2M4IA

Solution structure of bacillus subtilis minc n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
GSHMKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHVKLGNRFLYKEQEEQLTELIASKKDLFVHSIDSEVITKKEAQQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein MinC
publication title Solution structure of Bacillus subtilis MinC N-terminal domain
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.540 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m4iA01
2M4IA
chains in the Genus database with same CATH superfamily
5KL3A 2EPLX 4JI2E 1YFHA 2EL6A 1UHZA 3DF6A 2B3TB 2L6MA 2MDRA 4LF7E 2V85A 1DGCA 2UUAE 2HC5A 4BHBA 1SR9A 2ODRD 2G7HA 4OX9E 4BS9A 5A6JA 2DIXA 1IBLE 2EQ3A 2EOIA 5KL6A 1RC7A 1QU6A 1X47A 2EWLA 2EORA 4DMIA 2L33A 5CFFE 2MKDA 1LLMC 3C6KA 1BBOA 2EOYA 3HXLA 2LTRA 2JP9A 3EQ1A 5AE3A 2MDGA 2EOXA 4LF6E 4JI0E 4R2CA 2FV4B 2HJJA 4P7DA 2UXDE 1UBDC 2NUEA 5KL7A 5AE2A 2RPCA 2WCC3 1J5EE 1WRJA 1NEIA 3OTOE 2EMLA 2EPKX 2VRDA 3T1YE 4WSGA 2LT7A 1IBME 2EOZA 2RS6A 5KL5A 2EN1A 3JAMC 1T38A 3OMLA 1T4OA 4X66E 2UUBE 2EPOA 4DKKA 2GPIA 4M9VC 5FLXC 2EMWA 4DV4E 1PKPA 4LF8E 4HEIA 2R76A 1YSAC 4LF4E 4R03A 3ZOQB 5ADZA 5LMNE 1A1IA 4K0KE 2EP3A 1IBKE 4Q28A 4LTYA 3MSWA 1IQOA 2EPRA 3ECRA 2EMHA 4LU9A 2ODRC 2JR1A 4M30A 5IT9C 2IHR1 2UXCE 4ZYEA 5AC4A 1X6HA 2EOJA 2K7IA 2LVHA 4B3ME 2LTSA 2WBTA 2LJHA 2YTFA 3J7AG 3C6MA 4IS1C 2EPMX 3P1XA 1WXRA 1Z1BA 3BF2A 1FKAE 4JV5E 2V89A 1B69A 2L8TA 3HTXA 2UUCE 4YY3E 2EOEA 4F54A 4KZSA 1F2IG 2YWQA 1EH8A 3IWDA 1GZ6A 2EN7A 4YHHE 2LV2A 1I94E 1G2FC 2WZOA 4J8ZA 4OOGC 4BBYA 2DB2A 2DRPA 4DR4E 1BB8A 5IV8B 4WPYA 3JU0A 4X9JA 1HR0E 3THOB 1PJSA 3HQ1A 2EM5A 2EN6A 2EM9A 2A25A 2YTEA 2ENCA 3EPJA 3IWBA 4R8OA 4WFTA 2I13A 1YYKA 5A6BD 4GKKE 4LF5E 2YTIA 5LLQA 2UU9E 4M0VA 1WHNA 4JI8E 1GQEA 4RH8A 3M99B 1RQ0A 2L2KB 2YTJA 3LLHA 1PDAA 2D9HA 3BBGA 1WJPA 2EOOA 3AUZA 2EM7A 4N4RB 2EQ0A 2CPNA 4RHBB 2EMZA 2EMBA 5TSEA 2PRTA 2CT1A 3J81C 2JVAA 2HHHE 4IJDA 4DV3E 4R2SA 2FTXB 1J26A 2EMGA 2EPUA 1FJGE 2YRKA 3VK6A 2YTGA 1L4SA 2RTXA 2V86A 4Q35B 5KL4A 2EM3A 3KWRA 1A1LA 2JXPA 5LL6R 2L2NA 