2M4KA

Solution structure of the delta subunit of rna polymerase from bacillus subtilis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the Partially Disordered Full-Length delta Subunit of RNA Polymerase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit delta
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4kA00
2KRCA 2M4KA 4NC8A 4NC7A
chains in the Genus database with same CATH superfamily
3A2KA 5D4RA 1JTXA 2ME0A 3OSFA 2VXZA 2E5ZA 2GA2A 4ZDLA 1MSEC 1R22A 1Y0UA 1LFUP 3CMYA 5HNHA 2LC2A 4RDUA 1MBKA 3JRHA 2BGCA 3SFZA 3H36A 3TO7A 2HGCA 3MZYA 4KITB 3MVPA 2DA4A 3BR0A 4LB5A 1OMIA 1CF7A 3CUOA 3A01B 4JX6A 5J47A 4JQFA 4A3MJ 5HODA 1EA3A 2E35A 4IF4A 3Q3SA 1Z1DA 3ONQA 2COBA 3OIQA 4U0WA 4ENNA 4Y17A 2AO9A 1MJAA 2O0YA 1XPXA 1P7JA 1OCOH 4F55A 1WHUA 3OYLA 4KIGA 3H92A 2XPUA 2ZFWA 3KZIC 3K2AA 2STTA 3WTUC 2DI3A 5CVUA 1WJEA 5KHDA 3ZPLA 4BJTA 5IT9Z 3CQZJ 3Q5FA 1R6RA 1MBFA 5FFXA 1WCMJ 4PK4A 1IGNA 1V5GA 2HWVA 4CGZA 4B48A 1P4WA 4BU2A 3CCLI 2EB7A 3GUDA 3FWEA 4AVPA 2BXYA 2YX4A 4MEYF 1MDMA 5DD4A 3PSFA 4L9VA 4LIUA 3REOA 3MKYB 2BHYA 1IZ1A 3A01A 1TWCJ 1TW3A 1U8RA 3CJQB 5DD8A 4RAZA 2VONA 4IRHA 1IXRC 5EZHA 2L4MA 3KIOA 5KNLA 2M8GX 1EF4A 4Z6YA 1FTTA 1KU9A 5BMZA 4QLCU 3JTHA 3GFIA 2FNAA 1XCBA 3QOEA 2R7TA 2P6SA 2BV6A 2HVQA 3S15J 2TDXA 1VQKI 5FGMA 3EUHC 3FIWA 4RS8A 4IQJA 2OZUA 3FK7A 2XKPA 4NNJA 1XSDA 1B72A 4PUSA 1W1WE 5L3BA 3DTEA 4PJNA 3S1MJ 4IKFA 4P96A 2WAQN 2XRLA 3RCOA 3VDXA 4PJLA 4LK1F 2EA4A 4RB2C 4M3EA 2RGVA 2LK2A 1G6NA 4LOCA 3CO6C 4EM2A 2MBFA 2RQQA 2PG4A 2YPRA 3CUQC 3GYHX 4YFXF 2DK8A 3M8EA 4BXXJ 4BH9A 2GOXB 2MA3A 3ASNH 5IT9K 2KDZA 4IX7A 1OQYA 4EJTA 1S5LC 4RAYA 2CMPA 1W36C 4UB8C 3J80K 2WB1N 2DJIA 3KFWX 2FD5A 2R7VA 3OS1A 1ETKA 1SFXA 1YYVA 5HLHA 5K7ZA 5F08A 1SD5A 3G1LA 4CCNA 2E1CA 2E2IJ 2Q2EB 1YW7A 1FC3A 4IVNA 1HLVA 3HGGA 1TQIA 1I6XA 4LB6B 1QHGA 2F5EA 2ECBA 3ZR8X 2EA2A 2NVXJ 3JTGA 2A5WA 2H09A 2PBIA 4PGHA 3SHFA 3FXOA 2X51A 3DPTA 1YTYA 2TCTA 3Q0WA 2XGXA 3K4KA 1O4XA 5IP6A 2HVSA 2JA5J 1AKHA 4IHSA 1T6SA 2KISA 3JRBA 4BQQA 2F5DA 5AIPA 2CW8A 2BW3A 1T33A 3HRMA 5CKTA 4Z2YA 3F21A 1I3AA 2BE5F 2DOEA 2X6OA 3HM5A 1J09A 4KN7X 1P6RA 1PUFB 2I5UA 4N4NB 1WJBA 2PMZA 2QVOA 1JE8A 1CQTA 4RLQA 3FHNA 2WAQA 1ZKGA 4Y3OA 5D8KB 1ZG3A 2KJBA 1UG2A 3H5AA 5D4SA 2W1OA 1N78A 4I7HA 3VOEA 1LPQA 1A6IA 1FX7A 1LDJA 2XPWA 3DCFA 3K70D 5H6QA 1ZYRF 2K9LA 1ZK8A 2VLAA 1ETYA 1ETVA 3H0DA 2EBIA 1LJ9A 1UCRA 1IO2A 5L3FA 2QQAA 3L2VA 1DQUA 2MH2A 3CDHA 5FLMJ 2BY1A 3JRGA 1AKHB 1KZHA 2Q0OA 3TL4X 4UV9A 4AD9A 1IUFA 1IJWC 2M87A 4F92B 3MWMA 2LBFA 3F8MA 1BOAA 1QBJA 1H9GA 2JQ7A 1T95A 2O3FA 1VQPI 5D5WB 3LQQA 1Z0XA 1Z3XA 1TTYA 1X2MA 3GZ5A 5J6XA 3C18A 3OL4A 4HLXA 3BCBA 3TKYA 5EG0B 1FNNA 5LFAA 2JRTA 1TP4A 3G4SI 2EINH 5ILVA 2W48A 1FMWA 1YITI 2WC2A 2P5VA 3DTIA 4RBOA 4C9YA 4OAZA 2KQRA 2KRFA 4PCQA 5K5RA 1S7AA 2R7RA 2KRHA 2VJ5A 3DF8A 1WSUA 2XAHA 4BQOA 2QSFX 3HHGA 1D1AA 3H3ZA 4NQWA 1X4PA 4GYGA 5EYRA 3OYEA 2KDOA 1FOWA 4Y33A 2NNNA 2XAFA 3LA7A 1R58A 1OCCH 3I4NJ 4IHYA 2HKXA 2M3AA 4M73A 2JA2A 5GAHJ 2R7SA 5DCMA 1QZYA 3C2GA 2C6YA 3GTOJ 2PEXA 4IZZA 4BDZA 1ZQ3P 4A3GJ 2YX7A 1H0MA 1MW7A 3MKZA 2DT5A 2XF7A 1ACIA 1BJZA 3RTRA 5JFRA 3VWBA 1LQ1A 3QOPA 4KICA 4C30A 2PFBA 3ZQHA 1L3LA 1XSVA 4JBAA 2RREA 3CCYA 2RV8A 5CVVA 2FOWA 2OU2A 1WH7A 3IWFA 1IF1A 3I59B 1DGRM 1QQIA 2OCCH 2K9MA 3ECOA 3M07A 3OOUA 2RC4A 4P9UA 3CC2I 4BL0B 1K6YA 1R49A 3P9CA 1K78B 1RESA 2QSGX 1IN7A 3QPLA 4HSTA 5FLVA 2LKXA 3LSRA 2JN6A 3E3VA 2P7CB 2Y75A 3IKVA 3VSLA 3K70C 5CVIA 4IPAA 2OZ6A 5C4XJ 1I27A 3LSHA 4WF2A 4HDUA 5FRMA 4YELA 3RKWA 4AIDA 3WU2C 1T98A 3MKWB 2R4GA 3TOBA 3CP8A 2CSOA 2V9PA 2VQHA 1Z7UA 5TGTA 4DBRA 1Z91A 1K4SA 2E60A 4U7DA 1WVRA 4Q47A 3R0JA 2EZLA 3KP4A 5GTHC 1V4RA 3ZQFA 1FPQA 3OYIA 4RM3A 5ICGA 4EVIA 3GTLJ 2D5VA 2HR3A 2DFEA 1W0TA 3MFKA 3L00A 2IT0A 4EJUA 3LOCA 5KVRA 2WWYA 3HYIA 5E18F 3I4PA 1QNTA 1DP3A 1ZRFA 1G3WA 2LRDA 2VQCA 3SZGA 2XAJA 4Y52J 4UVCA 2RDPA 5IOZA 4PJJA 3W6KB 3HBLA 2E1OA 2XAGA 1J75A 1AHDP 1XX5A 2W7NA 3LMMA 3CUQA 3FXRA 4HSRA 3KYCB 1R71A 2CQXA 1HXDA 4XKCA 2D1VA 1OISA 4A3CJ 1ETXA 5LRRA 5IYDJ 3TOAA 3GEZA 1P4XA 2WV0A 2STWA 3GWZA 4QTRA 4DQ2A 5A2QZ 2Q8KA 3OR2C 2K9NA 5FLXK 1OLTA 3QYBA 3PIPF 2ZC2A 2CH0A 3TEDA 2VKDA 2GXBA 4D1QA 5FFZA 3G73A 1YJWI 4RMNA 2MC3A 3CMMA 1BM9A 5IYBJ 3BR2A 5J1YA 4UUTA 2CQQA 3S3OA 1OYIA 1FWZA 3KZYA 4GDFA 2VQGA 3QP5A 4L0ZB 4AU7A 2IA2A 4EJWA 3IV5A 1D5YA 4XN3A 1YW8A 2X6WA 5E1ZB 3BPVA 4Y7NJ 2OQRA 2WAEA 2KHMA 4ZH4F 4G6QA 1X19A 1DGWY 2B63J 2HOEA 4OU0A 4KISA 5AONA 3AL0B 3BCAA 1G4DA 2DLLA 1OR7A 4ZDOA 1F9NA 1U2WA 2B9SA 4GCVA 4A2UA 2KIQA 2RN7A 1OKRA 2A6HF 2WA0A 4HYEA 4P1WA 3KE2A 3BP8A 3S1RJ 3LWFA 4A3LJ 4OINF 1UELB 2G7HA 2GWRA 3ABUA 3RYPA 1FLIA 1T39A 2P7VB 2BYVE 2FQ3A 2DQLA 3F72A 4FHTA 2EV5A 2R7OA 1RIOH 3M8FA 4U88A 1FSHA 1WFXA 4B8XA 1QO0D 2DW4A 2HYJA 2JK3A 3CCEI 1LFBA 4FX4A 1TZLA 1Q1HA 3FDYA 3DPUA 3OYAA 1ZR2A 1T0FC 2GM4A 3EYYA 4PFPA 1GXPA 1W5TA 5DCFA 1QPIA 2DQRA 3GTMJ 1BI2A 2A6EF 2ZFUA 1VFCA 1AWCA 1D1CA 1I6HJ 2IGMA 4IHVA 3PM1A 3BG7A 2HYFA 1ZLKA 3VFZA 2HZDA 3EQLF 4BAYA 2IS6A 4OIOF 4JOMA 3TMOA 3IL2A 1MBJA 1SFEA 5B66C 4RGRA 3BR6A 2NS7A 5L3EA 1AA7A 3GX4X 2QBYB 1SVMA 2F4OB 4YIFA 5J1UA 4E4HA 2M4GA 1RZ4A 4CH7A 1R5ID 4NBQA 3BTJA 1B6AA 1BI0A 4I09A 3KYLA 5JLWA 4A93J 4NHJA 1FIPA 1UZCA 2CW0F 2HDDA 1QZZA 3F8CA 5DYMA 4A3JJ 4F91B 1MNEA 2DODA 1VTNC 3B6CA 3C2HA 4BE1A 3OYDA 1WJDA 2YR2A 1VQ4I 1ZG5A 5AIQA 1WWXA 3I53A 2LH9A 4GRIA 2G0EA 1ZAOA 2UV1A 1K7AA 1G8XA 1X3ZB 1O3SA 2MC4A 4ZC3A 3NQOA 2QF7A 4PSXA 2DMUA 5CYVA 3LA3A 2R5ZA 3RPUD 1NH3A 5HS7A 3CF5F 3GTPJ 1TQMA 1EJ9A 1IAWA 5CLSA 3VYTB 3AG2H 4B3AA 2QUFA 5D8LB 4JP0A 4N0BA 3TQNA 3HDDA 3VEPA 2VKHA 2H8RA 1R36A 2IXSA 2R3SA 2JA6J 3QYFA 4HQEA 2XSJC 3RDIA 1UHWA 4R8HA 3O8GA 3ROUA 2DYSH 2JUCA 3HOWJ 3UR3C 3KETA 2B0LA 5J4YA 2IVMA 2ID6A 1C0WA 4HG2A 4G9YA 4XIDA 2FE3A 1YIJI 1REPC 1MJBA 2VN2A 2NVTJ 1ORKA 4HPQA 2HI3A 2MGQA 2H8WA 1BR1A 1USTA 5D6FA 2AS5F 3K1MA 4M6YA 4MHGA 4DBQA 2IA0A 3SYTA 2QZ8A 2Y30A 2LBFB 1MIJA 1RPWA 1RR7A 2W82A 5FKNA 1HSTA 1UAAA 1D0ZA 3J7YJ 3RI4A 1JHHA 3SZPA 2CV1A 3HKZN 1SD7A 2E19A 3KPHA 3VYUB 1JHFA 3GVAA 1PP7U 5M3FJ 2X9DA 3S93A 4XSZF 3SEZA 1BR4A 2DFHA 4XR6A 3O2PE 4IRIA 4Y13A 4KMFA 4RB1A 3OWTA 2IGNA 3HGYA 4JYKA 4U0VA 3JAMZ 5BNGA 4OOIA 3I64A 2WTEA 4CYDA 4HAMA 2HZTA 2WBMA 1GT0C 1EV7A 3VODA 4CUGA 1IRGA 1SD4A 2CV2A 2X1CA 1R1UA 2CQNA 1GDTA 3R0AA 3F23A 4OWRB 4FT8A 1R4NB 1UJ8A 1X3UA 2ELHA 2B7EA 2KIFA 1MMDA 2YUSA 1MMNA 1ON2A 1ZGJA 4ON0A 1MBGA 3S8PA 4Q48A 3T1BA 1AOYA 2L01A 2ADUA 3BT9A 3OMYA 4V2GA 2EJRA 2CQKA 1XMAA 4IHXA 4KIBA 4HBLA 2PMZN 2EFOA 4KT5C 1MJ9A 3HEFA 3SJMA 2Z99A 2VKEA 1NG6A 1VQNI 4HNUA 2Q2EA 5IP7J 3BQYA 3ERMA 4OMZA 2IJLA 1HDDC 5JVTA 4UY8I 4DNCA 2D1HA 4G8XA 3EYIA 3TW6A 4M9SA 3KP7A 2D2WA 4AIKA 1K78A 3TP0A 1XD7A 2JZYA 2LVSA 1H88C 1TL8A 2A68F 2XVCA 1TT0A 3BQZA 3DLLF 3EETA 3CESA 3IH4A 2FUG2 3GTGJ 4HOBA 2VUMJ 2HTSA 2WB1A 5DUKA 1W36D 3PO3J 4G6TB 2NS0A 3KEYA 2M9HA 1FJLA 2ZCWA 3AG3H 3JAMK 3DXJF 1KQ9A 4GFBA 2NVQJ 5GAEJ 2IA1A 2E34A 3QP6A 3QU3A 