2M4IA

Solution structure of bacillus subtilis minc n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'GSHMKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHVKLGNRFLYKEQEEQLTELIASKKDLFVHSIDSEVITKKEAQQIREE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein MinC
publication title Solution structure of Bacillus subtilis MinC N-terminal domain
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.540 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m4iA01
2M4IA
chains in the Genus database with same CATH superfamily
2I9IA 3IWCA 2EORA 2YTDA 4DR1E 4R2CA 5KL6A 2N3HA 3T1YE 5KL4A 4RHBB 4R2DA 2GPIA 1UBDC 4I8OA 2R1FA 4BC9A 4LF6E 2JWOA 1A1HA 4GZNC 2YTGA 2KHXA 4K0KE 4TUIA 1KYQA 2YTPA 5TSEA 2CPNA 5AE3A 1A1GA 2B7TA 2VF1A 1EH8A 1GTKA 2EMWA 2L3JA 2EOFA 2EN8A 2EMLA 4X64E 1XMOE 1XNQE 2EN4A 1HNXE 2B3TB 3MHHC 2WZOA 2EPNA 4ZYEA 3VYYA 4NXME 2VQFE 1A1LA 4NHRA 1WXRA 1DGCA 4F6NA 2MC5A 1QNTA 2YTNA 2L2NA 2RQLA 1YYWA 2VQEE 1QU6A 2YRHA 3VK6A 2V83A 1TN9A 4ZYHA 2BB8A 2EOOA 2EM3A 2FV4B 1SR9A 2EE8A 4LFAE 4BMJA 2JVAA 3H09A 4HTGA 4L8NA 4R2EA 2EM9A 3J80C 2NA2A 4M30A 4LF4E 1N33E 1PJSA 3EPLA 4DUZE 1TF3A 2KOUA 4WXDA 2MC6A 2ODRC 2DRPA 1B69A 4ZYGA 1J26A 4LTYA 4R03A 4DMIA 5KL3A 3LMLA 3HTXA 1T4NA 1Z1BA 2LV2A 4OOGC 2EPAA 5IT9C 1AH5A 1IBKE 3JTZA 2LUQA 3DF6A 3MHSC 2G7HA 2V85A 4JI2E 4MLQA 3M99B 4KWYA 2L2MA 5AE1A 5A6JA 5A6BA 4P78A 2L92A 4L5NC 4DR2E 4TUGA 3HPSA 2EL5A 2EQ0A 1T4LB 2UXCE 2HJJA 2EQ1A 2EQ3A 1ZBTA 5A6AA 4NZVA 3HQ1A 2JR1A 2YRKA 2EPUA 3FIGA 1G2FC 4O24A 4R2SA 4BC7A 3MSWA 2L2KB 2YTIA 1O0WA 1WHQA 2H36X 2EPOA 2EOSA 4LU9A 4RH8A 2YU5A 4DV0E 2HC5A 2M1SA 3THOB 1L4SA 5KL7A 5A69A 2HGHA 2PRTA 1X49A 2ADRA 2D9HA 2M9AA 1A1KA 2HHHE 1UILA 4ZYDA 2EN6A 2EPZA 2V87A 1T38A 1ZAAC 2DGCA 4JI0E 4JYAE 2DLQA 4X9JA 3HPZA 4WFTA 1ZR9A 2ELYA 5KL5A 2WBSA 2LT7A 2UUBE 2Q8UA 1HNZE 1MGTA 4JI1E 2EOXA 2EMGA 1PJTA 1RC7A 2RPCA 2L3CA 1PKPA 1PJQA 2DMYA 4X66E 2EOEA 2LVHA 1WRJA 3DJWA 2B9DA 5LLQA 2EWLA 1SFEA 2LMZA 2EMHA 3IWDA 4B3ME 3KZYA 4N4RB 3ADGA 2YTQA 2F4VE 4P7DA 1X48A 2EMFA 4WXCA 1HR0E 2EN2A 1YYKA 2EMKA 3OTOE 