2YZTA 1YUJA 5DNYA 4JI3E 1NCSA 1X6EA 1EH6A 4DUZE 4F6NA 1X49A 4GZNC 4DV6E 3IWCA 2DLQA 2R1FA 4F2JC 4JYAE 1IMUA 2EM2A 2EQ1A 3AV0A 2F8BA 4I8OA 4LFAE 4HTGA 2EL5A 2EN8A 2YRMA 3BIDA 4JI6E 1SFEA 3VHTB 4WX9A 3EPHA 2EOFA 2LCEA 4DR2E 3ADJA 2EOMA 5KL2A 4AQYE 2LMZA 4O24A 1YUIA 1YYOA 4WYQB 4R2AA 2EMXA 2EPNA 2M1SA 1YYWA 1P47A 2WBSA 2E1MA 3VYYA 3JTZA 4NHRA 4NXME 2LO3A 2E72A 3FIGA 3LMLA 2ELZA 4JI1E 1O0WA 2JOXA 2ADRA 1T39A 3K6QA 4DR1E 2DGCA 2EZ6A 4B3TE 1N36E 1ZR9A 2N8XA 3C4BA 2EM0A 2MC5A 1EH7A 1BBGA 1WHQA 2EMFA 1IQSA 1YPNA 2V83A 4TUIA 4O4KA 3TQMA 3ADGA 1MGTA 1JK2A 4DV1E 4DV7E 4TUGA 2B7VA 2YT4A 1N3GA 2GHFA 2NA2A 4WXCA 2LUPB 4DR3E 4M2ZA 2K4VA 2NABA 2Q8UA 4X8WA 2EN3A 4F9CB 4X64E 1A1FA 4R2PA 5IXMB 4O5GA 1AH5A 2EE8A 4BHCA 2EM6A 1N32E 2YSOA 4DR6E 5A2QC 2B9DA 2MKNA 4BC7A 1EKZA 2JPAA 4F6MA 2NUGA 1KYQA 2EM8A 2VQFE 4MLQA 2V87A 4LFBE 2CTDA 5A6KA 5AASA 4MLVA 2YRHA 1ZAAC 4F9AB 1XMQE 3J80C 2ZM6E 2N3GA 4LFCE 3H09A 4B3RE 2VE7C 1X5WA 2BB8A 5AE1A 3ADLA 2L3JA 4B3SE 4ZYGA 2V8QB 2DMYA 2I9IA 2EMIA 4KHPE 4ZYHA 2YSPA 2RSMA 2YU5A 1DQ3A 2KONA 4R2QA 1UN6B 2NUFA 4R2RA 1A1GA 2EPXA 2MC6A 2EMYA 2FGGA 2J7JA 2YPNA 5T6JA 3MHSC 4WSPA 1MEYC 2LBSB 2YU8A 4F9BB 2H36X 2DSYA 3HPSA 5A69A 2LE2A 2L3CA 1QNTA 4FK5C 4P78A 3ADIA 2EMKA 2EL4A 5F3WA 4BCAA 5IWAE 1X6FA 2EOHA 1DI2A 2LUQA 1GTKA 4DV5E 2YTPA 1ZBTA 2YTNA 2KOUA 4X62E 4DV0E 2EMAA 1RMDA 1A1HA 2YTDA 5AC5A 2RS7A 2EN2A 1XNQE 3VYXA 2EOSA 2ELYA 2LJUA 1TN9A 3BGHA 2EOQA 1PJQA 2JY9A 2LRSA 1YZ9A 3KZYA 1XMOE 1T4LB 2L2MA 1A1KA 3EPLA 3HPZA 3EPKA 2ENHA 2V88A 5A6BA 5LMUE 4WXDA 3UK3C 1G2DC 2EPCA 2M9AA 2JOBA 3RMPA 2EPPA 2WBUA 1ZBQA 4R2EA 4DR7E 3T1HE 2EPZA 1PJTA 2YTOA 2JYAA 3F6HA 2EMCA 1HNZE 1KJKA 3MHHC 1TF3A 3QG5C 3DJWA 2RQLA 5BR8E 2E5LE 2VQEE 1AAYA 1STUA 2CSHA 2YTQA 4GEQB 4DV2E 2B7TA 4NZVA 4LF9E 3J7Yp 4KWYA 2DLKA 4JI7E 1HNXE 1N33E 2N3HA 2EM4A 2M4IA 4BMJA 2L92A 4R2DA 4BC9A 2EPAA 1XNRE 3F6GA 1X3CA 4O43A 2F4VE 4DUYE 1T4NA 2DMIA 1A1JA 2HGHA 2EN4A 3KZZA 2ENAA 4ZYDA 2KHXA 2EJ4A 1TF6A 4JI4E 2M7QA 3THNA 3C4TA 1X48A 1ZU1A 4L8NA 4JI5E 2JWOA 1N34E 3L00A 2RSIA 4L5NC 2GLIA 2UXBE 4DR5E 1JK1A 2VF1A 4NXNE 2BBGA 4GKJE 5A6AA 4X65E 1HNWE 1UILA