1QA6A 1TWHJ 2KLOA 1MD0A 5JHFA 3E7LA 2HYGD 4MIMA 3V8KA 2XKOA 5LLQA 3OYCA 2DFFA 2IS2A 3N97A 1HF0A 1WJAA 2JMWA 3BZCA 2IBDA 4H4KC 3DFGA 1BW6A 2EILH 2NNYA 4W97A 4WXDA 2JTVA 2JSCA 3GFJA 4B1RA 2CGPA 1KYWA 2M1BA 1Y8QB 4ZYDA 2K7LA 1Z21A 1XMKA 4F52A 1R7JA 4FX0A 4DIQA 3WG9A 4A3KJ 1ETOA 4G6DA 4E70A 3PNYA 1VQ8I 3CUQB 3HRUA 2YU3A 4FISA 3V4GA 3IRRA 1S29A 2P0WA 4XICA 3OYNA 1U3EM 1E3HA 4HV6A 1LEAA 2F5VA 4A3FJ 5K5OA 5B1AH 5JI6A 2R5YB 3RJPA 2W24A 5ICEA 2DXIA 1XTAA 3E5QA 4W1UA 4EQQA 1O3QA 1B1BA 2EK5A 2Z9OA 3H1CA 1O57A 3ZMSA 3DKXA 1NK3P 2VL8A 1Z67A 2M34A 3DBLB 2IW5A 3S3NA 4FTHA 2JSPA 2MYSA 3ELKA 4V19K 2DT6A 2EFNA 2X1DA 2Z1DA 1SFOJ 4Q5SF 2M30A 2KZGA 3H9QA 4A0XA 4XSXF 3WE3A 2KT0A 3TW7A 1XC5A 2ID3A 1MGTA 2P5KA 4B4CA 2OAZA 2Y0MA 2K27A 1LE8A 2ZSHB 4M3DA 3KLOA 5JVGF 1E2XA 5ERIA 4J00A 3ZN1A 2ZNZA 1SAXA 4ZYAA 4Y4RA 5HLTA 3LQRA 2R5YA 3IKTA 1ZGWA 3DKYA 5E3NA 1W7PB 3D0SA 4K2EA 3WGGA 4L5IA 5J3LA 2IEKA 1HW1A 2OPTA 3HG9A 4PFOA 3ZQGA 4IRGA 1KU7A 3DV8A 1FBUA 4MQ9F 3AKZA 1X4OA 4BY7J 3T8RA 2EQRA 5FB2A 1X2NA 2VC0A 1YHQI 1JI8A 1FOXA 2OTLI 5J40A 4II3A 5KCMA 5E8IA 3DLAA 5H6RA 3WTWC 5GP9A 1D8JA 1AU7A 2XDVA 3S2WA 2LY2A 4MO7A 2QGUA 5J8CA 4BXFA 1ODDA 2KFDA 2E5NA 3HL2A 3HUGA 2KZVA 1DU6A 3FM3A 1R1TA 2OTJI 4BNCA 4HF2A 3CJTB 3M1EA 3S2HJ 3IH2A 4I0AA 4V2FA 1R9TJ 2NYXA 1POGA 2WY8Q 2Z16A 2VASA 2DK5A 1BI3A 3BR3A 1ZN2A 3D5RC 1BN5A 1W7PA 4IL6C 1WGXA 1X1PA 2I10A 3Q0VA 4RA2A 4B47A 1EH6A 3CDLA 3BR5A 3HOTA 2EPFA 3HRSA 3V42A 2EFWA 1XN7A 3ABLH 3QQAA 4U7BA 2VI6A 3KX2A 2RNGA 4UVAA 4WCGA 2BOLA 4BE2A 3KLNA 1Y8RB 5DDGA 3HPGA 1VQLI 1GV5A 3PNVA 1T56A 4R79A 2AHQA 3MN2A 4A6DA 1YX5A 3J7AY 1KA8A 2GIZA 3WTSC 4OIQF 2ZJ2A 3G1OA 3V7RA 1F4KA 3H3VK 1ITYA 4CO8A 3ZP5A 3L2UA 1MKMA 2VJ4A 4AWXB 1E17A 1WJFA 2FQ4A 2HXIA 3I5UA 3E6MA 3MQ0A 1Y1VJ 3AG4H 4QIWN 2K3PA 2HDWA 4LK0F 4XLPF 5E1WA 2GBYA 3CJNA 1ETQA 3E0JB 2Z5UA 2PX9A 2XGDA 2J5OA 3BTLA 1EH8A 3L9FA 2EIJH 1YFHA 1DUXC 2L7ZA 1YRNB 1S7OA 4KA4A 1Z3YA 3V7CA 2Q1ZB 4EGZA 5D5VB 2R5ZB 3KP5A 4HRIA 1IN6A 2QWWA 2R7DA 4IO9F 1IC8A 3NAUA 3K7AJ 2VKVA 4RGXA 2K5CA 1TLHB 2NOJB 5LHGA 3AAFA 1ZARA 3WU1B 1B8IB 4IEJA 2KMUA 3RPUA 1BOBA 4RM2A 1FP1D 1KU2A 3JR9A 2HVRA 4M74A 1JT6A 3CZ6A 4XK4A 1IXCA 3TBIA 4ZZLA 1D1BA 1FP2A 1ZRDA 1GVJA 1P4AA 3KP6A 4XLCA 5E8GA 2WY7Q 4D9JA 1DU0A 3NWTA 3HRTA 1VQOI 1NTCA 3LSIA 2LY1A 2P8TA 3K1PA 4KN4X 2O7OA 1R00A 3VPRA 3BJ6A 3JRIA 2H94A 2JUGA 3JRDA 4QWQA 3CC7I 3KEOA 5LGTA 1K4TA 1K79A 1YRNA 1P9QC 4JX5A 4NC7A 2RVCA 2HEOA 3CCQI 3HOSA 5HNFA 4XRSG 1DP7P 3L2RA 1G3SA 1WI9A 4QSHA 3GLXA 1X58A 4EM0B 4H0EA 3DBHB 2YU9J 4ZDPA 1G2HA 5IY5H 2ZJPF 3W2WA 3PSIA 3ZRGA 5EJCA 2E2HJ 2QLZA 3TGNA 2FRHA 2ESHA 2FBIA 2WAFA 1PP8F 4ENKA 1K61A 2PMUA 2XIGA 5K7FA 2IRFG 2CUEA 2Z3YA 2UXXA 5E17F 2FBKA 1ERDA 5LD2C 5E3LA 3OYFA 1OCTC 5C44J 2L0KA 3ZMDA 4D7MA 4A12A 3J7ZI 2QSHX 3S32A 1Y39A 2X6YA 3CCRI 2GQQA 3QPHA 4BHCA 3F22A 4DZPA 4MLOA 3BTIA 1LVAA 1SAUA 1HKSA 4D7NA 3S2DJ 2DFIA 2UUZA 1BI1A 2YSRA 2QA4I 3JCUC 4E7JA 5K1YA 2LLKA 1U6GA 4OIPF 3ZQLA 5ICCA 2MG4A 5CPRB 3IWZA 4L9JA 2FA5A 4LG0A 2HOAA 2NAZA 1U0JA 4RGUA 4XLAA 3CLOA 3H9JA 1T0FA 3HTUA 1OFCX 2O9LA 1MSFC 2VQLA 1F5TA 2DOAA 1YS6A 3FM5A 4M6XA 1WJCA 4AUXA 2XF5A 3I4MJ 2XRNA 1TNTA 3OIOA 5B3SH 3FMRA 3U21A 3IP4B 5F0HA 1A36A 4MQVA 2OC6A 4CZZA 2CO5A 2F2EA 4Y15A 1A5JA 3D5LA 3ZXSA 1OCRH 1HA8A 2QYOA 3L7WA 4N9IA 4NC6A 1TWFJ 1Y1WJ 1IRFA 1P2FA 1RUNA 2EZKA 3S1NJ 4HX7A 3DTKA 2XC7A 2DTRA 4CCMA 1IN8A 3K4JA 2K02A 4B44A 2MSYA 5K7HA 3K4NA 2R7ZJ 1BL0A 1G3TA 1D0YA 3FK6A 1IW7F 2RAEA 4RAFA 2MW8A 3W3CA 2HOSA 2DA1A 3ZQIA 5F1JA 1IV6A 5F6FA 4I98B 2WADA 3M8JA 2F4IA 2X85A 1X1BA 4I0BA 2EIKH 3G71I 2M7AA 2QENA 3EDPA 2VOPA 1N77A 1WPKA 4XKBA 3JSPA 1FTZA 1JTYA 2E71A 2XB5A 2VXDA 1O3TA 1XS9A 3QWLA 4IQ4A 2UWMA 2H1KA 2F5CA 3LFKA 2QEXI 5TRDA 4DOZA 1P7IA 2IGKA 3OYHA 1TC3C 2DA7A 2QKMB 2K86A 5IOYA 5C4JJ 5DCMB 2XPVA 3E6BA 3GMEA 3DKWA 3FZVA 2A6TA 1F36A 5J1RA 1UB9A 2HKOA 3K9TA 3HSRA 2ZXIA 3CCMI 1TBXA 2GZWA 2W84A 2BY3A 5BPIA 3I71A 1K83J 1H89C 1JJ8C 1U9OA 1S7EA 5F0FA 1ZELA 4P5OA 4PSWA 4A6EA 4RB3C 3JSOA 4ABZA 2BEOA 1EKEA 2OD5A 3A4CA 2BY2A 2L3DA 2A07F 2KKOA 4XONA 1OPCA 2P81A 2DA5A 4N4OB 2Y0SN 4LJZF 3PL8A 1DDNA 2N8GA 5BPDA 1Z7LA 4ENMA 1K6OA 3NARA 4ZYGA 3DWLE 1LFPA 3CDIA 2E1MC 4C3JJ 1SC7A 1Y6IA 2PJRA 1JUSA 4LGWA 3W6JB 2K85A 2E36A 3IHUA 2V6EA 2ZXJA 1TWAJ 5E20A 4Q4ZF 5FO5A 5HOOA 1HKTA 3PNTA 3F0CA 2DT7B 4BBRJ 2OBPA 3G1MA 1GLNA 1GXQA 5IPAA 2XUBA 3QPTA 3QODA 1QVTA 4FQGA 3OYMA 1SEUA 4MEXF 2EZHA 1SVLA 1SANA 2XB0X 3EUHA 2ME6A 4KDPA 4CZCA 1J59A 1BBYA 4HW0A 1M1EB 1Z77A 2HNHA 1W5CC 4MGRA 5DUIA 1LEBA 2MD0A 3LSPA 3ZMZA 1PVEA 1A35A 1MBEA 4XNFA 4XRSA 3FBIB 2VBYA 2HQRA 2MLKA 4A3IJ 3DEWA 1IN4A 3WG7H 5D5UB 4XN0A 4TV7A 4WXHA 4HF1A 4B43A 2H6BA 6PAXA 3WHCA 3AG1H 4I99C 4FE4A 2ZBKA 4L5EA 3LNQA 3WGIA 2F4MB 4KJZA 3MEXA 2HS5A 3D5SC 4XLEA 4E7ZA 1Z6RA 2LREA 2QKLB 3AL0C 4BHPA 3I58A 4EV0A 4CICA 1U5TB 3F8NA 3BDDA 3TO9A 3V8JA 1O7FA 2KL4A 3GFMA 3RKXA 1ONVA 3FX3A 3QYEA 1PYVA 2EIMH 1X1DA 2K9QA 2V4JC 3U9GA 3SQNA 4KNYA 2MD5A 1ZH5A 3WHBA 1Y56A 3MAJA 2VB6A 1IG7A 1XDUA 2VC1A 5FKLA 4DYRA 2Y9ZA 1XGMA 2CG4A 3COAC 3P9KA 2BVLA 5IP9J 2L9SA 4ENJA 3FHZA 1VI0A 4NUBA 3C2BA 4C2TA 2PMHA 2CRGA 4WX9A 3A02A 4PJMA 3A0HC 3KP3A 4LG3A 4XORA 4GXOA 4HLYA 1I1SA 5DM6F 4AIHA 2HOTA 1SMYF 1N25A 4M3GA 2FX0A 3F8FA 2V1UA 2DMQA 4XL9A 1X1CA 1XB4A 4RAGA 3AFHA 4RB0A 1BW5A 2K9SA 2M4KA 1HCRA 1R1VA 1UHSA 2LY9A 4ESJA 4J19A 3FISA 1T2KA 1RKTA 5D5XB 1FT9A 3K10A 2ISZA 2Y9YA 2X48A 2V1DA 3MKLA 3GTQJ 3D1NI 3Q9SA 2E7XA 5KK1A 4C3IJ 1E3OC 2PLYA 1FYLA 4MTEA 1H9TA 5FKOA 4QPQA 1LUJB 2ICWG 4EATA 3LAJA 2KIUA 3CCSI 4UNOA 5D6EA 2EWNA 4YG2F 3A0BC 1S3JA 3HSEA 3MCZA 1J7KA 4DYCA 2DN0A 1MDMB 4HEA2 4LLGF 3CMEI 4HDVA 1LE8B 1SFKA 2VJJA 4XLHA 4AYBA 1HOMA 1KGSA 1FEXA 2CU7A 4YFNF 1HBXG 4CDGA 1SMTA 1RKWA 2IPQX 4XOPA 2R7FA 2WV1A 3NWSA 4EGYA 4UV8A 4M9ZA 2GAUA 2XHKA 2XGCA 3V7SA 4YEJA 4KT6A 2DJNA 2Y31A 1WJ5A 2ZMEB 3HPHA 1RRJA 2VBWA 3GCMA 4UUSA 2V9VA 3ZGKA 5LHIA 4ZTJA 2CUFA 2R92J 3RZOJ 2F6CA 3WTZA 1ZG1A 1B72B 1FY7A 1HC8A 3O8HA 3LSKA 1RETA 5CVRA 3WTVC 4A5MA 4S05A 3BJAA 3DEEA 3J80Z 4PJ0C 3R4KA 2RKHA 4ZZDA 1USSA 2CQ7A 3W2AA 3RSNA 3K0LA 1XGNA 4A0ZA 4BHBA 2EV0A 3WTXC 3VYSB 4BJ5C 3H3UA 4C3HJ 3H5NA 2Y2ZA 3GF2A 2FF4A 4MFEA 1GV2A 2LYCA 2IS1A 4A69C 2VE8A 1ZTRA 2L02A 3EUAA 3RIRA 4EEFG 4I2OA 3Q9VA 4YIIA 3HB9A 3LSGA 1IRZA 5LBQA 5BOXA 3S14J 4BE0A 1V55H 1O7LA 4G7OF 4P9FA 1T38A 2VJIA 3OIPA 1HDPA 3M1CA 2L5QA 1I50J 3JREA 4M3BA 3FMSA 3K6GA 3CC4I 2L9NA 3HTSB 3BG5A 2L7FP 4M71A 5CJ9A 3ZMUA 5M5XJ 3CMAI 5IT3A 3M9AA 2V79A 1UG0A 3E5UA 2UZKA 2ZMEC 2GXGA 2BW3B 2DBBA 3F8BA 4J01A 2M5WA 4BEHA 3Q0UA 1IRXA 4UXNA 2BVMA 4AC0A 4CYCB 5FRNA 3WTYC 4ESFA 3DU6A 2L7KA 5EEGA 2P4WA 3HIFA 4D5FA 5E3MA 1VQ9I 3SXYA 2DDBA 4PGGA 3ULQB 1XGOA 1Z9CA 3CD6I 4IOAF 1FOYA 2ETHA 1FZPB 3V8LA 3U2RA 5F64A 1B4AA 1ULYA 1IXSB 3ERED 1QPMA 2LDUA 1W0UA 5E1XA 3ABKH 2FOKA 1YQAA 4ZJZA 1XDSA 4DZJA 2K40A 4NB5A 2L54A 2OCEA 3ZMTA 3WU0A 1HW2A 3LSTA 3E97A 5EZGA 1YIOA 5F27A 3W2VA 1BA5A 1LNWA 3CLQA 2XV4S 