1X6FA 2YPNA 3IWBA 4JI6E 5KL2A 4J8ZA 4LF9E 2KONA 2JP9A 5CFFE 3LLHA 1YPNA 1JK1A 4B3TE 1YYOA 4LF7E 4KZSA 2LBSB 4WSGA 4BHBA 2EM5A 2WCC3 2K4VA 1DI2A 2RS7A 5F3WA 4DR7E 2DSYA 2EOHA 4O4KA 1A1IA 2EM4A 2B7VA 4WSPA 5A6BD 4WPYA 4DR4E 4F9AB 2EMYA 2N8XA 2EL6A 2L33A 3QG5C 4MLVA 5LL6R 1EKZA 4DR3E 1LLMC 2UXBE 2JOXA 2LCEA 2ZM6E 2ODRD 4AQYE 2CTDA 2L6MA 3F6GA 3KWRA 2EL4A 4DR5E 4WYQB 1YUIA 1ZU1A 2EM0A 2FGGA 4X62E 4JI8E 2JPAA 1IMUA 3JAMC 2EPXA 2L8TA 2ENAA 5LMNE 2FTXB 2LRSA 4R2QA 2EM7A 2YSOA 3OMLA 2DMIA 2YT4A 2LTSA 4FK5C 1IBME 4DR6E 2EMZA 4R8OA 4DV4E 1X6HA 2UXDE 2LO3A 2GLIA 1RMDA 3J7AG 4YY3E 2EPLX 4WX9A 2EJ4A 2EOZA 5AASA 2YTFA 4JI4E 3ZOQB 2VE7C 3BF2A 3KZZA 1A1FA 1AAYA 2EM8A 2A25A 1DQ3A 4BS9A 2R76A 4B3RE 1UN6B 2EOYA 3VYXA 2NABA 5LMUE 4O43A 3RMPA 3C4TA 5AE2A 4DUYE 2UU9E 1X6EA 2EOQA 2YZTA 4JI7E 2YWQA 1YZ9A 2YU8A 1BBGA 2EN3A 1JK2A 1EH6A 3ADIA 4X8WA 1KJKA 1A1JA 2UUAE 1EH7A 2MDGA 2V8QB 4R2AA 2YSPA 2YTOA 4BHCA 5DNYA 2EPMX 4IJDA 1XNRE 1TF6A 2JY9A 5IXMB 4GKKE 4JI3E 4LFBE 2MKDA 2LE2A 2E5LE 1WJPA 3THNA 1PDAA 2VRDA 2CSHA 5T6JA 2EPPA 4M2ZA 4BBYA 2WBUA 2EOJA 4LF8E 2M4IA 2DLKA 5A6KA 2EMXA 3P1XA 2N3GA 4R2PA 2NUFA 2DIXA 5FLXC 5AC4A 1UHZA 3AUZA 3C4BA 4DV2E 4GEQB 2V89A 4F54A 2RSIA 2LUPB 1T39A 1GQEA 3EPKA 4DKKA 3T1HE 2EM6A 1I94E 3EQ1A 2YTJA 1MEYC 1YSAC 2LJUA 1ZBQA 4JI5E 2EPCA 3EPJA 1T4OA 4DV5E 3K6QA 1N34E 4M9VC 2GHFA 2EPRA 4Q28A 4DV1E 3ADLA 1WHNA 1N3GA 1N36E 2E1MA 4B3SE 4GKJE 4DV6E 4NXNE 2ELZA 4OX9E 3BIDA 2JYAA 1X47A 1FJGE 4O5GA 4F9BB 2EMAA 1X3CA 2E72A 3HXLA 1F2IG 2ENCA 1FKAE 3BGHA 4LF5E 1N32E 2CT1A 1IQOA 2EMBA 5ADZA 3EPHA 3J7Yp 2RTXA 3VHTB 1X5WA 2F8BA 5IV8B 4YHHE 2EMCA 2RSMA 4JV5E 5IWAE 2WBTA 2IHR1 1YFHA 2V88A 4DV7E 4LFCE 4X65E 2LTRA 4R2RA 1NEIA 2J7JA 1YUJA 2EOIA 3BBGA 1IQSA 2YTEA 4BCAA 4Q35B 2EPKX 5A2QC 2I13A 1RQ0A 2LJHA 4HEIA 1IBLE 3JU0A 4F2JC 1P47A 2EZ6A 1BBOA 3UK3C 4DV3E 3ECRA 1HNWE 2EOMA 1NCSA 2V86A 3TQMA 2EMIA 5BR8E 2NUEA 2JXPA 2K7IA 3ADJA 2YRMA 4KHPE 2DB2A 2MDRA 2M7QA 4IS1C 3AV0A 3C6KA 2UUCE 2BBGA 2ENHA 1J5EE 3J81C 3F6HA 4F9CB 2EN7A 2RS6A 4F6MA 2EP3A 1STUA 1BB8A 2MKNA 2NUGA 2EM2A 3C6MA 2EN1A 1XMQE 3L00A 5AC5A 1G2DC 2JOBA 1GZ6A 4M0VA