chains in the Genus database with same CATH topology
4WYQB 4F54A 4KZSA 2M1SA 5F3WA 1YYWA 3IWDA 4BCAA 1GZ6A 5IWAE 4YHHE 4JI2E 1I94E 1DI2A 1UHZA 2E1MA 2LUQA 2WZOA 3DF6A 2B3TB 2DB2A 2L6MA 2MDRA 3JTZA 4J8ZA 4OOGC 2V85A 4BBYA 4DV5E 2UUAE 4LF7E 4NXME 1ZBTA 4WPYA 1SR9A 3FIGA 2ODRD 2G7HA 2KOUA 3JU0A 3LMLA 4X62E 4DV0E 3HQ1A 1HR0E 4BS9A 4JI1E 1O0WA 2DIXA 1IBLE 2JOXA 3IWBA 4R8OA 4WFTA 1RC7A 1YYKA 4OX9E 4GKKE 1QU6A 1X47A 2EWLA 4LF5E 3K6QA 4DMIA 4DR1E 2RS7A 2EZ6A 4B3TE 2L33A 1XNQE 5CFFE 1N36E 3VYXA 3C4BA 2UU9E 4M0VA 1WHNA 2MC5A 4JI8E 1GQEA 1WHQA 3HXLA 2LTRA 2V83A 4TUIA 5AE3A 1RQ0A 2JY9A 2L2KB 3ADGA 3LLHA 2LRSA 1YZ9A 4DV1E 1XMOE 1T4LB 4JI0E 4LF6E 2L2MA 2FV4B 3AUZA 3HPZA 4DV7E 4TUGA 2B7VA 4P7DA 2CPNA 2V88A 2YT4A 2UXDE 2NUEA 5LMUE 2NA2A 2LUPB 4DR3E 4M2ZA 2K4VA 2JOBA 5AE2A 1J5EE 3RMPA 4X8WA 3OTOE 4F9CB 4X64E 1ZBQA 3T1YE 3J81C 3T1HE 1IBME 4DR7E 2JVAA 2HHHE 4DR4E 2RS6A 4DV3E 2FTXB 1J26A 3F6HA 3JAMC 3OMLA 1T4OA 4X66E 1HNZE 1FJGE 1N32E 4DR6E 3DJWA 2UUBE 4DKKA 5A2QC 3VK6A 2B9DA 5BR8E 5FLXC 2E5LE 4BC7A 2VQEE 1EKZA 2RTXA 2V86A 4DV4E 2NUGA 1PKPA 2VQFE 1STUA 4LF8E 3KWRA 4GEQB 5LL6R 4DV2E 4LF4E 2L2NA 2B7TA 2V87A 2YZTA 4R03A 3ZOQB 5ADZA 5LMNE 4LFBE 5DNYA 4LF9E 4JI3E 3J7Yp 5AASA 4K0KE 4JI7E 1HNXE 1N33E 1IBKE 2N3HA 4Q28A 4F9AB 4DUZE 2M4IA 4LTYA 1XMQE 3MSWA 3J80C 2ZM6E 1X49A 4BMJA 2L92A 2N3GA 4BC9A 4LU9A 4LFCE 3H09A 2ODRC 4DV6E 2JR1A 2VE7C 3F6GA 4M30A 5IT9C 1XNRE 4B3RE 2IHR1 2UXCE 2F4VE 3IWCA 5AE1A 4DUYE 3ADLA 4JYAE 1T4NA 2L3JA 3AV0A 2F8BA 4B3SE 2V8QB 2DMYA 4I8OA 4B3ME 4KHPE 4LFAE 3ADIA 2LTSA 3J7AG 2LJHA 2RSMA 2KHXA 4JI6E 1DQ3A 2KONA 4JI4E 2NUFA 2M7QA 2MC6A 3VYYA 2FGGA 3C4TA 1X48A 3P1XA 4WSPA 5T6JA 1WXRA 2LBSB 4F9BB 2H36X 2DSYA 4L8NA 4DR2E 3HPSA 1FKAE 2JWOA 1N34E 4JI5E 4JV5E 2V89A 3ADJA 4L5NC 2LE2A 2UXBE 4DR5E 2L8TA 2VF1A 2L3CA 4AQYE 4NXNE 3HTXA 2UUCE 4GKJE 4X65E 1HNWE 2LMZA 1UILA 4P78A 4YY3E 1YYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4I A; 
#chains in the Genus database with same CATH topology