3ZN0A 2PN6A 2LP0A 3M7GA 3GTJJ 1V5FA 3E1SA 4II2A 3N4MA 3ECHA 1BC7C 4L18B 3HOVJ 3H9GA 5E3OA 3RZDJ 2VPRA 1A6QA 1MZBA 2LF8A 3MMYB 4MFDA 1J5YA 2VPLA 2LFBA 2MABA 2FMLA 3DEUA 1ZHFA 3SZTA 5EG0A 2ZO4A 3GTKJ 3S3MA 4U87A 2JPCA 2VOOA 1G3YA 2GIVA 3BG9A 2QQ9A 3G3ZA 2XSDC 3DQVC 3O6BB 3I3LA 2DMNA 4WXCA 2CWEA 5GTIC 4BGDA 5HDGA 1FMVA 5JLXA 4LMYA 1X1AA 4LIVA 1B59A 2E1NA 4LLLA 4CCLA 1VQ6I 4NQWB 1D3YA 3T0YA 3BTCA 1JGSA 2JRMA 1R5GA 4KYWA 1CGPA 2LSOA 3I54A 2VODA 4IHWA 2XAUA 5FROA 2A05A 2JPBA 4LITA 3CO7C 4XBFA 4X0GA 2O5RA 1TWGJ 2BHZA 3HXLA 3J7AO 4I76A 2HFHA 2PJRB 2O8KA 4G94A 2QQBA 1IDYA 5EEAA 1MH3A 1HW5A 2ISYA 4HQMA 4XKWA 1U5TC 1Z05A 1YE9A 3L09A 4CXFA 3HHHA 1VQMI 1YW9A 4BACA 4KMUX 1QU3A 1MBHA 2QQ8A 1GHCA 4E7HA 3FKJA 3BROA 4B09A 1QHHD 2TRTA 4C2UA 1HQCA 3BWGA 1Y0NA 2CUZA 3DBRB 3OY9A 4JK1X 5GAGJ 2M0MA 1O3RA 4D5CA 2L9VA 2G9WA 1FYKA 5ED4A 3I59A 3PIOF 2Y69H 3BZ6A 3H5RA 3O3KA 2V7FA 2OA4A 4F93B 5K5QA 5GADJ 4MNUA 2VIXA 2CYYA 2FEZA 2RNJA 3W6VA 2QCOA 9ANTA 3OV8A 2V9KA 4G7HF 4AM3A 4LFUA 3MD2A 1L0OC 1IV8A 4HNVA 3G6EI 3ZQCA 1S8NA 3F3XA 1OYWA 3QRFF 4HF0A 2BZTA 5CVJA 5L3CA 3WTTC 1FYMA 2FNPA 3FF5A 3JRAA 4LD5A 5DS9A 4M9XA 3BZKA 4E6KG 4EJVA 3FKIJ 3FXKA 2XAQA 4YRVA 4NC8A 1ZRCA 3S16J 2M0CA 1W5SA 4KUMA 4BBSJ 3DPLC 3N05A 2E1MB 2VE9A 2IS4A 4CHUA 1X3WB 2W57A 2KJCA 1U9NA 4OMYA 3FBNB 4U0YA 1FSEA 4L9TA 1RC9A 3L1PA 3OS2A 2ESNA 2CS3A 2X4HA 1VQ5I 4BY1J 1SVOA 4OAYA 1ENHA 4CCKA 1G59A 5A2QK 5FLXZ 3BJOA 1XGSA 2V26A 3I0TA 2LTPA 4XOTA 1FIAA 1TNSA 2DOFA 2V6CA 2LG4A 3K4CA 4PZJA 3JRCA 3LAPA 3E5XA 4FASD 2E7WA 1YOVB 3GZ6A 2HXOA 5KAFC 3GLLA 2A3SA 2BBYA 5ILSA 2X6XA 2XGEA 2DAOA 4XLFA 1A31A 4ESBA 2L2OA 3K2ZA 1VF9A 3BY6A 4E7SA 2DA6A 1FBSA 1UHMA 5LHHA 1OCPA 3CF2A 5EDNA 1STZA 4HA8A 2JT1A 2M8EA 3TP3A 3L2CA 3EPZA 3IAS2 2Y48A 1E0EA 3LSJA 1I5ZA 2JJ7A 4DJAA 3X2QH 3J81Z 2PI0A 2O61A 5F04A 3I55I 4EJOA 3IUOA 5HVQC 1N75A 4MTDA 4X1EA 2MH9A 2H1LA 5LEJA 1YO5C 2PQ8A 2K4JA 4HZFA 2HDCA 3S1QJ 1IDZA 3MZ8A 3OR1C 2LKSA 4WK8F 2ELKA 1JKRC 1WZ2A 3EUKL 2LD5A 3HOXJ 1JT0A 2VT3A 1RUOA 2X1EA 1WI3A 2MFZA 3OYKA 2IP2A 3F9KA 3NEUA 3OYBA 4ASNA 3C7JA 1MNDA 2GLOA 1F43A 2VT2A 5M5YJ 2ZNYA 4S04A 3OS0A 3CTAA 3LA2A 2OQGA 3KEQA 3VSKA 4E7LA 4IHTA 1XCVA 3K4MA 2GXAA 2DMPA 2FXAA 5GPCA 5EF6A 3E6CC 2R93J 2M2EA 2R7QA 3CCVI 1S72I 3WE2A 1MNMC 4BQAA 2W00A 1JKPC 2HPIA 1QZEA 2DDAA 1U8BA 5DV5A 4QPOA 3RKYA 2ZJRF 5GPAA 4XM3A 1U78A 5HLIA 5DM7F 2ZJQF 1LKXA 2CFOA 1J0RA 5J8FA 3BC8A 2IAIA 1YG2A 3IAM2 1V54H 2CJJA 3ZMVA 4R1HA 5LEKA 2XROA 2QM3A 1V5EA 2KRCA 2LNBA 3SEQA 4WWCA 1YI2I 2K3FA 3ASOH 4D0PA 4ZYHA 3B02A 3J81K 2K4BA 2QBYA 4CCJA 2VBXA 3F6OA 3GFLA 4G7ZF 3TO6A 3KP2A 1RR8C 1PUEE 1JGGA 2DU9A 2E2JJ 2L7MP 1B8IA 2EH3A 3HOYJ 2COMA 2YS9A 3SDGA 3C3WA 3CCJI 2ECCA 2GA1A 4BXUA 1DPRA 4XQFA 2DA2A 3PUBA 3JW4A 3H35A 3CJRB 4ZYEA 3ZQ7A 4XMYA 1JUMA 1RNLA 2FBHA 3R60A 4FE7A 3ESWB 4F3QA 3A1YA 2JVHA 4CSWA 2OJED 5DTDA 1MMAA 5B1BH 3PO2J 1B9NA 2EV6A 4I01A 1ZLJA 3HSFA 4IOCF 4BDYA 1ETWA 5FD5A 5TISC 4HV5A 1TT5B 2R7XA 1HKQA 4CYCA 5LRSA 2AQFA 4A3DJ 1I3QJ 2AXTC 3GO5A 3R6SA 1QGPA 4FETA 2EFQA 1WRJA 2HQ5A 2J5PA 2LOOA 2O8XA 3BG3A 1S6LA 5JR3A 2A5YB 2O03A 3VYRB 3WODF 1KU3A 1J2XA 3A03A 3FXUA 2L4AA 2ZB9A 3E6DA 5IYCJ 1BJAA 4ZTFA 2LKPA 4GYIA 3P9IA 3HJEA 3RPQA 2HTJA 1QVUA 2NXNB 3B73A 3OYJA 3VB2A 2DCEA 3HOZJ 2HPMA 1APLC 2KIMA 5M3MJ 1IN5A 2A61A 2PJPA 3M4OJ 2G7UA 1B9MA 4N9HA 3SFIA 2XASA 3WGHA 5F0CA 3CP2A 1KYZA 1LDKB 5FJ8J 4XRMA 5JHUA 4XRFA 3PUFA 1LB2A 3LFUA 2KP6A 2LMDA 3K4BA 2ZMEA 4EM1A 1OR7C 4XLNF 3K4LA 2JWTA 4LG0B 1FOKA 2ELJA 3IRQA 4UUSB 1MMGA 4YIRX 3ABMH 4FCYA 4CCOA 3LSMA 1I39A 3FXLA 1P92A 3BG6A 5TJJA 1R23A 3OSGA 3P5JA 2CW7A 3L2WA 1E3PA 1W7PD 1OJLA 3B6AA 3KYDB 2L9RA 3H0GJ 1BIBA 3CCUI 4OIRF 2V1XA 4BUPA 5EEHA 4A0YA 2R7WA 3HKZA 1NK2P 2DMTA 3G2BA 3BPXA 4PDKA 3SDBA 3U1KA 3ISPA 5ICFA 4A3BJ 3KZZA 1RI7A 2HU9A 3ZCOA 2JVGA 1XG1A 2M45A 2NRAC 3FMQA 3L2QA 4BQNA 1DPUA 5CQEA 5L3GA 4DYQA 2W4SA 5BQTA 3ZOBA 1SFUA 3BLYA 2V1NA 2ZXHA 3RKQA 4E7KA 4UUVA 1OCZH 1Q1VA 1YJ9I 1PUFA 2IGOA 3PFIA 1ZR4A 3K1NA 1LDDA 5EGOA 2CFXA 3IC7A 4YFKF 5KAIC 3TDUC 1BC8C 1W4MA 2F48A 5H2FC 3C1DA 3RYRA 1H8AC 4A5NA 3M3YJ 3DP7A 1HSJA 4BS9A 2ACJA 1VQ7I 4BYYA 3P7NA 3PJRA 5HDKA 2Z2SB 4A3EJ 2LR8A 2JA7J 2DPDA 1FBQA 1UFMA 2FSWA 4CA0A 1JJ6C 3ABTA 2FJ1A 1J9IA 2NS8A 4L9NA 1SD6A 5B5EC 2O6GE 1JKQC 2DA3A 2OF7A 1KQ0A 1XSXA 1V3FA 2EZIA 3BOQA 4IJAA 2FMYA 2LF7A 1NG7A 1Z6TA 1EH7A 1XMXA 4BEHB 2BY0A 5LGUA 1TW2A 3QPSA 3HOUJ 2OUMA 3HZJA 5EGOB 3FXQA 2F5FA 1KQ8A 2BXZA 4G12A 1KONA 2DYRH 3OOPA 4M3FA 1WKMA 4O6JA 4BKXA 5HS8A 2R0QC 4E7IA 4L5JA 1YLFA 2M7BA 2KPMA 3UKGA 3ZQQA 2NVYJ 3PQJA 2CV0A 2UXNA 4RGSA 2VBZA 2DO7A 1I1GA 1R4MB 4S0HB 3NRVA 3K69A 3I56I 2I8DA 1D5VA 1PDNC 3KCCA 1NHAA 5E79C 3LL7A 1R5HA 2D45A 1ZREA 4NDLA 4EMSA 1D8KA 3T5XA 1JKOC 2DTZA 2HQNA 4P55A 5HDNA 3I9V2 3RQIA 2AQEA 3HC7A 1YX3A 4GO1A 5HS9A 5J4VA 3GW2A 1T08B 3ML6A 3BR1A 3RQ4A 2ZSIB 3T8TA 1VNDA 3F6VA 5HLGA 3FXJA 4KFCA 1WH5A 2NOGA 3UNGC 3U1DA 4BJ6C 2A69F 4I02A 1ON1A 3S17J 3IH3A 4UB6C 4GGGA 1OYYA 4B3XA 4AVZA 3GBGA 4L0YB 2W85A 5ILUA 4AYBN 2P6TA 5FKMA 3OYGA 1QRYA 2AXLA 2W25A 4DGWB 2Z33A 3QAHA 2H6CA 3FXMA 1D0XA 5M5WJ 3TDZC 4HX4A 1GVDA 1JXSA 2R7UA 4KIFA 4IXAA 4DW6A 3JRFA 4HX8A 1GUUA 2P5LC 1ZGAA 1T8IA 5DEQA 1BIAA 4LLNA 3DU5A 1YS7A 4X6AJ 2Y0SA 1LVKA 2EFPA 4M72A 4UVBA 5F1RA 4O5VA 4RLFA 1UMQA 2NVUB 4AIJA 3GZNB 1F1ZA 5C3EJ 2ZKZA 3GXOA 4ETSA 2ZXWH 1VZ0A 2JA8J 2OV7A 1YJNI 1U5TA 1WQ2A 4M6VA 5H20A 3OL3A 1TQPA 2XF6A 4ITVA 5FD6A 1MH4A 2CUJA 1JUPA 1CF7B 2FU4A 2RQPA 5FKKA 4F7ZA 3MZHA 4ANJA 3PFYA 2X0LA 3PQKA 1MMSA 4C2MJ 2MLGA 4XKVA 1A04A 2H27A 2HQAA 1IUYA 5L3DA 5BS6A 4JX4A 4HNTA 2GOMA 4I6ZA 3HUGB 5CQGA 4UHTA 4O3MA 3R61A 1S9HA 1BR2A 3QU6A 2DPUA 5LGNA 1PJRA
chains in the Genus database with same CATH topology
1MNEA 3A2KA 3D5LA 3MD2A 2VXZA 3ZXSA 2E5ZA 3C2HA 4ZDLA 1HA8A 4BE1A 3OYDA 1WJDA 5HNHA 2LH9A 4GRIA 2LC2A 2UV1A 3DTKA 2XC7A 4CCMA 1G8XA 3K4JA 4E6KG 4KITB 4B44A 2MC4A 4ZC3A 3K4NA 4PSXA 4YRVA 4NC8A 4JQFA 3RPUD 1EA3A 1D0YA 3DPLC 3N05A 3ONQA 2E1MB 3VYTB 3W3CA 3OIQA 2IS4A 2VKHA 2WADA 2IXSA 3M8JA 2F4IA 2X85A 3QYFA 1X1BA 4F55A 3FBNB 3OYLA 2XSJC 3OS2A 2M7AA 3UR3C 2CS3A 1N77A 4XKBA 1WJEA 4HG2A 5KHDA 4BJTA 4OAYA 4CCKA 2VXDA 1R6RA 4HPQA 1G59A 4IQ4A 4PK4A 2UWMA 1V5GA 4B48A 4BU2A 2V26A 1BR1A 4DOZA 2IGKA 3OYHA 2QKMB 4XOTA 4DBQA 3K4CA 3SYTA 2LG4A 2LBFB 4FASD 2W82A 3PSFA 4LIUA 3MKYB 1UAAA 1D0ZA 2A6TA 2CV1A 3CJQB 2X6XA 2ZXIA 3VYUB 3S93A 3SEZA 4XLFA 5KNLA 1BR4A 2L2OA 4XR6A 4E7SA 3OWTA 3CF2A 2IGNA 1ZELA 4P5OA 4PSWA 3QOEA 2R7TA 2HVQA 3A4CA 1E0EA 3EPZA 3IAS2 3EUHC 4IQJA 2WBMA 4DJAA 4NNJA 4PUSA 4CUGA 4XONA 3DTEA 4PJNA 2CV2A 4IKFA 4N4OB 2X1CA 3IUOA 3RCOA 3VDXA 5HVQC 4PJLA 3PL8A 1N75A 1Z7LA 4OWRB 3DWLE 1LFPA 2E1MC 1Y6IA 3OR1C 2PJRA 1MMDA 1MMNA 2RQQA 3S8PA 3EUKL 2V6EA 5HOOA 3PNTA 2DT7B 3OMYA 2GOXB 1GLNA 2X1EA 4IX7A 2MFZA 3OYKA 3F9KA 2CMPA 3OYBA 1W36C 3QODA 1MNDA 3OYMA 2DJIA 2R7VA 3OS1A 1NG6A 4HNUA 4CZCA 3OS0A 4CCNA 3VSKA 4E7LA 3K4MA 2Q2EB 2HNHA 2MD0A 4XNFA 1QHGA 3FBIB 2R7QA 