chains in the Genus database with same CATH topology
2L92A 2ODRD 4L5NC 3IWCA 4DR2E 2L6MA 2DIXA 4AQYE 3F6GA 3KWRA 3HPSA 4TUGA 4DR1E 5FLXC 4WYQB 4DR5E 2N3HA 3T1YE 1T4LB 2UXCE 1UHZA 3AUZA 3C4BA 4DV2E 1ZBTA 4I8OA 4GEQB 3HQ1A 2JR1A 2V89A 3FIGA 4F54A 2FGGA 4BC9A 4X62E 2LUPB 4LF6E 2JWOA 1GQEA 4JI8E 4DKKA 3T1HE 1I94E 4BC7A 3JAMC 3MSWA 2L2KB 2NUFA 1DI2A 1O0WA 2L8TA 1ZBQA 5LMNE 1WHQA 2FTXB 2KHXA 2H36X 2LRSA 4TUIA 4JI5E 4K0KE 1T4OA 3P1XA 3OMLA 4LU9A 2CPNA 5AE3A 4DV5E 2YT4A 3K6QA 4DV0E 1N34E 2LTSA 1IBME 4DR6E 2M1SA 4R8OA 4DV4E 2UXDE 2B7TA 2VF1A 4Q28A 4DV1E 1X49A 1WHNA 2L3JA 3ADLA 3J7AG 1N36E 2HHHE 1UILA 2E1MA 4YY3E 4X64E 2V87A 1XMOE 4B3SE 4JI0E 1XNQE 4JYAE 4GKJE 5AASA 4DV6E 2B3TB 1HNXE 4NXNE 4JI4E 3HPZA 4WFTA 3ZOQB 4OX9E 2VE7C 2WZOA 2UUBE 1HNZE 1X47A 1FJGE 4JI1E 3VYYA 4NXME 1RC7A 2VQFE 4F9BB 2L3CA 1PKPA 1WXRA 3HXLA 2DMYA 1FKAE 1DQ3A 4LF5E 4BS9A 1N32E 4X66E 4B3RE 5ADZA 3DJWA 3J7Yp 2MC5A 2RTXA 2B9DA 3VYXA 5LMUE 2EWLA 2L2NA 3RMPA 2LMZA 2F8BA 1YYWA 3IWDA 2VQEE 3C4TA 1QU6A 4B3ME 3VK6A 4YHHE 3ADGA 2RSMA 2V83A 4JV5E 2F4VE 4P7DA 1X48A 5AE2A 5IWAE 1HR0E 4DUYE 2IHR1 2UU9E 1YYKA 2V88A 3OTOE 4DV7E 2FV4B 3IWBA 1SR9A 4JI6E 4LFAE 4BMJA 4LFCE 4J8ZA 4X65E 4LF9E 2KONA 2LTRA 2YZTA 4JI7E 5CFFE 1YZ9A 3LLHA 2JVAA 3H09A 4B3TE 4BCAA 1YYOA 4L8NA 3J80C 4LF7E 3ADIA 4KZSA 5A2QC 4X8WA 1RQ0A 2LJHA 2NA2A 4M30A 1IBLE 2UUAE 4LF4E 4DUZE 1N33E 3JU0A 2EZ6A 2KOUA 2LBSB 2MC6A 2V8QB 2ODRC 4DV3E 5DNYA 1HNWE 1XNRE 1J26A 4LTYA 2K4VA 4R03A 2JY9A 4DMIA 2V86A 2RS7A 3LMLA 5BR8E 5F3WA 2NUEA 3HTXA 1T4NA 4DR7E 2DSYA 3ADJA 4JI3E 4LFBE 4GKKE 4KHPE 2DB2A 2LE2A 2MDRA 2B7VA 4WSPA 4OOGC 2M7QA 2E5LE 3AV0A 2UUCE 4WPYA 5IT9C 1IBKE 4DR4E 1J5EE 3JTZA 3J81C 2LUQA 3F6HA 3DF6A 4F9CB 2G7HA 2RS6A 2V85A 4F9AB 5T6JA 4JI2E 2L33A 1STUA 4M2ZA 5LL6R 2NUGA 1XMQE 4BBYA 1EKZA 4DR3E 4LF8E 2M4IA 2L2MA 5AE1A 2JOXA 2ZM6E 2UXBE 4P78A 2JOBA 1GZ6A 2N3GA 4M0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4I A; 
#chains in the Genus database with same CATH topology
