ1 A;  1XZQ A;  1JMW A;  1OKK A;  2NUP B;  3LS1 A;  4E17 A;  2OKU A;  3QMK A;  2GWW A;  2NSG A;  2IXN A;  2HFI A;  1NFO A;  4XEF A;  2EPO A;  3QVZ A;  3SEO A;  3ZQY A;  3K7D A;  2QLA A;  4MND A;  1SR2 A;  3L8J A;  5DS4 A;  3C8G B;  5F5F A;  4BEJ A;  3IQ6 A;  3Q7L A;  3ZIB A;  4JUR I;  1VMA A;  3O6X A;  4JC7 A;  5JLI A;  1H9G A;  1M2O A;  1MND A;  4YWQ A;  1E2X A;  1AVO B;  2WVN A;  4IWB A;  1J8Y F;  4NTF A;  5CI9 A;  2R9R B;  1FFH A;  1OW6 A;  4UDV A;  2YVK A;  1VTM P;  4IAQ A;  5KYY B;  1B68 A;  1RCP A;  1NSG B;  1MMG A;  1NFN A;  1WGW A;  2EPK X;  3NG1 A;  3ITF A;  1ZU4 A;  2I15 A;  1H7I A;  4OD5 A;  4PAC A;  4OIO F;  1QPU A;  2WL8 A;  1JPN A;  1M57 C;  3RQE A;  1ZHX A;  3U8V A;  1D1B A;  1M2V A;  2CDQ A;  4DRJ B;  4J30 B;  4LDR A;  1FAP B;  1ZHW A;  1FTS A;  3GEE A;  4N4W A;  4CDY A;  3MX3 A;  3NMI A;  2OCC C;  2GFH A;  2R7S A;  5A6B D;  1OXB A;  2Y39 A;  1S7Z A;  3N24 A;  3JRT A;  2XRH A;  3TJ6 A;  3DM5 A;  1JAF A;  2HS5 A;  3C18 A;  1UG7 A;  1Q0M A;  3RVY A;  1S05 A;  2VAS A;  3HJC A;  3IQC A;  3N0T A;  2HV7 A;  3OWT A;  3ECS A;  3DAG A;  1EKY A;  1JPJ A;  1QQ3 A;  2IXM A;  4EBJ A;  2M4E A;  1YYJ A;  1BR1 A;  1LS1 A;  2W4B A;  1T6U A;  3IPM O;  5DQZ A;  2QUP A;  5L0I A;  2XXA A;  1Z7Q c;  1TFK B;  2X0C A;  1E85 A;  3W2V A;  2JX0 A;  4LAC B;  2EIM C;  3DKA A;  4YT5 A;  3GAN A;  3U5S A;  4C3D A;  5DS5 A;  4JTC B;  1GQA A;  2IOQ A;  1TWC A;  2OJQ A;  1SYQ A;  1VK5 A;  4C7O B;  2L6F A;  3WAQ A;  3Q6M A;  1ORS C;  1G4W R;  3LS0 A;  3M79 A;  3V5Z A;  5L0F A;  2LIG A;  2FAP B;  2DGJ A;  4J32 B;  1ZHY A;  1Z63 A;  2MWQ A;  1ZVZ A;  4G0H A;  2J0X A;  4CX9 A;  5BQH A;  3C8Z A;  2XLM A;  1HE9 A;  3KKB A;  1LKX A;  1T6Q A;  3JTL O;  5AGF A;  2H7B A;  4BJT A;  5KYU B;  3PCV A;  4GYT A;  2YWA A;  3SZR A;  5KYN A;  4P6I C;  2Y3B A;  2QY9 A;  3U9J A;  4JW1 A;  3KYJ A;  4BPM A;  2EPM X;  4I1M A;  1LS4 A;  4N6C A;  2R7O A;  1KTM A;  4PFP A;  3J06 A;  4WGY A;  1BR4 A;  5T3W A;  3H65 A;  3SYN A;  3I4U A;  3R7C A;  3QTH A;  3GWN A;  2WZG A;  3NYL A;  