 5KL3 A;  2EPL X;  4JI2 E;  1YFH A;  2EL6 A;  1UHZ A;  3DF6 A;  2B3T B;  2L6M A;  2MDR A;  4LF7 E;  2V85 A;  1DGC A;  2UUA E;  2HC5 A;  4BHB A;  1SR9 A;  2ODR D;  2G7H A;  4OX9 E;  4BS9 A;  5A6J A;  2DIX A;  1IBL E;  2EQ3 A;  2EOI A;  5KL6 A;  1RC7 A;  1QU6 A;  1X47 A;  2EWL A;  2EOR A;  4DMI A;  2L33 A;  5CFF E;  2MKD A;  1LLM C;  3C6K A;  1BBO A;  2EOY A;  3HXL A;  2LTR A;  2JP9 A;  3EQ1 A;  5AE3 A;  2MDG A;  2EOX A;  4LF6 E;  4JI0 E;  4R2C A;  2FV4 B;  2HJJ A;  4P7D A;  2UXD E;  1UBD C;  2NUE A;  5KL7 A;  5AE2 A;  2RPC A;  2WCC 3;  1J5E E;  1WRJ A;  1NEI A;  3OTO E;  2EML A;  2EPK X;  2VRD A;  3T1Y E;  4WSG A;  2LT7 A;  1IBM E;  2EOZ A;  2RS6 A;  5KL5 A;  2EN1 A;  3JAM C;  1T38 A;  3OML A;  1T4O A;  4X66 E;  2UUB E;  2EPO A;  4DKK A;  2GPI A;  4M9V C;  5FLX C;  2EMW A;  4DV4 E;  1PKP A;  4LF8 E;  4HEI A;  2R76 A;  1YSA C;  4LF4 E;  4R03 A;  3ZOQ B;  5ADZ A;  5LMN E;  1A1I A;  4K0K E;  2EP3 A;  1IBK E;  4Q28 A;  4LTY A;  3MSW A;  1IQO A;  2EPR A;  3ECR A;  2EMH A;  4LU9 A;  2ODR C;  2JR1 A;  4M30 A;  5IT9 C;  2IHR 1;  2UXC E;  4ZYE A;  5AC4 A;  1X6H A;  2EOJ A;  2K7I A;  2LVH A;  4B3M E;  2LTS A;  2WBT A;  2LJH A;  2YTF A;  3J7A G;  3C6M A;  4IS1 C;  2EPM X;  3P1X A;  1WXR A;  1Z1B A;  3BF2 A;  1FKA E;  4JV5 E;  2V89 A;  1B69 A;  2L8T A;  3HTX A;  2UUC E;  4YY3 E;  2EOE A;  4F54 A;  4KZS A;  1F2I G;  2YWQ A;  1EH8 A;  3IWD A;  1GZ6 A;  2EN7 A;  4YHH E;  2LV2 A;  1I94 E;  1G2F C;  2WZO A;  4J8Z A;  4OOG C;  4BBY A;  2DB2 A;  2DRP A;  4DR4 E;  1BB8 A;  5IV8 B;  4WPY A;  3JU0 A;  4X9J A;  1HR0 E;  3THO B;  1PJS A;  3HQ1 A;  2EM5 A;  2EN6 A;  2EM9 A;  2A25 A;  2YTE A;  2ENC A;  3EPJ A;  3IWB A;  4R8O A;  4WFT A;  2I13 A;  1YYK A;  5A6B D;  4GKK E;  4LF5 E;  2YTI A;  5LLQ A;  2UU9 E;  4M0V A;  1WHN A;  4JI8 E;  1GQE A;  4RH8 A;  3M99 B;  1RQ0 A;  2L2K B;  2YTJ A;  3LLH A;  1PDA A;  2D9H A;  3BBG A;  1WJP A;  2EOO A;  3AUZ A;  2EM7 A;  4N4R B;  2EQ0 A;  2CPN A;  4RHB B;  2EMZ A;  2EMB A;  5TSE A;  2PRT A;  2CT1 A;  3J81 C;  2JVA A;  2HHH E;  4IJD A;  4DV3 E;  4R2S A;  2FTX