3ZR8X 2W00A 2A5WA 2HPIA 2X51A 1TT0A 3DPTA 4XN0A 3CESA 3K4KA 4QPOA 2FUG2 4B43A 4XM3A 2HVSA 1W36D 2WB1A 4BQQA 4G6TB 1LKXA 2CFOA 3KEYA 2CW8A 2BW3A 4KJZA 3BC8A 3D5SC 3IAM2 4XLEA 5CKTA 2LREA 4E7ZA 2QKLB 3AL0C 1V5EA 2KRCA 3SEQA 1J09A 2KLOA 4N4NB 2KL4A 5JHFA 1WJBA 2PMZA 3QYEA 4RLQA 3OYCA 2IS2A 3FHNA 1PYVA 4CCJA 1WJAA 1X1DA 2WAQA 4Y3OA 2V4JC 4H4KC 3H5AA 2W1OA 1N78A 3K70D 1Y56A 2VB6A 2K9LA 2VLAA 3H0DA 2BVLA 2L9SA 4XQFA 3PUBA 1Z21A 3H35A 3CJRB 4F52A 4NUBA 3L2VA 1DQUA 4C2TA 4XMYA 4DIQA 3TL4X 4PJMA 4F3QA 3A1YA 2JVHA 3PNYA 4LG3A 4XORA 4CSWA 4F92B 2LBFA 1MMAA 1T95A 2P0WA 1Z3XA 4BDYA 3OL4A 3OYNA 2R7XA 3BCBA 4XL9A 2AQFA 2F5VA 1X1CA 2DXIA 5LFAA 3AFHA 2M4KA 1FMWA 4FETA 3DTIA 3K10A 4C9YA 4OAZA 2LOOA 2KQRA 3DKXA 2VL8A 3VYRB 3S3NA 2R7RA 2JSPA 2KRHA 2VJ5A 2MYSA 2DT6A 4BQOA 2X1DA 2Z1DA 1D1AA 4ZTFA 1X4PA 4QPQA 3OYEA 2KDOA 3H9QA 4EATA 3OYJA 4Y33A 2DCEA 4HEA2 2M3AA 1SFKA 2JA2A 2VJJA 4XLHA 4AYBA 2HPMA 2R7SA 2ZSHB 4J00A 3C2GA 4XOPA 4Y4RA 4ZYAA 4IZZA 5HLTA 4BDZA 3NWSA 1MW7A 3DKYA 3CP2A 3MKZA 1LDKB 2XF7A 3HG9A 4PFOA 3RTRA 3AKZA 3VWBA 3LFUA 4YEJA 1X4OA 2KP6A 3K4BA 4C30A 4KT6A 1JI8A 1OR7C 3K4LA 1WJ5A 3HPHA 4II3A 5KCMA 2ELJA 2RREA 1MMGA 3DLAA 4CCOA 3ZGKA 2XDVA 3LSMA 4ZTJA 2LY2A 1DGRM 3OOUA 2F6CA 2K9MA 3BG6A 4BXFA 2CW7A 4BL0B 3L2WA 1K6YA 2E5NA 3LSKA 3HL2A 4BUPA 2R7WA 2KZVA 3HKZA 3DEEA 4HSTA 3G2BA 3SDBA 3ZCOA 2HU9A 3VSLA 2WY8Q 2JVGA 2Z16A 3RSNA 3K70C 2VASA 3W2AA 3D5RC 3LSHA 3L2QA 4BQNA 5CQEA 3VYSB 4BJ5C 4YELA 2W4SA 5FRMA 3MKWB 2R4GA 3H5NA 3BLYA 2V1NA 3CP8A 4B47A 2ZXHA 2VQHA 2LYCA 4E7KA 3HOTA 5TGTA 4DBRA 2IS1A 2E60A 2IGOA 3V42A 3EUAA 3OYIA 4RM3A 4U7BA 3LSGA 3KX2A 2RNGA 4BS9A 2BOLA 4BE2A 4BE0A 3PJRA 3HPGA 3PNVA 2Z2SB 2VJIA 3OIPA 4R79A 4CA0A 3M1CA 2L5QA 1DP3A 1YX5A 3J7AY 2LRDA 2VQCA 3SZGA 3K6GA 3L2UA 2L9NA 2VJ4A 4PJJA 1WJFA 2W7NA 1UG0A 3LMMA 1NG7A 2K3PA 4HSRA 2HDWA 4BEHB 2BW3B 4J01A 4XKCA 4BEHA 3E0JB 1IRXA 2BVMA 2OUMA 5FRNA 1KONA 1Z3YA 3DU6A 2L7KA 2Q1ZB 4HRIA 4E7IA 3OR2C 1OLTA 3QYBA 2M7BA 2CH0A 2KPMA 3ZQQA 2VKDA 4D1QA 2K5CA 2CV0A 2NOJB 4RMNA 3CMMA 2KMUA 1BOBA 4RM2A 2I8DA 3S3OA 2HVRA 3CZ6A 3TBIA 4ZJZA 1D1BA 3LL7A 4XLCA 2WY7Q 4D9JA 2VQGA 3NWTA 4AU7A 3LSIA 2LY1A 4XN3A 3I9V2 2X6WA 2AQEA 3W2VA 2WAEA 2KHMA 1X19A 1V5FA 2JUGA 1DGWY 3E1SA 4II2A 4KISA 3HC7A 3AL0B 3H9GA 1YX3A 3BCAA 3MMYB 3RQ4A 1P9QC 2ZSIB 4ZDOA 2VPLA 4NC7A 2MABA 3UNGC 4BJ6C 3HOSA 4P1WA 5HNFA 3S3MA 2WA0A 4U87A 3L2RA 4B3XA 3DQVC 4AVZA 3GBGA 3I3LA 4ZDPA 1UELB 3OYGA 4BGDA 3W2WA 3PSIA 3ZRGA 1FMVA 4DGWB 1X1AA 4LIVA 2WAFA 4CCLA 4NQWB 1D0XA 1ERDA 5LD2C 2R7UA 3OYFA 2R7OA 1WFXA 2XAUA 5FROA 3S32A 1TZLA 3DU5A 4LITA 2X6YA 4X0GA 3FDYA 2Y0SA 1LVKA 3DPUA 3OYAA 2O5RA 4MLOA 1T0FC 3HXLA 1SAUA 4RLFA 4PFPA 2PJRB 2ZFUA 1D1CA 2IGMA 2UUZA 3BG7A 4XKWA 2HZDA 4E7JA 1VZ0A 1YE9A 2IS6A 2OV7A 4BACA 4JOMA 3TMOA 1QU3A 5CPRB 3OL3A 4E7HA 2XF6A 3FKJA 4ITVA 4C2UA 1AA7A 1QHHD 2CUJA 1U0JA 4XLAA 2CUZA 3H9JA 3OY9A 4E4HA 2M0MA 2M4GA 4ANJA 3PFYA 4CH7A 2VQLA 4XKVA 2DOAA 3KYLA 1WJCA 2HQAA 3H5RA 4HNTA 2V7FA 4F93B 2GOMA 2XF5A 3HUGB 1PJRA 2VIXA 5CQGA 1S9HA 1BR2A 3U21A 3IP4B 2V9KA 2OC6A 4F91B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRC A;  2M4K A;  4NC8 A;  4NC7 A; 
#chains in the Genus database with same CATH topology
 3A2K A;  5D4R A;  1JTX A;  2ME0 A;  3OSF A;  2VXZ A;  2E5Z A;  2GA2 A;  4ZDL A;  1MSE C;  1R22 A;  1Y0U A;  1LFU P;  3CMY A;  5HNH A;  2LC2 A;  4RDU A;  1MBK A;  3JRH A;  2BGC A;  3SFZ A;  3H36 A;  3TO7 A;  2HGC A;  3MZY A;  4KIT B;  3MVP A;  2DA4 A;  3BR0 A;  4LB5 A;  1OMI A;  1CF7 A;  3CUO A;  3A01 B;  4JX6 A;  5J47 A;  4JQF A;  4A3M J;  5HOD A;  1EA3 A;  2E35 A;  4IF4 A;  3Q3S A;  1Z1D A;  3ONQ A;  2COB A;  3OIQ A;  4U0W A;  4ENN A;  4Y17 A;  2AO9 A;  1MJA A;  2O0Y A;  1XPX A;  1P7J A;  1OCO H;  4F55 A;  1WHU A;  3OYL A;  4KIG A;  3H92 A;  2XPU A;  2ZFW A;  3KZI C;  3K2A A;  2STT A;  3WTU C;  2DI3 A;  5CVU A;  1WJE A;  5KHD A;  3ZPL A;  4BJT A;  5IT9 Z;  3CQZ J;  3Q5F A;  1R6R A;  1MBF A;  5FFX A;  1WCM J;  4PK4 A;  1IGN A;  1V5G A;  2HWV A;  4CGZ A;  4B48 A;  1P4W A;  4BU2 A;  3CCL I;  2EB7 A;  3GUD A;  3FWE A;  4AVP A;  2BXY A;  2YX4 A;  4MEY F;  1MDM A;  5DD4 A;  3PSF A;  4L9V A;  4LIU A;  3REO A;  3MKY B;  2BHY A;  1IZ1 A;  3A01 A;  1TWC J;  1TW3 A;  1U8R A;  3CJQ B;  5DD8 A;  4RAZ A;  2VON A;  4IRH A;  1IXR C;  5EZH A;  2L4M A;  3KIO A;  5KNL A;  2M8G X;  1EF4 A;  4Z6Y A;  1FTT A;  1KU9 A;  5BMZ A;  4QLC U;  3JTH A;  3GFI A;  2FNA A;  1XCB A;  3QOE A;  2R7T A;  2P6S A;  2BV6 A;  2HVQ A;  3S15 J;  2TDX A;  1VQK I;  5FGM A;  3EUH C;  3FIW A;  4RS8 A;  4IQJ A;  2OZU A;  3FK7 A;  2XKP A;  4NNJ A;  1XSD A;  1B72 A;  4PUS A;  1W1W E;  5L3B A;  3DTE A;  4PJN A;  3S1M J;  4IKF A;  4P96 A;  2WAQ N;  2XRL A;  3RCO A;  3VDX A;  4PJL A;  4LK1 F;  2EA4 A;  4RB2 C;  4M3E A;  2RGV A;  2LK2 A;  1G6N A;  4LOC A;  3CO6 C;  4EM2 A;  2MBF A;  2RQQ A;  2PG4 A;  2YPR A;  3CUQ C;  3GYH X;  4YFX F;  2DK8 A;  3M8E A;  4BXX J;  4BH9 A;  2GOX B;  2MA3 A;  3ASN H;  5IT9 K;  2KDZ A;  4IX7 A;  1OQY A;  4EJT A;  1S5L C;  4RAY A;  2CMP A;  1W36 C;  4UB8 C;  3J80 K;  2WB1 N;  2DJI A;  3KFW X;  2FD5 A;  2R7V A;  3OS1 A;  1ETK A;  1SFX A;  1YYV A;  5HLH A;  5K7Z A;  5F08 A;  1SD5 A;  3G1L A;  4CCN A;  2E1C A;  2E2I J;  2Q2E B;  1YW7 A;  1FC3 A;  4IVN A;  1HLV A;  3HGG A;  1TQI A;  1I6X A;  4LB6 B;  1QHG A;  2F5E A;  2ECB A;  3ZR8 X;  2EA2 A;  2NVX J;  3JTG A;  2A5W A;  2H09 A;  2PBI A;  4PGH A;  3SHF A;  3FXO A;  2X51 A;  3DPT A;  1YTY A;  2TCT A;  3Q0W A;  2XGX A;  3K4K A;  1O4X A;  5IP6 A;  2HVS A;  2JA5 J;  1AKH A;  4IHS A;  1T6S A;  2KIS A;  3JRB A;  4BQQ A;  2F5D A;  5AIP A;  2CW8 A;  2BW3 A;  1T33 A;  3HRM A;  5CKT A;  4Z2Y A;  3F21 A;  1I3A A;  2BE5 F;  2DOE A;  2X6O A;  3HM5 A;  1J09 A;  4KN7 X;  1P6R A;  1PUF B;  2I5U A;  4N4N B;  1WJB A;  2PMZ A;  2QVO A;  1JE8 A;  1CQT A;  4RLQ A;  3FHN A;  2WAQ A;  1ZKG A;  4Y3O A;  5D8K B;  1ZG3 A;  2KJB A;  1UG2 A;  3H5A A;  5D4S A;  2W1O A;  1N78 A;  4I7H A;  3VOE A;  1LPQ A;  1A6I A;  1FX7 A;  1LDJ A;  2XPW A;  3DCF A;  3K70 D;  5H6Q A;  1ZYR F;  2K9L A;  1ZK8 A;  2VLA A;  1ETY A;  1ETV A;  3H0D A;  2EBI A;  1LJ9 A;  1UCR A;  1IO2 A;  5L3F A;  2QQA A;  3L2V A;  1DQU A;  2MH2 A;  3CDH A;  5FLM J;  2BY1 A;  3JRG A;  1AKH B;  1KZH A;  2Q0O A;  3TL4 X;  4UV9 A;  4AD9 A;  1IUF A;  1IJW C;  2M87 A;  4F92 B;  3MWM A;  2LBF A;  3F8M A;  1BOA A;  1QBJ A;  1H9G A;  2JQ7 A;  1T95 A;  2O3F A;  1VQP I;  5D5W B;  3LQQ A;  1Z0X A;  1Z3X A;  1TTY A;  1X2M A;  3GZ5 A;  5J6X A;  3C18 A;  3OL4 A;  4HLX A;  3BCB A;  3TKY A;  5EG0 B;  1FNN A;  5LFA A;  2JRT A;  1TP4 A;  3G4S I;  2EIN H;  5ILV A;  2W48 A;  1FMW A;  1YIT I;  2WC2 A;  2P5V A;  3DTI A;  4RBO A;  4C9Y A;  4OAZ A;  2KQR A;  2KRF A;  4PCQ A;  5K5R A;  1S7A A;  2R7R A;  2KRH A;  2VJ5 A;  3DF8 A;  1WSU A;  2XAH A;  4BQO A;  2QSF X;  3HHG A;  1D1A A;  3H3Z A;  4NQW A;  1X4P A;  