 2I9I A;  3IWC A;  2EOR A;  2YTD A;  4DR1 E;  4R2C A;  5KL6 A;  2N3H A;  3T1Y E;  5KL4 A;  4RHB B;  4R2D A;  2GPI A;  1UBD C;  4I8O A;  2R1F A;  4BC9 A;  4LF6 E;  2JWO A;  1A1H A;  4GZN C;  2YTG A;  2KHX A;  4K0K E;  4TUI A;  1KYQ A;  2YTP A;  5TSE A;  2CPN A;  5AE3 A;  1A1G A;  2B7T A;  2VF1 A;  1EH8 A;  1GTK A;  2EMW A;  2L3J A;  2EOF A;  2EN8 A;  2EML A;  4X64 E;  1XMO E;  1XNQ E;  2EN4 A;  1HNX E;  2B3T B;  3MHH C;  2WZO A;  2EPN A;  4ZYE A;  3VYY A;  4NXM E;  2VQF E;  1A1L A;  4NHR A;  1WXR A;  1DGC A;  4F6N A;  2MC5 A;  1QNT A;  2YTN A;  2L2N A;  2RQL A;  1YYW A;  2VQE E;  1QU6 A;  2YRH A;  3VK6 A;  2V83 A;  1TN9 A;  4ZYH A;  2BB8 A;  2EOO A;  2EM3 A;  2FV4 B;  1SR9 A;  2EE8 A;  4LFA E;  4BMJ A;  2JVA A;  3H09 A;  4HTG A;  4L8N A;  4R2E A;  2EM9 A;  3J80 C;  2NA2 A;  4M30 A;  4LF4 E;  1N33 E;  1PJS A;  3EPL A;  4DUZ E;  1TF3 A;  2KOU A;  4WXD A;  2MC6 A;  2ODR C;  2DRP A;  1B69 A;  4ZYG A;  1J26 A;  4LTY A;  4R03 A;  4DMI A;  5KL3 A;  3LML A;  3HTX A;  1T4N A;  1Z1B A;  2LV2 A;  4OOG C;  2EPA A;  5IT9 C;  1AH5 A;  1IBK E;  3JTZ A;  2LUQ A;  3DF6 A;  3MHS C;  2G7H A;  2V85 A;  4JI2 E;  4MLQ A;  3M99 B;  4KWY A;  2L2M A;  5AE1 A;  5A6J A;  5A6B A;  4P78 A;  2L92 A;  4L5N C;  4DR2 E;  4TUG A;  3HPS A;  2EL5 A;  2EQ0 A;  1T4L B;  2UXC E;  2HJJ A;  2EQ1 A;  2EQ3 A;  1ZBT A;  5A6A A;  4NZV A;  3HQ1 A;  2JR1 A;  2YRK A;  2EPU A;  3FIG A;  1G2F C;  4O24 A;  4R2S A;  4BC7 A;  3MSW A;  2L2K B;  2YTI A;  1O0W A;  1WHQ A;  2H36 X;  2EPO A;  2EOS A;  4LU9 A;  4RH8 A;  2YU5 A;  4DV0 E;  2HC5 A;  2M1S A;  3THO B;  1L4S A;  5KL7 A;  5A69 A;  2HGH A;  2PRT A;  1X49 A;  2ADR A;  2D9H A;  2M9A A;  1A1K A;  2HHH E;  1UIL A;  4ZYD A;  2EN6 A;  2EPZ A;  2V87 A;  1T38 A;  1ZAA C;  2DGC A;  4JI0 E;  4JYA E;  2DLQ A;  4X9J A;  3HPZ A;  4WFT A;  1ZR9 A;  2ELY A;  5KL5 A;  2WBS A;  2LT7 A;  2UUB E;  2Q8U A;  1HNZ E;  1MGT A;  4JI1 E;  2EOX A;  2EMG A;  1PJT A;  1RC7 A;  2RPC A;  2L3C A;  1PKP A;  1PJQ A;  2DMY A;  4X66 E;  2EOE A;  2LVH A;  1WRJ A;  3DJW A;  2B9D A;  5LLQ A;  2EWL A;  