3B0P A;  3GOR A;  4CDV A;  1MMA A;  3M1C B;  5B3S C;  5BQI A;  4ZLD A;  4MVR A;  2P61 A;  3V7O A;  2KQ9 A;  3FXH A;  3S27 A;  4IB4 A;  3ZTM A;  2CGE A;  3T6J A;  3V5X A;  4YL3 A;  1XZP A;  5DS6 A;  3FVY A;  4PR9 A;  5EK0 A;  1KNY A;  1LPE A;  2XS8 A;  1HY5 A;  1T6I A;  3QW0 A;  4WAB A;  3SXM A;  5F28 E;  4E7S A;  1OCZ C;  4EKW A;  1OCO C;  2NPU A;  4IAR A;  3TOM A;  2J9B A;  5A6A A;  4KC9 A;  3B0U X;  5FCL A;  3EG9 B;  4I44 A;  3AG4 C;  5GPG B;  4BEM J;  3TUL A;  1QVX A;  2J9W A;  3F47 A;  1TWH A;  4BJ1 A;  4ANJ A;  5EHH A;  2IBF A;  5HV9 A;  2NUT B;  4Q7C A;  2HJ3 A;  2L7A A;  4YN0 B;  1DOV A;  5E33 A;  1VOM A;  1E83 A;  3PMR A;  3ZSU A;  2PF4 E;  3Q7G A;  5L0G A;  1D1A A;  3NMK A;  2W4M A;  2W45 A;  2XLO A;  1LI7 A;  4G7O F;  2ETS A;  4MVM A;  1U89 A;  3AGU A;  2PP4 A;  5L3Q A;  4ULW A;  2NUP A;  3C8G D;  3DM9 B;  4N06 A;  5D91 A;  3SXZ A;  3FDQ A;  2A6E F;  4JEB A;  2DYS C;  2XLH A;  2HKV A;  3U3B A;  4DRI B;  3E9V A;  4DBQ A;  1RJ9 B;  2EIN C;  1O87 A;  2J8W A;  1PD1 A;  3ZWI A;  4EBK A;  3AG1 C;  1D0X A;  3GM3 A;  4DVY P;  1IW7 F;  1ZYR F;  2IXO A;  1NU7 D;  2G62 A;  4YT8 A;  2XL4 A;  4XTK A;  3C8G A;  2Q00 A;  1AEP A;  2PFD A;  2YL7 A;  1FR0 A;  1K40 A;  3T6B A;  2V3C C;  5JP7 A;  1C02 A;  1O5H A;  2YRF A;  2XSE A;  1VB5 A;  3AGT A;  3G50 A;  4KNV A;  3EHN A;  2R7U A;  3EGD B;  3ZQV A;  2FGY A;  1V4A A;  1CGO A;  3W2W A;  1WOL A;  2DI3 A;  3EFO B;  2H8A A;  3A9C A;  3K33 A;  2HJM A;  3RW0 A;  4JTD B;  3C63 A;  1IZM A;  2J7P D;  2VCA A;  3H2U A;  3DJU B;  3O10 A;  2NG1 A;  3TQO A;  3L0I A;  2V26 A;  3WOD F;  2L9J A;  2M64 A;  3L1M A;  4JCH A;  3K66 A;  5KYY A;  2J46 A;  1Z5Z A;  4DRH B;  1VLS A;  4CJG A;  3JSE O;  5F5H A;  4DOZ A;  1MNE A;  1BR2 A;  2KW3 C;  1YJG A;  2HUJ A;  2WB7 A;  1YA9 A;  3MYI A;  4JIO A;  2P7V A;  1VYI A;  3QW1 A;  1XWJ A;  2C04 A;  2DB4 A;  2E87 A;  3GEH A;  5E3C A;  3TD7 A;  4PJM A;  2PNO A;  4LLE A;  3DWW A;  1Q0G A;  2JPU A;  1MQV A;  3ABK C;  3EJN A;  1AUE A;  4MTO A;  2WZL A;  2R7X A;  3TK0 A;  2YL1 A;  