4GYG A;  5EYR A;  3OYE A;  2KDO A;  1FOW A;  4Y33 A;  2NNN A;  2XAF A;  3LA7 A;  1R58 A;  1OCC H;  3I4N J;  4IHY A;  2HKX A;  2M3A A;  4M73 A;  2JA2 A;  5GAH J;  2R7S A;  5DCM A;  1QZY A;  3C2G A;  2C6Y A;  3GTO J;  2PEX A;  4IZZ A;  4BDZ A;  1ZQ3 P;  4A3G J;  2YX7 A;  1H0M A;  1MW7 A;  3MKZ A;  2DT5 A;  2XF7 A;  1ACI A;  1BJZ A;  3RTR A;  5JFR A;  3VWB A;  1LQ1 A;  3QOP A;  4KIC A;  4C30 A;  2PFB A;  3ZQH A;  1L3L A;  1XSV A;  4JBA A;  2RRE A;  3CCY A;  2RV8 A;  5CVV A;  2FOW A;  2OU2 A;  1WH7 A;  3IWF A;  1IF1 A;  3I59 B;  1DGR M;  1QQI A;  2OCC H;  2K9M A;  3ECO A;  3M07 A;  3OOU A;  2RC4 A;  4P9U A;  3CC2 I;  4BL0 B;  1K6Y A;  1R49 A;  3P9C A;  1K78 B;  1RES A;  2QSG X;  1IN7 A;  3QPL A;  4HST A;  5FLV A;  2LKX A;  3LSR A;  2JN6 A;  3E3V A;  2P7C B;  2Y75 A;  3IKV A;  3VSL A;  3K70 C;  5CVI A;  4IPA A;  2OZ6 A;  5C4X J;  1I27 A;  3LSH A;  4WF2 A;  4HDU A;  5FRM A;  4YEL A;  3RKW A;  4AID A;  3WU2 C;  1T98 A;  3MKW B;  2R4G A;  3TOB A;  3CP8 A;  2CSO A;  2V9P A;  2VQH A;  1Z7U A;  5TGT A;  4DBR A;  1Z91 A;  1K4S A;  2E60 A;  4U7D A;  1WVR A;  4Q47 A;  3R0J A;  2EZL A;  3KP4 A;  5GTH C;  1V4R A;  3ZQF A;  1FPQ A;  3OYI A;  4RM3 A;  5ICG A;  4EVI A;  3GTL J;  2D5V A;  2HR3 A;  2DFE A;  1W0T A;  3MFK A;  3L00 A;  2IT0 A;  4EJU A;  3LOC A;  5KVR A;  2WWY A;  3HYI A;  5E18 F;  3I4P A;  1QNT A;  1DP3 A;  1ZRF A;  1G3W A;  2LRD A;  2VQC A;  3SZG A;  2XAJ A;  4Y52 J;  4UVC A;  2RDP A;  5IOZ A;  4PJJ A;  3W6K B;  3HBL A;  2E1O A;  2XAG A;  1J75 A;  1AHD P;  1XX5 A;  2W7N A;  3LMM A;  3CUQ A;  3FXR A;  4HSR A;  3KYC B;  1R71 A;  2CQX A;  1HXD A;  4XKC A;  2D1V A;  1OIS A;  4A3C J;  1ETX A;  5LRR A;  5IYD J;  3TOA A;  3GEZ A;  1P4X A;  2WV0 A;  2STW A;  3GWZ A;  4QTR A;  4DQ2 A;  5A2Q Z;  2Q8K A;  3OR2 C;  2K9N A;  5FLX K;  1OLT A;  3QYB A;  3PIP F;  2ZC2 A;  2CH0 A;  3TED A;  2VKD A;  2GXB A;  4D1Q A;  5FFZ A;  3G73 A;  1YJW I;  4RMN A;  2MC3 A;  3CMM A;  1BM9 A;  5IYB J;  3BR2 A;  5J1Y A;  4UUT A;  2CQQ A;  3S3O A;  1OYI A;  1FWZ A;  3KZY A;  4GDF A;  2VQG A;  3QP5 A;  4L0Z B;  4AU7 A;  2IA2 A;  4EJW A;  3IV5 A;  1D5Y A;  4XN3 A;  1YW8 A;  2X6W A;  5E1Z B;  3BPV A;  4Y7N J;  2OQR A;  2WAE A;  2KHM A;  4ZH4 F;  4G6Q A;  1X19 A;  1DGW Y;  2B63 J;  2HOE A;  4OU0 A;  4KIS A;  5AON A;  3AL0 B;  3BCA A;  1G4D A;  2DLL A;  1OR7 A;  4ZDO A;  1F9N A;  1U2W A;  2B9S A;  4GCV A;  4A2U A;  2KIQ A;  2RN7 A;  1OKR A;  2A6H F;  2WA0 A;  4HYE A;  4P1W A;  3KE2 A;  3BP8 A;  3S1R J;  3LWF A;  4A3L J;  4OIN F;  1UEL B;  2G7H A;  2GWR A;  3ABU A;  3RYP A;  1FLI A;  1T39 A;  2P7V B;  2BYV E;  2FQ3 A;  2DQL A;  3F72 A;  4FHT A;  2EV5 A;  2R7O A;  1RIO H;  3M8F A;  4U88 A;  1FSH A;  1WFX A;  4B8X A;  1QO0 D;  2DW4 A;  2HYJ A;  2JK3 A;  3CCE I;  1LFB A;  4FX4 A;  1TZL A;  1Q1H A;  3FDY A;  3DPU A;  3OYA A;  1ZR2 A;  1T0F C;  2GM4 A;  3EYY A;  4PFP A;  1GXP A;  1W5T A;  5DCF A;  1QPI A;  2DQR A;  3GTM J;  1BI2 A;  2A6E F;  2ZFU A;  1VFC A;  1AWC A;  1D1C A;  1I6H J;  2IGM A;  4IHV A;  3PM1 A;  3BG7 A;  2HYF A;  1ZLK A;  3VFZ A;  2HZD A;  3EQL F;  4BAY A;  2IS6 A;  4OIO F;  4JOM A;  3TMO A;  3IL2 A;  1MBJ A;  1SFE A;  5B66 C;  4RGR A;  3BR6 A;  2NS7 A;  5L3E A;  1AA7 A;  3GX4 X;  2QBY B;  1SVM A;  2F4O B;  4YIF A;  5J1U A;  4E4H A;  2M4G A;  1RZ4 A;  4CH7 A;  1R5I D;  4NBQ A;  3BTJ A;  1B6A A;  1BI0 A;  4I09 A;  3KYL A;  5JLW A;  4A93 J;  4NHJ A;  1FIP A;  1UZC A;  2CW0 F;  2HDD A;  1QZZ A;  3F8C A;  5DYM A;  4A3J J;  4F91 B;  1MNE A;  2DOD A;  1VTN C;  3B6C A;  3C2H A;  4BE1 A;  3OYD A;  1WJD A;  2YR2 A;  1VQ4 I;  1ZG5 A;  5AIQ A;  1WWX A;  3I53 A;  2LH9 A;  4GRI A;  2G0E A;  1ZAO A;  2UV1 A;  1K7A A;  1G8X A;  1X3Z B;  1O3S A;  2MC4 A;  4ZC3 A;  3NQO A;  2QF7 A;  4PSX A;  2DMU A;  5CYV A;  3LA3 A;  2R5Z A;  3RPU D;  1NH3 A;  5HS7 A;  3CF5 F;  3GTP J;  1TQM A;  1EJ9 A;  1IAW A;  5CLS A;  3VYT B;  3AG2 H;  4B3A A;  2QUF A;  5D8L B;  4JP0 A;  4N0B A;  3TQN A;  3HDD A;  3VEP A;  2VKH A;  2H8R A;  1R36 A;  2IXS A;  2R3S A;  2JA6 J;  3QYF A;  4HQE A;  2XSJ C;  3RDI A;  1UHW A;  4R8H A;  3O8G A;  3ROU A;  2DYS H;  2JUC A;  3HOW J;  3UR3 C;  3KET A;  2B0L A;  5J4Y A;  2IVM A;  2ID6 A;  1C0W A;  4HG2 A;  4G9Y A;  4XID A;  2FE3 A;  1YIJ I;  1REP C;  1MJB A;  2VN2 A;  2NVT J;  1ORK A;  4HPQ A;  2HI3 A;  2MGQ A;  2H8W A;  1BR1 A;  1UST A;  5D6F A;  2AS5 F;  3K1M A;  4M6Y A;  4MHG A;  4DBQ A;  2IA0 A;  3SYT A;  2QZ8 A;  2Y30 A;  2LBF B;  1MIJ A;  1RPW A;  1RR7 A;  2W82 A;  5FKN A;  1HST A;  1UAA A;  1D0Z A;  3J7Y J;  3RI4 A;  1JHH A;  3SZP A;  2CV1 A;  3HKZ N;  1SD7 A;  2E19 A;  3KPH A;  3VYU B;  1JHF A;  3GVA A;  1PP7 U;  5M3F J;  2X9D A;  3S93 A;  4XSZ F;  3SEZ A;  1BR4 A;  2DFH A;  4XR6 A;  3O2P E;  4IRI A;  4Y13 A;  4KMF A;  4RB1 A;  3OWT A;  2IGN A;  3HGY A;  4JYK A;  4U0V A;  3JAM Z;  5BNG A;  4OOI A;  3I64 A;  2WTE A;  4CYD A;  4HAM A;  2HZT A;  2WBM A;  1GT0 C;  1EV7 A;  3VOD A;  4CUG A;  1IRG A;  1SD4 A;  2CV2 A;  2X1C A;  1R1U A;  2CQN A;  1GDT A;  3R0A A;  3F23 A;  4OWR B;  4FT8 A;  1R4N B;  1UJ8 A;  1X3U A;  2ELH A;  2B7E A;  2KIF A;  1MMD A;  2YUS A;  1MMN A;  1ON2 A;  1ZGJ A;  4ON0 A;  1MBG A;  3S8P A;  4Q48 A;  3T1B A;  1AOY A;  2L01 A;  2ADU A;  3BT9 A;  3OMY A;  4V2G A;  2EJR A;  2CQK A;  1XMA A;  4IHX A;  4KIB A;  4HBL A;  2PMZ N;  2EFO A;  4KT5 C;  1MJ9 A;  3HEF A;  3SJM A;  2Z99 A;  2VKE A;  1NG6 A;  1VQN I;  4HNU A;  2Q2E A;  5IP7 J;  3BQY A;  3ERM A;  4OMZ A;  2IJL A;  1HDD C;  5JVT A;  4UY8 I;  4DNC A;  2D1H A;  4G8X A;  3EYI A;  3TW6 A;  4M9S A;  3KP7 A;  2D2W A;  4AIK A;  1K78 A;  3TP0 A;  1XD7 A;  2JZY A;  2LVS A;  1H88 C;  1TL8 A;  2A68 F;  2XVC A;  1TT0 A;  3BQZ A;  3DLL F;  3EET A;  3CES A;  3IH4 A;  2FUG 2;  3GTG J;  4HOB A;  2VUM J;  2HTS A;  2WB1 A;  5DUK A;  1W36 D;  3PO3 J;  4G6T B;  2NS0 A;  3KEY A;  2M9H A;  1FJL A;  2ZCW A;  3AG3 H;  3JAM K;  3DXJ F;  1KQ9 A;  4GFB A;  2NVQ J;  5GAE J;  2IA1 A;  2E34 A;  3QP6 A;  3QU3 A;  1QA6 A;  1TWH J;  2KLO A;  1MD0 A;  5JHF A;  3E7L A;  2HYG D;  4MIM A;  3V8K A;  2XKO A;  5LLQ A;  3OYC A;  2DFF A;  2IS2 A;  3N97 A;  1HF0 A;  1WJA A;  2JMW A;  3BZC A;  2IBD A;  4H4K C;  3DFG A;  1BW6 A;  2EIL H;  2NNY A;  4W97 A;  4WXD A;  2JTV A;  2JSC A;  3GFJ A;  4B1R A;  2CGP A;  1KYW A;  2M1B A;  1Y8Q B;  4ZYD A;  2K7L A;  1Z21 A;  1XMK A;  4F52 A;  1R7J A;  4FX0 A;  4DIQ A;  3WG9 A;  4A3K J;  1ETO A;  4G6D A;  4E70 A;  3PNY A;  1VQ8 I;  3CUQ B;  3HRU A;  2YU3 A;  4FIS A;  3V4G A;  3IRR A;  1S29 A;  2P0W A;  4XIC A;  3OYN A;  1U3E M;  1E3H A;  4HV6 A;  1LEA A;  2F5V A;  4A3F J;  5K5O A;  5B1A H;  5JI6 A;  2R5Y B;  3RJP A;  2W24 A;  5ICE A;  2DXI A;  1XTA A;  3E5Q A;  4W1U A;  4EQQ A;  1O3Q A;  1B1B A;  2EK5 A;  2Z9O A;  3H1C A;  1O57 A;  3ZMS A;  3DKX A;  1NK3 P;  2VL8 A;  1Z67 A;  2M34 A;  3DBL B;  2IW5 A;  3S3N