1SFE A;  2LMZ A;  2EMH A;  3IWD A;  4B3M E;  3KZY A;  4N4R B;  3ADG A;  2YTQ A;  2F4V E;  4P7D A;  1X48 A;  2EMF A;  4WXC A;  1HR0 E;  2EN2 A;  1YYK A;  2EMK A;  3OTO E;  1X6F A;  2YPN A;  3IWB A;  4JI6 E;  5KL2 A;  4J8Z A;  4LF9 E;  2KON A;  2JP9 A;  5CFF E;  3LLH A;  1YPN A;  1JK1 A;  4B3T E;  1YYO A;  4LF7 E;  4KZS A;  2LBS B;  4WSG A;  4BHB A;  2EM5 A;  2WCC 3;  2K4V A;  1DI2 A;  2RS7 A;  5F3W A;  4DR7 E;  2DSY A;  2EOH A;  4O4K A;  1A1I A;  2EM4 A;  2B7V A;  4WSP A;  5A6B D;  4WPY A;  4DR4 E;  4F9A B;  2EMY A;  2N8X A;  2EL6 A;  2L33 A;  3QG5 C;  4MLV A;  5LL6 R;  1EKZ A;  4DR3 E;  1LLM C;  2UXB E;  2JOX A;  2LCE A;  2ZM6 E;  2ODR D;  4AQY E;  2CTD A;  2L6M A;  3F6G A;  3KWR A;  2EL4 A;  4DR5 E;  4WYQ B;  1YUI A;  1ZU1 A;  2EM0 A;  2FGG A;  4X62 E;  4JI8 E;  2JPA A;  1IMU A;  3JAM C;  2EPX A;  2L8T A;  2ENA A;  5LMN E;  2FTX B;  2LRS A;  4R2Q A;  2EM7 A;  2YSO A;  3OML A;  2DMI A;  2YT4 A;  2LTS A;  4FK5 C;  1IBM E;  4DR6 E;  2EMZ A;  4R8O A;  4DV4 E;  1X6H A;  2UXD E;  2LO3 A;  2GLI A;  1RMD A;  3J7A G;  4YY3 E;  2EPL X;  4WX9 A;  2EJ4 A;  2EOZ A;  5AAS A;  2YTF A;  4JI4 E;  3ZOQ B;  2VE7 C;  3BF2 A;  3KZZ A;  1A1F A;  1AAY A;  2EM8 A;  2A25 A;  1DQ3 A;  4BS9 A;  2R76 A;  4B3R E;  1UN6 B;  2EOY A;  3VYX A;  2NAB A;  5LMU E;  4O43 A;  3RMP A;  3C4T A;  5AE2 A;  4DUY E;  2UU9 E;  1X6E A;  2EOQ A;  2YZT A;  4JI7 E;  2YWQ A;  1YZ9 A;  2YU8 A;  1BBG A;  2EN3 A;  1JK2 A;  1EH6 A;  3ADI A;  4X8W A;  1KJK A;  1A1J A;  2UUA E;  1EH7 A;  2MDG A;  2V8Q B;  4R2A A;  2YSP A;  2YTO A;  4BHC A;  5DNY A;  2EPM X;  4IJD A;  1XNR E;  1TF6 A;  2JY9 A;  5IXM B;  4GKK E;  4JI3 E;  4LFB E;  2MKD A;  2LE2 A;  2E5L E;  1WJP A;  3THN A;  1PDA A;  2VRD A;  2CSH A;  5T6J A;  2EPP A;  4M2Z A;  4BBY A;  2WBU A;  2EOJ A;  4LF8 E;  2M4I A;  2DLK A;  5A6K A;  2EMX A;  3P1X A;  2N3G A;  4R2P A;  2NUF A;  2DIX A;  5FLX C;  5AC4 A;  1UHZ A;  3AUZ A;  3C4B A;  4DV2 E;  4GEQ B;  2V89 A;  4F54 A;  2RSI A;  2LUP B;  1T39 A;  1GQE A;  3EPK A;  4DKK A;  3T1H E;  2EM6 A;  1I94 E;  3EQ1 