B;  1J26 A;  2EMG A;  2EPU A;  1FJG E;  2YRK A;  3VK6 A;  2YTG A;  1L4S A;  2RTX A;  2V86 A;  4Q35 B;  5KL4 A;  2EM3 A;  3KWR A;  1A1L A;  2JXP A;  5LL6 R;  2L2N A;  2YZT A;  1YUJ A;  5DNY A;  4JI3 E;  1NCS A;  1X6E A;  1EH6 A;  4DUZ E;  4F6N A;  1X49 A;  4GZN C;  4DV6 E;  3IWC A;  2DLQ A;  2R1F A;  4F2J C;  4JYA E;  1IMU A;  2EM2 A;  2EQ1 A;  3AV0 A;  2F8B A;  4I8O A;  4LFA E;  4HTG A;  2EL5 A;  2EN8 A;  2YRM A;  3BID A;  4JI6 E;  1SFE A;  3VHT B;  4WX9 A;  3EPH A;  2EOF A;  2LCE A;  4DR2 E;  3ADJ A;  2EOM A;  5KL2 A;  4AQY E;  2LMZ A;  4O24 A;  1YUI A;  1YYO A;  4WYQ B;  4R2A A;  2EMX A;  2EPN A;  2M1S A;  1YYW A;  1P47 A;  2WBS A;  2E1M A;  3VYY A;  3JTZ A;  4NHR A;  4NXM E;  2LO3 A;  2E72 A;  3FIG A;  3LML A;  2ELZ A;  4JI1 E;  1O0W A;  2JOX A;  2ADR A;  1T39 A;  3K6Q A;  4DR1 E;  2DGC A;  2EZ6 A;  4B3T E;  1N36 E;  1ZR9 A;  2N8X A;  3C4B A;  2EM0 A;  2MC5 A;  1EH7 A;  1BBG A;  1WHQ A;  2EMF A;  1IQS A;  1YPN A;  2V83 A;  4TUI A;  4O4K A;  3TQM A;  3ADG A;  1MGT A;  1JK2 A;  4DV1 E;  4DV7 E;  4TUG A;  2B7V A;  2YT4 A;  1N3G A;  2GHF A;  2NA2 A;  4WXC A;  2LUP B;  4DR3 E;  4M2Z A;  2K4V A;  2NAB A;  2Q8U A;  4X8W A;  2EN3 A;  4F9C B;  4X64 E;  1A1F A;  4R2P A;  5IXM B;  4O5G A;  1AH5 A;  2EE8 A;  4BHC A;  2EM6 A;  1N32 E;  2YSO A;  4DR6 E;  5A2Q C;  2B9D A;  2MKN A;  4BC7 A;  1EKZ A;  2JPA A;  4F6M A;  2NUG A;  1KYQ A;  2EM8 A;  2VQF E;  4MLQ A;  2V87 A;  4LFB E;  2CTD A;  5A6K A;  5AAS A;  4MLV A;  2YRH A;  1ZAA C;  4F9A B;  1XMQ E;  3J80 C;  2ZM6 E;  2N3G A;  4LFC E;  3H09 A;  4B3R E;  2VE7 C;  1X5W A;  2BB8 A;  5AE1 A;  3ADL A;  2L3J A;  4B3S E;  4ZYG A;  2V8Q B;  2DMY A;  2I9I A;  2EMI A;  4KHP E;  4ZYH A;  2YSP A;  2RSM A;  2YU5 A;  1DQ3 A;  2KON A;  4R2Q A;  1UN6 B;  2NUF A;  4R2R A;  1A1G A;  2EPX A;  2MC6 A;  2EMY A;  2FGG A;  2J7J A;  2YPN A;  5T6J A;  3MHS C;  4WSP A;  1MEY C;  2LBS B;  2YU8 A;  4F9B B;  2H36 X;  2DSY A;  3HPS A;  5A69 A;  2LE2 A;  2L3C A;  1QNT A;  4FK5 C;  4P78 A;  3ADI A;  2EMK A;  2EL4 A;  5F3W A;  4BCA A;  5IWA