A;  4FTH A;  2JSP A;  2MYS A;  3ELK A;  4V19 K;  2DT6 A;  2EFN A;  2X1D A;  2Z1D A;  1SFO J;  4Q5S F;  2M30 A;  2KZG A;  3H9Q A;  4A0X A;  4XSX F;  3WE3 A;  2KT0 A;  3TW7 A;  1XC5 A;  2ID3 A;  1MGT A;  2P5K A;  4B4C A;  2OAZ A;  2Y0M A;  2K27 A;  1LE8 A;  2ZSH B;  4M3D A;  3KLO A;  5JVG F;  1E2X A;  5ERI A;  4J00 A;  3ZN1 A;  2ZNZ A;  1SAX A;  4ZYA A;  4Y4R A;  5HLT A;  3LQR A;  2R5Y A;  3IKT A;  1ZGW A;  3DKY A;  5E3N A;  1W7P B;  3D0S A;  4K2E A;  3WGG A;  4L5I A;  5J3L A;  2IEK A;  1HW1 A;  2OPT A;  3HG9 A;  4PFO A;  3ZQG A;  4IRG A;  1KU7 A;  3DV8 A;  1FBU A;  4MQ9 F;  3AKZ A;  1X4O A;  4BY7 J;  3T8R A;  2EQR A;  5FB2 A;  1X2N A;  2VC0 A;  1YHQ I;  1JI8 A;  1FOX A;  2OTL I;  5J40 A;  4II3 A;  5KCM A;  5E8I A;  3DLA A;  5H6R A;  3WTW C;  5GP9 A;  1D8J A;  1AU7 A;  2XDV A;  3S2W A;  2LY2 A;  4MO7 A;  2QGU A;  5J8C A;  4BXF A;  1ODD A;  2KFD A;  2E5N A;  3HL2 A;  3HUG A;  2KZV A;  1DU6 A;  3FM3 A;  1R1T A;  2OTJ I;  4BNC A;  4HF2 A;  3CJT B;  3M1E A;  3S2H J;  3IH2 A;  4I0A A;  4V2F A;  1R9T J;  2NYX A;  1POG A;  2WY8 Q;  2Z16 A;  2VAS A;  2DK5 A;  1BI3 A;  3BR3 A;  1ZN2 A;  3D5R C;  1BN5 A;  1W7P A;  4IL6 C;  1WGX A;  1X1P A;  2I10 A;  3Q0V A;  4RA2 A;  4B47 A;  1EH6 A;  3CDL A;  3BR5 A;  3HOT A;  2EPF A;  3HRS A;  3V42 A;  2EFW A;  1XN7 A;  3ABL H;  3QQA A;  4U7B A;  2VI6 A;  3KX2 A;  2RNG A;  4UVA A;  4WCG A;  2BOL A;  4BE2 A;  3KLN A;  1Y8R B;  5DDG A;  3HPG A;  1VQL I;  1GV5 A;  3PNV A;  1T56 A;  4R79 A;  2AHQ A;  3MN2 A;  4A6D A;  1YX5 A;  3J7A Y;  1KA8 A;  2GIZ A;  3WTS C;  4OIQ F;  2ZJ2 A;  3G1O A;  3V7R A;  1F4K A;  3H3V K;  1ITY A;  4CO8 A;  3ZP5 A;  3L2U A;  1MKM A;  2VJ4 A;  4AWX B;  1E17 A;  1WJF A;  2FQ4 A;  2HXI A;  3I5U A;  3E6M A;  3MQ0 A;  1Y1V J;  3AG4 H;  4QIW N;  2K3P A;  2HDW A;  4LK0 F;  4XLP F;  5E1W A;  2GBY A;  3CJN A;  1ETQ A;  3E0J B;  2Z5U A;  2PX9 A;  2XGD A;  2J5O A;  3BTL A;  1EH8 A;  3L9F A;  2EIJ H;  1YFH A;  1DUX C;  2L7Z A;  1YRN B;  1S7O A;  4KA4 A;  1Z3Y A;  3V7C A;  2Q1Z B;  4EGZ A;  5D5V B;  2R5Z B;  3KP5 A;  4HRI A;  1IN6 A;  2QWW A;  2R7D A;  4IO9 F;  1IC8 A;  3NAU A;  3K7A J;  2VKV A;  4RGX A;  2K5C A;  1TLH B;  2NOJ B;  5LHG A;  3AAF A;  1ZAR A;  3WU1 B;  1B8I B;  4IEJ A;  2KMU A;  3RPU A;  1BOB A;  4RM2 A;  1FP1 D;  1KU2 A;  3JR9 A;  2HVR A;  4M74 A;  1JT6 A;  3CZ6 A;  4XK4 A;  1IXC A;  3TBI A;  4ZZL A;  1D1B A;  1FP2 A;  1ZRD A;  1GVJ A;  1P4A A;  3KP6 A;  4XLC A;  5E8G A;  2WY7 Q;  4D9J A;  1DU0 A;  3NWT A;  3HRT A;  1VQO I;  1NTC A;  3LSI A;  2LY1 A;  2P8T A;  3K1P A;  4KN4 X;  2O7O A;  1R00 A;  3VPR A;  3BJ6 A;  3JRI A;  2H94 A;  2JUG A;  3JRD A;  4QWQ A;  3CC7 I;  3KEO A;  5LGT A;  1K4T A;  1K79 A;  1YRN A;  1P9Q C;  4JX5 A;  4NC7 A;  2RVC A;  2HEO A;  3CCQ I;  3HOS A;  5HNF A;  4XRS G;  1DP7 P;  3L2R A;  1G3S A;  1WI9 A;  4QSH A;  3GLX A;  1X58 A;  4EM0 B;  4H0E A;  3DBH B;  2YU9 J;  4ZDP A;  1G2H A;  5IY5 H;  2ZJP F;  3W2W A;  3PSI A;  3ZRG A;  5EJC A;  2E2H J;  2QLZ A;  3TGN A;  2FRH A;  2ESH A;  2FBI A;  2WAF A;  1PP8 F;  4ENK A;  1K61 A;  2PMU A;  2XIG A;  5K7F A;  2IRF G;  2CUE A;  2Z3Y A;  2UXX A;  5E17 F;  2FBK A;  1ERD A;  5LD2 C;  5E3L A;  3OYF A;  1OCT C;  5C44 J;  2L0K A;  3ZMD A;  4D7M A;  4A12 A;  3J7Z I;  2QSH X;  3S32 A;  1Y39 A;  2X6Y A;  3CCR I;  2GQQ A;  3QPH A;  4BHC A;  3F22 A;  4DZP A;  4MLO A;  3BTI A;  1LVA A;  1SAU A;  1HKS A;  4D7N A;  3S2D J;  2DFI A;  2UUZ A;  1BI1 A;  2YSR A;  2QA4 I;  3JCU C;  4E7J A;  5K1Y A;  2LLK A;  1U6G A;  4OIP F;  3ZQL A;  5ICC A;  2MG4 A;  5CPR B;  3IWZ A;  4L9J A;  2FA5 A;  4LG0 A;  2HOA A;  2NAZ A;  1U0J A;  4RGU A;  4XLA A;  3CLO A;  3H9J A;  1T0F A;  3HTU A;  1OFC X;  2O9L A;  1MSF C;  2VQL A;  1F5T A;  2DOA A;  1YS6 A;  3FM5 A;  4M6X A;  1WJC A;  4AUX A;  2XF5 A;  3I4M J;  2XRN A;  1TNT A;  3OIO A;  5B3S H;  3FMR A;  3U21 A;  3IP4 B;  5F0H A;  1A36 A;  4MQV A;  2OC6 A;  4CZZ A;  2CO5 A;  2F2E A;  4Y15 A;  1A5J A;  3D5L A;  3ZXS A;  1OCR H;  1HA8 A;  2QYO A;  3L7W A;  4N9I A;  4NC6 A;  1TWF J;  1Y1W J;  1IRF A;  1P2F A;  1RUN A;  2EZK A;  3S1N J;  4HX7 A;  3DTK A;  2XC7 A;  2DTR A;  4CCM A;  1IN8 A;  3K4J A;  2K02 A;  4B44 A;  2MSY A;  5K7H A;  3K4N A;  2R7Z J;  1BL0 A;  1G3T A;  1D0Y A;  3FK6 A;  1IW7 F;  2RAE A;  4RAF A;  2MW8 A;  3W3C A;  2HOS A;  2DA1 A;  3ZQI A;  5F1J A;  1IV6 A;  5F6F A;  4I98 B;  2WAD A;  3M8J A;  2F4I A;  2X85 A;  1X1B A;  4I0B A;  2EIK H;  3G71 I;  2M7A A;  2QEN A;  3EDP A;  2VOP A;  1N77 A;  1WPK A;  4XKB A;  3JSP A;  1FTZ A;  1JTY A;  2E71 A;  2XB5 A;  2VXD A;  1O3T A;  1XS9 A;  3QWL A;  4IQ4 A;  2UWM A;  2H1K A;  2F5C A;  3LFK A;  2QEX I;  5TRD A;  4DOZ A;  1P7I A;  2IGK A;  3OYH A;  1TC3 C;  2DA7 A;  2QKM B;  2K86 A;  5IOY A;  5C4J J;  5DCM B;  2XPV A;  3E6B A;  3GME A;  3DKW A;  3FZV A;  2A6T A;  1F36 A;  5J1R A;  1UB9 A;  2HKO A;  3K9T A;  3HSR A;  2ZXI A;  3CCM I;  1TBX A;  2GZW A;  2W84 A;  2BY3 A;  5BPI A;  3I71 A;  1K83 J;  1H89 C;  1JJ8 C;  1U9O A;  1S7E A;  5F0F A;  1ZEL A;  4P5O A;  4PSW A;  4A6E A;  4RB3 C;  3JSO A;  4ABZ A;  2BEO A;  1EKE A;  2OD5 A;  3A4C A;  2BY2 A;  2L3D A;  2A07 F;  2KKO A;  4XON A;  1OPC A;  2P81 A;  2DA5 A;  4N4O B;  2Y0S N;  4LJZ F;  3PL8 A;  1DDN A;  2N8G A;  5BPD A;  1Z7L A;  4ENM A;  1K6O A;  3NAR A;  4ZYG A;  3DWL E;  1LFP A;  3CDI A;  2E1M C;  4C3J J;  1SC7 A;  1Y6I A;  2PJR A;  1JUS A;  4LGW A;  3W6J B;  2K85 A;  2E36 A;  3IHU A;  2V6E A;  2ZXJ A;  1TWA J;  5E20 A;  4Q4Z F;  5FO5 A;  5HOO A;  1HKT A;  3PNT A;  3F0C A;  2DT7 B;  4BBR J;  2OBP A;  3G1M A;  1GLN A;  1GXQ A;  5IPA A;  2XUB A;  3QPT A;  3QOD A;  1QVT A;  4FQG A;  3OYM A;  1SEU A;  4MEX F;  2EZH A;  1SVL A;  1SAN A;  2XB0 X;  3EUH A;  2ME6 A;  4KDP A;  4CZC A;  1J59 A;  1BBY A;  4HW0 A;  1M1E B;  1Z77 A;  2HNH A;  1W5C C;  4MGR A;  5DUI A;  1LEB A;  2MD0 A;  3LSP A;  3ZMZ A;  1PVE A;  1A35 A;  1MBE A;  4XNF A;  4XRS A;  3FBI B;  2VBY A;  2HQR A;  2MLK A;  4A3I J;  3DEW A;  1IN4 A;  3WG7 H;  5D5U B;  4XN0 A;  4TV7 A;  4WXH A;  4HF1 A;  4B43 A;  2H6B A;  6PAX A;  3WHC A;  3AG1 H;  4I99 C;  4FE4 A;  2ZBK A;  4L5E A;  3LNQ A;  3WGI A;  2F4M B;  4KJZ A;  3MEX A;  2HS5 A;  3D5S C;  4XLE A;  4E7Z A;  1Z6R A;  2LRE A;  2QKL B;  3AL0 C;  4BHP A;  3I58 A;  4EV0 A;  4CIC A;  1U5T B;  3F8N A;  3BDD A;  3TO9 A;  3V8J A;  1O7F A;  2KL4 A;  3GFM A;  3RKX A;  1ONV A;  3FX3 A;  3QYE A;  1PYV A;  2EIM H;  1X1D A;  2K9Q A;  2V4J C;  3U9G A;  3SQN A;  4KNY A;  2MD5 A;  1ZH5 A;  3WHB A;  1Y56 A;  3MAJ A;  2VB6 A;  1IG7 A;  1XDU A;  2VC1 A;  5FKL A;  4DYR A;  2Y9Z A;  1XGM A;  2CG4 A;  3COA C;  3P9K A;  2BVL A;  5IP9 J;  2L9S A;  4ENJ A;  3FHZ A;  1VI0 A;  4NUB A;  3C2B A;  4C2T A;  2PMH A;  2CRG A;  4WX9 A;  3A02 A;  4PJM A;  3A0H C;  3KP3 A;  4LG3 A;  4XOR A;  4GXO A;  4HLY A;  1I1S A;  5DM6 F;  4AIH A;  2HOT A;  1SMY