A;  2YTJ A;  1MEY C;  1YSA C;  2LJU A;  1ZBQ A;  4JI5 E;  2EPC A;  3EPJ A;  1T4O A;  4DV5 E;  3K6Q A;  1N34 E;  4M9V C;  2GHF A;  2EPR A;  4Q28 A;  4DV1 E;  3ADL A;  1WHN A;  1N3G A;  1N36 E;  2E1M A;  4B3S E;  4GKJ E;  4DV6 E;  4NXN E;  2ELZ A;  4OX9 E;  3BID A;  2JYA A;  1X47 A;  1FJG E;  4O5G A;  4F9B B;  2EMA A;  1X3C A;  2E72 A;  3HXL A;  1F2I G;  2ENC A;  1FKA E;  3BGH A;  4LF5 E;  1N32 E;  2CT1 A;  1IQO A;  2EMB A;  5ADZ A;  3EPH A;  3J7Y p;  2RTX A;  3VHT B;  1X5W A;  2F8B A;  5IV8 B;  4YHH E;  2EMC A;  2RSM A;  4JV5 E;  5IWA E;  2WBT A;  2IHR 1;  1YFH A;  2V88 A;  4DV7 E;  4LFC E;  4X65 E;  2LTR A;  4R2R A;  1NEI A;  2J7J A;  1YUJ A;  2EOI A;  3BBG A;  1IQS A;  2YTE A;  4BCA A;  4Q35 B;  2EPK X;  5A2Q C;  2I13 A;  1RQ0 A;  2LJH A;  4HEI A;  1IBL E;  3JU0 A;  4F2J C;  1P47 A;  2EZ6 A;  1BBO A;  3UK3 C;  4DV3 E;  3ECR A;  1HNW E;  2EOM A;  1NCS A;  2V86 A;  3TQM A;  2EMI A;  5BR8 E;  2NUE A;  2JXP A;  2K7I A;  3ADJ A;  2YRM A;  4KHP E;  2DB2 A;  2MDR A;  2M7Q A;  4IS1 C;  3AV0 A;  3C6K A;  2UUC E;  2BBG A;  2ENH A;  1J5E E;  3J81 C;  3F6H A;  4F9C B;  2EN7 A;  2RS6 A;  4F6M A;  2EP3 A;  1STU A;  1BB8 A;  2MKN A;  2NUG A;  2EM2 A;  3C6M A;  2EN1 A;  1XMQ E;  3L00 A;  5AC5 A;  1G2D C;  2JOB A;  1GZ6 A;  4M0V A; 
#chains in the Genus database with same CATH homology
 2L92 A;  2ODR D;  4L5N C;  3IWC A;  4DR2 E;  2L6M A;  2DIX A;  4AQY E;  3F6G A;  3KWR A;  3HPS A;  4TUG A;  4DR1 E;  5FLX C;  4WYQ B;  4DR5 E;  2N3H A;  3T1Y E;  1T4L B;  2UXC E;  1UHZ A;  3AUZ A;  3C4B A;  4DV2 E;  1ZBT A;  4I8O A;  4GEQ B;  3HQ1 A;  2JR1 A;  2V89 A;  3FIG A;  4F54 A;  2FGG A;  4BC9 A;  4X62 E;  2LUP B;  4LF6 E;  2JWO A;  1GQE A;  4JI8 E;  4DKK A;  3T1H E;  1I94 E;  4BC7 A;  3JAM C;  3MSW A;  2L2K B;  2NUF A;  1DI2 A;  1O0W A;  2L8T A;  1ZBQ A;  5LMN E;  1WHQ A;  2FTX B;  2KHX A;  2H36 X;  2LRS A;  4TUI A;  4JI5 E;  4K0K E;  1T4O A;  3P1X A;  3OML A;  4LU9 A;  2CPN A;  5AE3 A;  4DV5 E;  2YT4 A;  3K6Q A;  4DV0 E;  1N34 E;  2LTS A;  1IBM E;  4DR6 E;  2M1S A;  4R8O