E;  1X6F A;  2EOH A;  1DI2 A;  2LUQ A;  1GTK A;  4DV5 E;  2YTP A;  1ZBT A;  2YTN A;  2KOU A;  4X62 E;  4DV0 E;  2EMA A;  1RMD A;  1A1H A;  2YTD A;  5AC5 A;  2RS7 A;  2EN2 A;  1XNQ E;  3VYX A;  2EOS A;  2ELY A;  2LJU A;  1TN9 A;  3BGH A;  2EOQ A;  1PJQ A;  2JY9 A;  2LRS A;  1YZ9 A;  3KZY A;  1XMO E;  1T4L B;  2L2M A;  1A1K A;  3EPL A;  3HPZ A;  3EPK A;  2ENH A;  2V88 A;  5A6B A;  5LMU E;  4WXD A;  3UK3 C;  1G2D C;  2EPC A;  2M9A A;  2JOB A;  3RMP A;  2EPP A;  2WBU A;  1ZBQ A;  4R2E A;  4DR7 E;  3T1H E;  2EPZ A;  1PJT A;  2YTO A;  2JYA A;  3F6H A;  2EMC A;  1HNZ E;  1KJK A;  3MHH C;  1TF3 A;  3QG5 C;  3DJW A;  2RQL A;  5BR8 E;  2E5L E;  2VQE E;  1AAY A;  1STU A;  2CSH A;  2YTQ A;  4GEQ B;  4DV2 E;  2B7T A;  4NZV A;  4LF9 E;  3J7Y p;  4KWY A;  2DLK A;  4JI7 E;  1HNX E;  1N33 E;  2N3H A;  2EM4 A;  2M4I A;  4BMJ A;  2L92 A;  4R2D A;  4BC9 A;  2EPA A;  1XNR E;  3F6G A;  1X3C A;  4O43 A;  2F4V E;  4DUY E;  1T4N A;  2DMI A;  1A1J A;  2HGH A;  2EN4 A;  3KZZ A;  2ENA A;  4ZYD A;  2KHX A;  2EJ4 A;  1TF6 A;  4JI4 E;  2M7Q A;  3THN A;  3C4T A;  1X48 A;  1ZU1 A;  4L8N A;  4JI5 E;  2JWO A;  1N34 E;  3L00 A;  2RSI A;  4L5N C;  2GLI A;  2UXB E;  4DR5 E;  1JK1 A;  2VF1 A;  4NXN E;  2BBG A;  4GKJ E;  5A6A A;  4X65 E;  1HNW E;  1UIL A; 
#chains in the Genus database with same CATH homology
 4WYQ B;  4F54 A;  4KZS A;  2M1S A;  5F3W A;  1YYW A;  3IWD A;  4BCA A;  1GZ6 A;  5IWA E;  4YHH E;  4JI2 E;  1I94 E;  1DI2 A;  1UHZ A;  2E1M A;  2LUQ A;  2WZO A;  3DF6 A;  2B3T B;  2DB2 A;  2L6M A;  2MDR A;  3JTZ A;  4J8Z A;  4OOG C;  2V85 A;  4BBY A;  4DV5 E;  2UUA E;  4LF7 E;  4NXM E;  1ZBT A;  4WPY A;  1SR9 A;  3FIG A;  2ODR D;  2G7H A;  2KOU A;  3JU0 A;  3LML A;  4X62 E;  4DV0 E;  3HQ1 A;  1HR0 E;  4BS9 A;  4JI1 E;  1O0W A;  2DIX A;  1IBL E;  2JOX A;  3IWB A;  4R8O A;  4WFT A;  1RC7 A;  1YYK A;  4OX9 E;  4GKK E;  1QU6 A;  1X47 A;  2EWL A;  4LF5 E;  3K6Q A;  4DMI A;  4DR1 E;  2RS7 A;  2EZ6 A;  4B3T E;  2L33 A;  1XNQ E;  5CFF E;  1N36 E;  3VYX A;  3C4B A;  2UU9 E;  4M0V A;  1WHN