F;  1N25 A;  4M3G A;  2FX0 A;  3F8F A;  2V1U A;  2DMQ A;  4XL9 A;  1X1C A;  1XB4 A;  4RAG A;  3AFH A;  4RB0 A;  1BW5 A;  2K9S A;  2M4K A;  1HCR A;  1R1V A;  1UHS A;  2LY9 A;  4ESJ A;  4J19 A;  3FIS A;  1T2K A;  1RKT A;  5D5X B;  1FT9 A;  3K10 A;  2ISZ A;  2Y9Y A;  2X48 A;  2V1D A;  3MKL A;  3GTQ J;  3D1N I;  3Q9S A;  2E7X A;  5KK1 A;  4C3I J;  1E3O C;  2PLY A;  1FYL A;  4MTE A;  1H9T A;  5FKO A;  4QPQ A;  1LUJ B;  2ICW G;  4EAT A;  3LAJ A;  2KIU A;  3CCS I;  4UNO A;  5D6E A;  2EWN A;  4YG2 F;  3A0B C;  1S3J A;  3HSE A;  3MCZ A;  1J7K A;  4DYC A;  2DN0 A;  1MDM B;  4HEA 2;  4LLG F;  3CME I;  4HDV A;  1LE8 B;  1SFK A;  2VJJ A;  4XLH A;  4AYB A;  1HOM A;  1KGS A;  1FEX A;  2CU7 A;  4YFN F;  1HBX G;  4CDG A;  1SMT A;  1RKW A;  2IPQ X;  4XOP A;  2R7F A;  2WV1 A;  3NWS A;  4EGY A;  4UV8 A;  4M9Z A;  2GAU A;  2XHK A;  2XGC A;  3V7S A;  4YEJ A;  4KT6 A;  2DJN A;  2Y31 A;  1WJ5 A;  2ZME B;  3HPH A;  1RRJ A;  2VBW A;  3GCM A;  4UUS A;  2V9V A;  3ZGK A;  5LHI A;  4ZTJ A;  2CUF A;  2R92 J;  3RZO J;  2F6C A;  3WTZ A;  1ZG1 A;  1B72 B;  1FY7 A;  1HC8 A;  3O8H A;  3LSK A;  1RET A;  5CVR A;  3WTV C;  4A5M A;  4S05 A;  3BJA A;  3DEE A;  3J80 Z;  4PJ0 C;  3R4K A;  2RKH A;  4ZZD A;  1USS A;  2CQ7 A;  3W2A A;  3RSN A;  3K0L A;  1XGN A;  4A0Z A;  4BHB A;  2EV0 A;  3WTX C;  3VYS B;  4BJ5 C;  3H3U A;  4C3H J;  3H5N A;  2Y2Z A;  3GF2 A;  2FF4 A;  4MFE A;  1GV2 A;  2LYC A;  2IS1 A;  4A69 C;  2VE8 A;  1ZTR A;  2L02 A;  3EUA A;  3RIR A;  4EEF G;  4I2O A;  3Q9V A;  4YII A;  3HB9 A;  3LSG A;  1IRZ A;  5LBQ A;  5BOX A;  3S14 J;  4BE0 A;  1V55 H;  1O7L A;  4G7O F;  4P9F A;  1T38 A;  2VJI A;  3OIP A;  1HDP A;  3M1C A;  2L5Q A;  1I50 J;  3JRE A;  4M3B A;  3FMS A;  3K6G A;  3CC4 I;  2L9N A;  3HTS B;  3BG5 A;  2L7F P;  4M71 A;  5CJ9 A;  3ZMU A;  5M5X J;  3CMA I;  5IT3 A;  3M9A A;  2V79 A;  1UG0 A;  3E5U A;  2UZK A;  2ZME C;  2GXG A;  2BW3 B;  2DBB A;  3F8B A;  4J01 A;  2M5W A;  4BEH A;  3Q0U A;  1IRX A;  4UXN A;  2BVM A;  4AC0 A;  4CYC B;  5FRN A;  3WTY C;  4ESF A;  3DU6 A;  2L7K A;  5EEG A;  2P4W A;  3HIF A;  4D5F A;  5E3M A;  1VQ9 I;  3SXY A;  2DDB A;  4PGG A;  3ULQ B;  1XGO A;  1Z9C A;  3CD6 I;  4IOA F;  1FOY A;  2ETH A;  1FZP B;  3V8L A;  3U2R A;  5F64 A;  1B4A A;  1ULY A;  1IXS B;  3ERE D;  1QPM A;  2LDU A;  1W0U A;  5E1X A;  3ABK H;  2FOK A;  1YQA A;  4ZJZ A;  1XDS A;  4DZJ A;  2K40 A;  4NB5 A;  2L54 A;  2OCE A;  3ZMT A;  3WU0 A;  1HW2 A;  3LST A;  3E97 A;  5EZG A;  1YIO A;  5F27 A;  3W2V A;  1BA5 A;  1LNW A;  3CLQ A;  2XV4 S;  3ZN0 A;  2PN6 A;  2LP0 A;  3M7G A;  3GTJ J;  1V5F A;  3E1S A;  4II2 A;  3N4M A;  3ECH A;  1BC7 C;  4L18 B;  3HOV J;  3H9G A;  5E3O A;  3RZD J;  2VPR A;  1A6Q A;  1MZB A;  2LF8 A;  3MMY B;  4MFD A;  1J5Y A;  2VPL A;  2LFB A;  2MAB A;  2FML A;  3DEU A;  1ZHF A;  3SZT A;  5EG0 A;  2ZO4 A;  3GTK J;  3S3M A;  4U87 A;  2JPC A;  2VOO A;  1G3Y A;  2GIV A;  3BG9 A;  2QQ9 A;  3G3Z A;  2XSD C;  3DQV C;  3O6B B;  3I3L A;  2DMN A;  4WXC A;  2CWE A;  5GTI C;  4BGD A;  5HDG A;  1FMV A;  5JLX A;  4LMY A;  1X1A A;  4LIV A;  1B59 A;  2E1N A;  4LLL A;  4CCL A;  1VQ6 I;  4NQW B;  1D3Y A;  3T0Y A;  3BTC A;  1JGS A;  2JRM A;  1R5G A;  4KYW A;  1CGP A;  2LSO A;  3I54 A;  2VOD A;  4IHW A;  2XAU A;  5FRO A;  2A05 A;  2JPB A;  4LIT A;  3CO7 C;  4XBF A;  4X0G A;  2O5R A;  1TWG J;  2BHZ A;  3HXL A;  3J7A O;  4I76 A;  2HFH A;  2PJR B;  2O8K A;  4G94 A;  2QQB A;  1IDY A;  5EEA A;  1MH3 A;  1HW5 A;  2ISY A;  4HQM A;  4XKW A;  1U5T C;  1Z05 A;  1YE9 A;  3L09 A;  4CXF A;  3HHH A;  1VQM I;  1YW9 A;  4BAC A;  4KMU X;  1QU3 A;  1MBH A;  2QQ8 A;  1GHC A;  4E7H A;  3FKJ A;  3BRO A;  4B09 A;  1QHH D;  2TRT A;  4C2U A;  1HQC A;  3BWG A;  1Y0N A;  2CUZ A;  3DBR B;  3OY9 A;  4JK1 X;  5GAG J;  2M0M A;  1O3R A;  4D5C A;  2L9V A;  2G9W A;  1FYK A;  5ED4 A;  3I59 A;  3PIO F;  2Y69 H;  3BZ6 A;  3H5R A;  3O3K A;  2V7F A;  2OA4 A;  4F93 B;  5K5Q A;  5GAD J;  4MNU A;  2VIX A;  2CYY A;  2FEZ A;  2RNJ A;  3W6V A;  2QCO A;  9ANT A;  3OV8 A;  2V9K A;  4G7H F;  4AM3 A;  4LFU A;  3MD2 A;  1L0O C;  1IV8 A;  4HNV A;  3G6E I;  3ZQC A;  1S8N A;  3F3X A;  1OYW A;  3QRF F;  4HF0 A;  2BZT A;  5CVJ A;  5L3C A;  3WTT C;  1FYM A;  2FNP A;  3FF5 A;  3JRA A;  4LD5 A;  5DS9 A;  4M9X A;  3BZK A;  4E6K G;  4EJV A;  3FKI J;  3FXK A;  2XAQ A;  4YRV A;  4NC8 A;  1ZRC A;  3S16 J;  2M0C A;  1W5S A;  4KUM A;  4BBS J;  3DPL C;  3N05 A;  2E1M B;  2VE9 A;  2IS4 A;  4CHU A;  1X3W B;  2W57 A;  2KJC A;  1U9N A;  4OMY A;  3FBN B;  4U0Y A;  1FSE A;  4L9T A;  1RC9 A;  3L1P A;  3OS2 A;  2ESN A;  2CS3 A;  2X4H A;  1VQ5 I;  4BY1 J;  1SVO A;  4OAY A;  1ENH A;  4CCK A;  1G59 A;  5A2Q K;  5FLX Z;  3BJO A;  1XGS A;  2V26 A;  3I0T A;  2LTP A;  4XOT A;  1FIA A;  1TNS A;  2DOF A;  2V6C A;  2LG4 A;  3K4C A;  4PZJ A;  3JRC A;  3LAP A;  3E5X A;  4FAS D;  2E7W A;  1YOV B;  3GZ6 A;  2HXO A;  5KAF C;  3GLL A;  2A3S A;  2BBY A;  5ILS A;  2X6X A;  2XGE A;  2DAO A;  4XLF A;  1A31 A;  4ESB A;  2L2O A;  3K2Z A;  1VF9 A;  3BY6 A;  4E7S A;  2DA6 A;  1FBS A;  1UHM A;  5LHH A;  1OCP A;  3CF2 A;  5EDN A;  1STZ A;  4HA8 A;  2JT1 A;  2M8E A;  3TP3 A;  3L2C A;  3EPZ A;  3IAS 2;  2Y48 A;  1E0E A;  3LSJ A;  1I5Z A;  2JJ7 A;  4DJA A;  3X2Q H;  3J81 Z;  2PI0 A;  2O61 A;  5F04 A;  3I55 I;  4EJO A;  3IUO A;  5HVQ C;  1N75 A;  4MTD A;  4X1E A;  2MH9 A;  2H1L A;  5LEJ A;  1YO5 C;  2PQ8 A;  2K4J A;  4HZF A;  2HDC A;  3S1Q J;  1IDZ A;  3MZ8 A;  3OR1 C;  2LKS A;  4WK8 F;  2ELK A;  1JKR C;  1WZ2 A;  3EUK L;  2LD5 A;  3HOX J;  1JT0 A;  2VT3 A;  1RUO A;  2X1E A;  1WI3 A;  2MFZ A;  3OYK A;  2IP2 A;  3F9K A;  3NEU A;  3OYB A;  4ASN A;  3C7J A;  1MND A;  2GLO A;  1F43 A;  2VT2 A;  5M5Y J;  2ZNY A;  4S04 A;  3OS0 A;  3CTA A;  3LA2 A;  2OQG A;  3KEQ A;  3VSK A;  4E7L A;  4IHT A;  1XCV A;  3K4M A;  2GXA A;  2DMP A;  2FXA A;  5GPC A;  5EF6 A;  3E6C C;  2R93 J;  2M2E A;  2R7Q A;  3CCV I;  1S72 I;  3WE2 A;  1MNM C;  4BQA A;  2W00 A;  1JKP C;  2HPI A;  1QZE A;  2DDA A;  1U8B A;  5DV5 A;  4QPO A;  3RKY A;  2ZJR F;  5GPA A;  4XM3 A;  1U78 A;  5HLI A;  5DM7 F;  2ZJQ F;  1LKX A;  2CFO A;  1J0R A;  5J8F A;  3BC8 A;  2IAI A;  1YG2 A;  3IAM 2;  1V54 H;  2CJJ A;  3ZMV A;  4R1H A;  5LEK A;  2XRO A;  2QM3 A;  1V5E A;  2KRC A;  2LNB A;  3SEQ A;  4WWC A;  1YI2 I;  2K3F A;  3ASO H;  4D0P A;  4ZYH A;  3B02 A;  3J81 K;  2K4B A;  2QBY A;  4CCJ A;  2VBX A;  3F6O A;  3GFL A;  4G7Z F;  3TO6 A;  3KP2 A;  1RR8 C;  1PUE E;  1JGG A;  2DU9 A;  2E2J J;  2L7M P;  1B8I A;  2EH3 A;  3HOY J;  2COM A;  2YS9 A;  3SDG A;  3C3W A;  3CCJ I;  2ECC A;  2GA1 A;  4BXU A;  1DPR A;  4XQF A;  2DA2 A;  3PUB A;  3JW4 A;  3H35 A;  3CJR B;  4ZYE A;  3ZQ7 A;  4XMY A;  1JUM A;  1RNL A;  2FBH A;  3R60 A;  4FE7 A;  3ESW B;  4F3Q A;  3A1Y A;  2JVH A;  4CSW A;  2OJE D;  5DTD A;  1MMA A;  5B1B H;  3PO2 J;  1B9N A;  2EV6 A;  4I01 