A;  4DV4 E;  2UXD E;  2B7T A;  2VF1 A;  4Q28 A;  4DV1 E;  1X49 A;  1WHN A;  2L3J A;  3ADL A;  3J7A G;  1N36 E;  2HHH E;  1UIL A;  2E1M A;  4YY3 E;  4X64 E;  2V87 A;  1XMO E;  4B3S E;  4JI0 E;  1XNQ E;  4JYA E;  4GKJ E;  5AAS A;  4DV6 E;  2B3T B;  1HNX E;  4NXN E;  4JI4 E;  3HPZ A;  4WFT A;  3ZOQ B;  4OX9 E;  2VE7 C;  2WZO A;  2UUB E;  1HNZ E;  1X47 A;  1FJG E;  4JI1 E;  3VYY A;  4NXM E;  1RC7 A;  2VQF E;  4F9B B;  2L3C A;  1PKP A;  1WXR A;  3HXL A;  2DMY A;  1FKA E;  1DQ3 A;  4LF5 E;  4BS9 A;  1N32 E;  4X66 E;  4B3R E;  5ADZ A;  3DJW A;  3J7Y p;  2MC5 A;  2RTX A;  2B9D A;  3VYX A;  5LMU E;  2EWL A;  2L2N A;  3RMP A;  2LMZ A;  2F8B A;  1YYW A;  3IWD A;  2VQE E;  3C4T A;  1QU6 A;  4B3M E;  3VK6 A;  4YHH E;  3ADG A;  2RSM A;  2V83 A;  4JV5 E;  2F4V E;  4P7D A;  1X48 A;  5AE2 A;  5IWA E;  1HR0 E;  4DUY E;  2IHR 1;  2UU9 E;  1YYK A;  2V88 A;  3OTO E;  4DV7 E;  2FV4 B;  3IWB A;  1SR9 A;  4JI6 E;  4LFA E;  4BMJ A;  4LFC E;  4J8Z A;  4X65 E;  4LF9 E;  2KON A;  2LTR A;  2YZT A;  4JI7 E;  5CFF E;  1YZ9 A;  3LLH A;  2JVA A;  3H09 A;  4B3T E;  4BCA A;  1YYO A;  4L8N A;  3J80 C;  4LF7 E;  3ADI A;  4KZS A;  5A2Q C;  4X8W A;  1RQ0 A;  2LJH A;  2NA2 A;  4M30 A;  1IBL E;  2UUA E;  4LF4 E;  4DUZ E;  1N33 E;  3JU0 A;  2EZ6 A;  2KOU A;  2LBS B;  2MC6 A;  2V8Q B;  2ODR C;  4DV3 E;  5DNY A;  1HNW E;  1XNR E;  1J26 A;  4LTY A;  2K4V A;  4R03 A;  2JY9 A;  4DMI A;  2V86 A;  2RS7 A;  3LML A;  5BR8 E;  5F3W A;  2NUE A;  3HTX A;  1T4N A;  4DR7 E;  2DSY A;  3ADJ A;  4JI3 E;  4LFB E;  4GKK E;  4KHP E;  2DB2 A;  2LE2 A;  2MDR A;  2B7V A;  4WSP A;  4OOG C;  2M7Q A;  2E5L E;  3AV0 A;  2UUC E;  4WPY A;  5IT9 C;  1IBK E;  4DR4 E;  1J5E E;  3JTZ A;  3J81 C;  2LUQ A;  3F6H A;  3DF6 A;  4F9C B;  2G7H A;  2RS6 A;  2V85 A;  4F9A B;  5T6J A;  4JI2 E;  2L33 A;  1STU A;  4M2Z A;  5LL6 R;  2NUG A;  1XMQ E;  4BBY A;  1EKZ A;  4DR3 E;  4LF8 E;  2M4I A;  2L2M A;  5AE1 A;  2JOX A;  2ZM6 E;  2UXB E;  4P78 A;  2JOB A;  1GZ6 A;  2N3G A;  4M0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...