2LK4 A;  5L0D A;  3MBG A;  1V74 B;  3IQ5 A;  3LNM B;  4JTA B;  4P9F A;  1Q0D A;  2R7W A;  4HFF B;  3WHN A;  1VYK A;  3K1H A;  3LEV A;  4EUK B;  5B3I A;  2OG2 A;  5IY5 C;  3OEO A;  1FNT c;  1OCR C;  2YKZ A;  3DD7 A;  4CS8 A;  4CS8 C;  3HNL A;  5K0I A;  3FOP A;  3PDM P;  2ZXP A;  4O6Y A;  4K0D A;  4U5D E;  2YLI A;  1LE2 A;  1ZZP A;  256B A;  2H7V C;  4JCZ A;  5KYW B;  1TR2 A;  2D5R B;  2YLD A;  3I5Q A;  3US6 A;  2OOC A;  5A6B A;  1GM5 A;  3KYI A;  2Z15 A;  1A7D A;  4DJ9 A;  2HV6 A;  3T4R A;  3E70 C;  3LLK A;  2IM8 A;  2XS1 A;  4MVQ A;  5JRA A;  4JVS A;  5E3A A;  3EGX B;  5COF A;  3IHU A;  2DYR C;  3EH1 A;  4C7O A;  2XLE A;  1GS9 A;  2ASR A;  3ASO C;  1D0Z A;  2A0U A;  2YEV A;  1JRA A;  2A0B A;  1ZW2 A;  2L81 A;  1K04 A;  3JYY A;  3W8I A;  3DE8 A;  2OEV A;  2CNW D; 
#chains in the Genus database with same CATH homology
 3HTK C;  3JSZ A;  1FMW A;  4KBL A;  3N2Z B;  1ZU5 A;  2X51 A;  4M63 A;  2C03 A;  3OA1 A;  3UGP A;  5KYU A;  1TWG A;  3DJN B;  3CSK A;  3EQL F;  3UMH A;  5KYX B;  3DXJ F;  4G7Z F;  4QDL A;  3ABM C;  3JT1 A;  1OCC C;  2BE5 F;  1ZHZ A;  2A68 F;  2Y3G A;  2WVQ A;  3B0V C;  3QZC A;  4JJF A;  2A1D D;  4OIN F;  2B0J A;  3NRH A;  3LLI A;  1G8X A;  3DAF A;  4G7H F;  4BJ6 C;  1D1C A;  2Q9A A;  3RH3 A;  4BJ6 A;  3EG9 A;  3POV A;  2WVO A;  2Q9B A;  2MYS A;  4OIR F;  2G3V A;  2NUT A;  4KNW A;  4IJJ A;  4PK4 A;  4C3B A;  4CSA C;  4PJJ A;  4CSA A;  1FMV A;  1KU2 A;  4XLN F;  4DVZ A;  2IYL D;  4YT2 A;  2EIL C;  1M56 C;  4NY3 A;  4AE4 B;  4JZA A;  3KL4 A;  3B9Q A;  2EIJ C;  1FFT C;  1RJ9 A;  3FAJ A;  4O7G A;  4YT4 A;  4EBB A;  2J9V A;  3JCU Q;  4A2N B;  1V54 C;  1N1C A;  1PD0 A;  4YJW A;  1ST6 A;  4CS9 C;  4CS9 A;  4RD9 A;  3EGD A;  3S0X A;  3X2Q C;  4I3M A;  4X0R A;  3EFO A;  3EZI A;  3IEE A;  2EIK C;  5EGY A;  1OKK D;  2KNH A;  2YZS A;  3CQZ A;  1LVK A;  3EHM A;  5T1D B;  2CW0 F;  5B1A C;  1QLE C;  3K1I C;  3ZG1 A;  4RDA A;  4Q4Z F;  1Z6A A;  2J7P A;  4I1O B;  1W2W A;  2P6V A;  2R7Q A;  4E7Z A;  2I8B A;  3L34 A;  4RBN A;  1D0Y A;  4Q5S F;  