A;  2MC5 A;  4JI8 E;  1GQE A;  1WHQ A;  3HXL A;  2LTR A;  2V83 A;  4TUI A;  5AE3 A;  1RQ0 A;  2JY9 A;  2L2K B;  3ADG A;  3LLH A;  2LRS A;  1YZ9 A;  4DV1 E;  1XMO E;  1T4L B;  4JI0 E;  4LF6 E;  2L2M A;  2FV4 B;  3AUZ A;  3HPZ A;  4DV7 E;  4TUG A;  2B7V A;  4P7D A;  2CPN A;  2V88 A;  2YT4 A;  2UXD E;  2NUE A;  5LMU E;  2NA2 A;  2LUP B;  4DR3 E;  4M2Z A;  2K4V A;  2JOB A;  5AE2 A;  1J5E E;  3RMP A;  4X8W A;  3OTO E;  4F9C B;  4X64 E;  1ZBQ A;  3T1Y E;  3J81 C;  3T1H E;  1IBM E;  4DR7 E;  2JVA A;  2HHH E;  4DR4 E;  2RS6 A;  4DV3 E;  2FTX B;  1J26 A;  3F6H A;  3JAM C;  3OML A;  1T4O A;  4X66 E;  1HNZ E;  1FJG E;  1N32 E;  4DR6 E;  3DJW A;  2UUB E;  4DKK A;  5A2Q C;  3VK6 A;  2B9D A;  5BR8 E;  5FLX C;  2E5L E;  4BC7 A;  2VQE E;  1EKZ A;  2RTX A;  2V86 A;  4DV4 E;  2NUG A;  1PKP A;  2VQF E;  1STU A;  4LF8 E;  3KWR A;  4GEQ B;  5LL6 R;  4DV2 E;  4LF4 E;  2L2N A;  2B7T A;  2V87 A;  2YZT A;  4R03 A;  3ZOQ B;  5ADZ A;  5LMN E;  4LFB E;  5DNY A;  4LF9 E;  4JI3 E;  3J7Y p;  5AAS A;  4K0K E;  4JI7 E;  1HNX E;  1N33 E;  1IBK E;  2N3H A;  4Q28 A;  4F9A B;  4DUZ E;  2M4I A;  4LTY A;  1XMQ E;  3MSW A;  3J80 C;  2ZM6 E;  1X49 A;  4BMJ A;  2L92 A;  2N3G A;  4BC9 A;  4LU9 A;  4LFC E;  3H09 A;  2ODR C;  4DV6 E;  2JR1 A;  2VE7 C;  3F6G A;  4M30 A;  5IT9 C;  1XNR E;  4B3R E;  2IHR 1;  2UXC E;  2F4V E;  3IWC A;  5AE1 A;  4DUY E;  3ADL A;  4JYA E;  1T4N A;  2L3J A;  3AV0 A;  2F8B A;  4B3S E;  2V8Q B;  2DMY A;  4I8O A;  4B3M E;  4KHP E;  4LFA E;  3ADI A;  2LTS A;  3J7A G;  2LJH A;  2RSM A;  2KHX A;  4JI6 E;  1DQ3 A;  2KON A;  4JI4 E;  2NUF A;  2M7Q A;  2MC6 A;  3VYY A;  2FGG A;  3C4T A;  1X48 A;  3P1X A;  4WSP A;  5T6J A;  1WXR A;  2LBS B;  4F9B B;  2H36 X;  2DSY A;  4L8N A;  4DR2 E;  3HPS A;  1FKA E;  2JWO A;  1N34 E;  4JI5 E;  4JV5 E;  2V89 A;  3ADJ A;  4L5N C;  2LE2 A;  2UXB E;  4DR5 E;  2L8T A;  2VF1 A;  2L3C A;  4AQY E;  4NXN E;  3HTX A;  2UUC E;  4GKJ E;  4X65 E;  1HNW E;  2LMZ A;  1UIL A;  4P78 A;  4YY3 E;  1YYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...