3VYW A;  4CS7 A;  3UNG C;  4O6M A;  2Y3H A;  4H4K C;  3K6B A;  3ASN C;  2LSE A;  2ZXO A;  5B1B C;  3DMD A;  4HFK B;  4U5G A;  4PJN A;  5KYW A;  3LNR A;  4OD4 A;  2PX0 A;  2VH3 A;  2ZXW C;  5DVW A;  2ZPA A;  5BUO A;  3VAY A;  4JJG A;  2J9U A;  3EGX A;  3EZH A;  4XLP F;  4PFO A;  4FWV A;  2YHS A;  1ZHT A;  1M2V B;  4C3E A;  2H7O A;  4O79 A;  3X1O A;  2J45 A;  4EWC A;  3DZA A;  3AG3 C;  3O39 A;  4WJ0 A;  2QTV A;  2KJG A;  3NKE A;  5DLJ A;  3AG2 C;  2R7R A;  1PCX A;  3S29 A;  3RKO F;  4QI0 A;  5DQT A;  4U5E E;  1NZE A;  3RFY A;  3SP1 A;  4OIP F;  2W9Y A;  3JYH A;  2CNW A;  4XWJ A;  1NG1 A;  2XXA B;  4K7B A;  4ZLC A;  2IXP A;  5KYX A;  3NYJ A;  3MLG A;  3EH2 A;  3RYL A;  5L3V A;  3I5P A;  4PJL A;  2G3K A;  3LJB A;  1Z3I X;  3FHD A;  2A6H F;  4IAO A;  3HLZ A;  1Z23 A;  3WG7 C;  1TKN A;  3AQC A;  3UR3 C;  3S28 A;  4B6I A;  3KMI A;  3PHF 2;  4U5C E;  3LES A;  3W8H A;  2KGO A;  5D92 A;  2PX3 A;  1MMD A;  2WZF A;  1MMN A;  4BG0 A;  3NYM A;  4MQ9 F;  4DBR A;  5HSW A;  3NDB B;  5T3T A;  2R7T A;  4U5F E;  4F4B A;  2FFH A;  4LER A;  3UMI A;  4U5H A;  4CIH A;  4FX5 A;  4FES A;  3ABL C;  1V55 C;  2JD3 A;  3AQB A;  2J0W A;  4U5B E;  4AE4 A;  3KH2 A;  1TWA A;  3ZVR A;  4CBE A;  3F46 A;  5E2Q A;  4HE8 D;  3UMK A;  3GOD A;  1SF8 A;  4AK9 A;  3EPV A;  3ZC4 A;  1J8M F;  1NU9 C;  3SNH A;  3RIP A;  3CZ6 A;  3UGO A;  4GEH A;  2Y69 C;  4O6N A;  4W8K A;  4OIQ F;  2Q9C A;  4BJ5 C;  4BJ5 A;  5CI8 A;  1QZX A;  4HEA J;  3LAY A;  2O9X A;  4IRU A;  4AX2 A;  2Y3D A;  1SZI A;  1SMY F;  2R7V A;  2ZXR A;  3Q6N A;  2VB6 A;  2Q3T A;  4LLC A;  2A69 F;  4QI2 A;  3NKD A;  2NUP B;  1OKK A;  3LS1 A;  3QMK A;  2IXN A;  3SEO A;  3K7D A;  4MND A;  5DS4 A;  5F5F A;  4BEJ A;  3Q7L A;  3ZIB A;  4JUR I;  1VMA A;  3O6X A;  1M2O A;  1MND A;  4YWQ A;  2WVN A;  4IWB A;  1J8Y F;  5CI9 A;  1FFH A;  5KYY B;  1MMG A;  1WGW A;  3NG1 A;  3ITF A;  1ZU4 A;  4OD5 A;  4OIO F;  2WL8 A;  1JPN A;  1M57 C;  1ZHX A;  1D1B A;  1M2V A;  2CDQ A;  4J30 B;  1ZHW A;  1FTS A;  3MX3 A;  2OCC C;  2GFH A;  2R7S A;  2Y39 A;  1S7Z A;  3N24 A;  3JRT A;  2XRH A;  3DM5 A;  2VAS A;  3HJC A;  3N0T A;  2HV7 A;  3OWT A;  3ECS A;  3DAG A;  1JPJ A;  2IXM A;  2M4E A;  1BR1 A;  1LS1 A;  2W4B A;  5DQZ A;  2XXA A;  3W2V A;  4LAC B;  2EIM C;  4YT5 A;  4C3D A;  3GAN A;  5DS5 A;  2IOQ A;  1TWC A;  1VK5 A;  4C7O B;  3Q6M A;  3LS0 A;  4J32 B;  2DGJ A;  1ZHY A;  1Z63 A;  2MWQ A;  4G0H A;  2J0X A;  3KKB A;  1LKX A;  2H7B A;  4BJT A;  5KYU B;  4GYT A;  3SZR A;  5KYN A;  4P6I C;  2Y3B A;  2QY9 A;  4JW1 A;  4I1M A;  2R7O A;  4PFP A;  1BR4 A;  5T3W A;  3H65 A;  3SYN A;  3I4U A;  2WZG A;  3NYL A;  3B0P A;  5B3S C;  1MMA A;  3M1C B;  4ZLD A;  3V7O A;  2KQ9 A;  3S27 A;  2CGE A;  3T6J A;  5DS6 A;  3FVY A;  4E7S A;  1OCZ C;  1OCO C;  4KC9 A;  3B0U X;  5FCL A;  3EG9 B;  4I44 A;  3AG4 C;  2J9W A;  3F47 A;  1TWH A;  4BJ1 A;  4ANJ A;  5EHH A;  2NUT B;  4Q7C A;  4YN0 B;  5E33 A;  1VOM A;  3PMR A;  3ZSU A;  2PF4 E;  3Q7G A;  1D1A A;  2W4M A;  2W45 A;  4G7O F;  2PP4 A;  5L3Q A;  4ULW A;  2NUP A;  5D91 A;  3DM9 B;  4N06 A;  3FDQ A;  2A6E F;  2DYS C;  3E9V A;  1RJ9 B;  2EIN C;  1O87 A;  1PD1 A;  3AG1 C;  1D0X A;  4DVY P;  1IW7 F;  1ZYR F;  2IXO A;  1NU7 D;  2G62 A;  4YT8 A;  2XL4 A;  4XTK A;  2PFD A;  3T6B A;  1O5H A;  2XSE A;  4KNV A;  3EHN A;  2R7U A;  3EGD B;  4DBQ A;  2FGY A;  3W2W A;  4KI2 A;  3EFO B;  3K33 A;  1IZM A;  2J7P D;  3WOD F;  3DJU B;  2V3C C;  2NG1 A;  3L0I A;  2V26 A;  2L9J A;  4JCH A;  3K66 A;  5KYY A;  2J46 A;  1Z5Z A;  5F5H A;  4DOZ A;  1MNE A;  1BR2 A;  2KW3 C;  2WB7 A;  2P7V A;  1VYI A;  2C04 A;  2E87 A;  5E3C A;  3TD7 A;  4PJM A;  4LLE A;  3ABK C;  3EJN A;  2WZL A;  2R7X A;  2R7W A;  4HFF B;  1VYK A;  3K1H A;  3LEV A;  5IY5 C;  2OG2 A;  3OEO A;  1OCR C;  4CS8 C;  3DD7 A;  4CS8 A;  2ZXP A;  4O6Y A;  4K0D A;  4U5D E;  2H7V C;  5KYW B;  1TR2 A;  2D5R B;  3I5Q A;  2Z15 A;  2HV6 A;  3T4R A;  3E70 C;  3LLK A;  4JVS A;  5E3A A;  3EGX B;  2DYR C;  3EH1 A;  4C7O A;  3ASO C;  1D0Z A;  2YEV A;  2L81 A;  3W8I A;  2CNW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...