A;  1ZLJ A;  3HSF A;  4IOC F;  4BDY A;  1ETW A;  5FD5 A;  5TIS C;  4HV5 A;  1TT5 B;  2R7X A;  1HKQ A;  4CYC A;  5LRS A;  2AQF A;  4A3D J;  1I3Q J;  2AXT C;  3GO5 A;  3R6S A;  1QGP A;  4FET A;  2EFQ A;  1WRJ A;  2HQ5 A;  2J5P A;  2LOO A;  2O8X A;  3BG3 A;  1S6L A;  5JR3 A;  2A5Y B;  2O03 A;  3VYR B;  3WOD F;  1KU3 A;  1J2X A;  3A03 A;  3FXU A;  2L4A A;  2ZB9 A;  3E6D A;  5IYC J;  1BJA A;  4ZTF A;  2LKP A;  4GYI A;  3P9I A;  3HJE A;  3RPQ A;  2HTJ A;  1QVU A;  2NXN B;  3B73 A;  3OYJ A;  3VB2 A;  2DCE A;  3HOZ J;  2HPM A;  1APL C;  2KIM A;  5M3M J;  1IN5 A;  2A61 A;  2PJP A;  3M4O J;  2G7U A;  1B9M A;  4N9H A;  3SFI A;  2XAS A;  3WGH A;  5F0C A;  3CP2 A;  1KYZ A;  1LDK B;  5FJ8 J;  4XRM A;  5JHU A;  4XRF A;  3PUF A;  1LB2 A;  3LFU A;  2KP6 A;  2LMD A;  3K4B A;  2ZME A;  4EM1 A;  1OR7 C;  4XLN F;  3K4L A;  2JWT A;  4LG0 B;  1FOK A;  2ELJ A;  3IRQ A;  4UUS B;  1MMG A;  4YIR X;  3ABM H;  4FCY A;  4CCO A;  3LSM A;  1I39 A;  3FXL A;  1P92 A;  3BG6 A;  5TJJ A;  1R23 A;  3OSG A;  3P5J A;  2CW7 A;  3L2W A;  1E3P A;  1W7P D;  1OJL A;  3B6A A;  3KYD B;  2L9R A;  3H0G J;  1BIB A;  3CCU I;  4OIR F;  2V1X A;  4BUP A;  5EEH A;  4A0Y A;  2R7W A;  3HKZ A;  1NK2 P;  2DMT A;  3G2B A;  3BPX A;  4PDK A;  3SDB A;  3U1K A;  3ISP A;  5ICF A;  4A3B J;  3KZZ A;  1RI7 A;  2HU9 A;  3ZCO A;  2JVG A;  1XG1 A;  2M45 A;  2NRA C;  3FMQ A;  3L2Q A;  4BQN A;  1DPU A;  5CQE A;  5L3G A;  4DYQ A;  2W4S A;  5BQT A;  3ZOB A;  1SFU A;  3BLY A;  2V1N A;  2ZXH A;  3RKQ A;  4E7K A;  4UUV A;  1OCZ H;  1Q1V A;  1YJ9 I;  1PUF A;  2IGO A;  3PFI A;  1ZR4 A;  3K1N A;  1LDD A;  5EGO A;  2CFX A;  3IC7 A;  4YFK F;  5KAI C;  3TDU C;  1BC8 C;  1W4M A;  2F48 A;  5H2F C;  3C1D A;  3RYR A;  1H8A C;  4A5N A;  3M3Y J;  3DP7 A;  1HSJ A;  4BS9 A;  2ACJ A;  1VQ7 I;  4BYY A;  3P7N A;  3PJR A;  5HDK A;  2Z2S B;  4A3E J;  2LR8 A;  2JA7 J;  2DPD A;  1FBQ A;  1UFM A;  2FSW A;  4CA0 A;  1JJ6 C;  3ABT A;  2FJ1 A;  1J9I A;  2NS8 A;  4L9N A;  1SD6 A;  5B5E C;  2O6G E;  1JKQ C;  2DA3 A;  2OF7 A;  1KQ0 A;  1XSX A;  1V3F A;  2EZI A;  3BOQ A;  4IJA A;  2FMY A;  2LF7 A;  1NG7 A;  1Z6T A;  1EH7 A;  1XMX A;  4BEH B;  2BY0 A;  5LGU A;  1TW2 A;  3QPS A;  3HOU J;  2OUM A;  3HZJ A;  5EGO B;  3FXQ A;  2F5F A;  1KQ8 A;  2BXZ A;  4G12 A;  1KON A;  2DYR H;  3OOP A;  4M3F A;  1WKM A;  4O6J A;  4BKX A;  5HS8 A;  2R0Q C;  4E7I A;  4L5J A;  1YLF A;  2M7B A;  2KPM A;  3UKG A;  3ZQQ A;  2NVY J;  3PQJ A;  2CV0 A;  2UXN A;  4RGS A;  2VBZ A;  2DO7 A;  1I1G A;  1R4M B;  4S0H B;  3NRV A;  3K69 A;  3I56 I;  2I8D A;  1D5V A;  1PDN C;  3KCC A;  1NHA A;  5E79 C;  3LL7 A;  1R5H A;  2D45 A;  1ZRE A;  4NDL A;  4EMS A;  1D8K A;  3T5X A;  1JKO C;  2DTZ A;  2HQN A;  4P55 A;  5HDN A;  3I9V 2;  3RQI A;  2AQE A;  3HC7 A;  1YX3 A;  4GO1 A;  5HS9 A;  5J4V A;  3GW2 A;  1T08 B;  3ML6 A;  3BR1 A;  3RQ4 A;  2ZSI B;  3T8T A;  1VND A;  3F6V A;  5HLG A;  3FXJ A;  4KFC A;  1WH5 A;  2NOG A;  3UNG C;  3U1D A;  4BJ6 C;  2A69 F;  4I02 A;  1ON1 A;  3S17 J;  3IH3 A;  4UB6 C;  4GGG A;  1OYY A;  4B3X A;  4AVZ A;  3GBG A;  4L0Y B;  2W85 A;  5ILU A;  4AYB N;  2P6T A;  5FKM A;  3OYG A;  1QRY A;  2AXL A;  2W25 A;  4DGW B;  2Z33 A;  3QAH A;  2H6C A;  3FXM A;  1D0X A;  5M5W J;  3TDZ C;  4HX4 A;  1GVD A;  1JXS A;  2R7U A;  4KIF A;  4IXA A;  4DW6 A;  3JRF A;  4HX8 A;  1GUU A;  2P5L C;  1ZGA A;  1T8I A;  5DEQ A;  1BIA A;  4LLN A;  3DU5 A;  1YS7 A;  4X6A J;  2Y0S A;  1LVK A;  2EFP A;  4M72 A;  4UVB A;  5F1R A;  4O5V A;  4RLF A;  1UMQ A;  2NVU B;  4AIJ A;  3GZN B;  1F1Z A;  5C3E J;  2ZKZ A;  3GXO A;  4ETS A;  2ZXW H;  1VZ0 A;  2JA8 J;  2OV7 A;  1YJN I;  1U5T A;  1WQ2 A;  4M6V A;  5H20 A;  3OL3 A;  1TQP A;  2XF6 A;  4ITV A;  5FD6 A;  1MH4 A;  2CUJ A;  1JUP A;  1CF7 B;  2FU4 A;  2RQP A;  5FKK A;  4F7Z A;  3MZH A;  4ANJ A;  3PFY A;  2X0L A;  3PQK A;  1MMS A;  4C2M J;  2MLG A;  4XKV A;  1A04 A;  2H27 A;  2HQA A;  1IUY A;  5L3D A;  5BS6 A;  4JX4 A;  4HNT A;  2GOM A;  4I6Z A;  3HUG B;  5CQG A;  4UHT A;  4O3M A;  3R61 A;  1S9H A;  1BR2 A;  3QU6 A;  2DPU A;  5LGN A;  1PJR A; 
#chains in the Genus database with same CATH homology
 1MNE A;  3A2K A;  3D5L A;  3MD2 A;  2VXZ A;  3ZXS A;  2E5Z A;  3C2H A;  4ZDL A;  1HA8 A;  4BE1 A;  3OYD A;  1WJD A;  5HNH A;  2LH9 A;  4GRI A;  2LC2 A;  2UV1 A;  3DTK A;  2XC7 A;  4CCM A;  1G8X A;  3K4J A;  4E6K G;  4KIT B;  4B44 A;  2MC4 A;  4ZC3 A;  3K4N A;  4PSX A;  4YRV A;  4NC8 A;  4JQF A;  3RPU D;  1EA3 A;  1D0Y A;  3DPL C;  3N05 A;  3ONQ A;  2E1M B;  3VYT B;  3W3C A;  3OIQ A;  2IS4 A;  2VKH A;  2WAD A;  2IXS A;  3M8J A;  2F4I A;  2X85 A;  3QYF A;  1X1B A;  4F55 A;  3FBN B;  3OYL A;  2XSJ C;  3OS2 A;  2M7A A;  3UR3 C;  2CS3 A;  1N77 A;  4XKB A;  1WJE A;  4HG2 A;  5KHD A;  4BJT A;  4OAY A;  4CCK A;  2VXD A;  1R6R A;  4HPQ A;  1G59 A;  4IQ4 A;  4PK4 A;  2UWM A;  1V5G A;  4B48 A;  4BU2 A;  2V26 A;  1BR1 A;  4DOZ A;  2IGK A;  3OYH A;  2QKM B;  4XOT A;  4DBQ A;  3K4C A;  3SYT A;  2LG4 A;  2LBF B;  4FAS D;  2W82 A;  3PSF A;  4LIU A;  3MKY B;  1UAA A;  1D0Z A;  2A6T A;  2CV1 A;  3CJQ B;  2X6X A;  2ZXI A;  3VYU B;  3S93 A;  3SEZ A;  4XLF A;  5KNL A;  1BR4 A;  2L2O A;  4XR6 A;  4E7S A;  3OWT A;  3CF2 A;  2IGN A;  1ZEL A;  4P5O A;  4PSW A;  3QOE A;  2R7T A;  2HVQ A;  3A4C A;  1E0E A;  3EPZ A;  3IAS 2;  3EUH C;  4IQJ A;  2WBM A;  4DJA A;  4NNJ A;  4PUS A;  4CUG A;  4XON A;  3DTE A;  4PJN A;  2CV2 A;  4IKF A;  4N4O B;  2X1C A;  3IUO A;  3RCO A;  3VDX A;  5HVQ C;  4PJL A;  3PL8 A;  1N75 A;  1Z7L A;  4OWR B;  3DWL E;  1LFP A;  2E1M C;  1Y6I A;  3OR1 C;  2PJR A;  1MMD A;  1MMN A;  2RQQ A;  3S8P A;  3EUK L;  2V6E A;  5HOO A;  3PNT A;  2DT7 B;  3OMY A;  2GOX B;  1GLN A;  2X1E A;  4IX7 A;  2MFZ A;  3OYK A;  3F9K A;  2CMP A;  3OYB A;  1W36 C;  3QOD A;  1MND A;  3OYM A;  2DJI A;  2R7V A;  3OS1 A;  1NG6 A;  4HNU A;  4CZC A;  3OS0 A;  4CCN A;  3VSK A;  4E7L A;  3K4M A;  2Q2E B;  2HNH A;  2MD0 A;  4XNF A;  1QHG A;  3FBI B;  2R7Q A;  3ZR8 X;  2W00 A;  2A5W A;  2HPI A;  2X51 A;  1TT0 A;  3DPT A;  4XN0 A;  3CES A;  3K4K A;  4QPO A;  2FUG 2;  4B43 A;  4XM3 A;  2HVS A;  1W36 D;  2WB1 A;  4BQQ A;  4G6T B;  1LKX A;  2CFO A;  3KEY A;  2CW8 A;  2BW3 A;  4KJZ A;  3BC8 A;  3D5S C;  3IAM 2;  4XLE A;  5CKT A;  2LRE A;  4E7Z A;  2QKL B;  3AL0 C;  1V5E A;  2KRC A;  3SEQ A;  1J09 A;  2KLO A;  4N4N B;  2KL4 A;  5JHF A;  1WJB A;  2PMZ A;  3QYE A;  4RLQ A;  3OYC A;  2IS2 A;  3FHN A;  1PYV A;  4CCJ A;  1WJA A;  1X1D A;  2WAQ A;  4Y3O A;  2V4J C;  4H4K C;  3H5A A;  2W1O A;  1N78 A;  3K70 D;  1Y56 A;  2VB6 A;  2K9L A;  2VLA A;  3H0D A;  2BVL A;  2L9S A;  4XQF A;  3PUB A;  1Z21 A;  3H35 A;  3CJR B;  4F52 A;  4NUB A;  3L2V A;  1DQU A;  4C2T A;  4XMY A;  4DIQ A;  3TL4 X;  4PJM A;  4F3Q A;  3A1Y A;  2JVH A;  3PNY A;  4LG3 A;  4XOR A;  4CSW A;  4F92 B;  2LBF A;  1MMA A;  1T95 A;  2P0W A;  1Z3X A;  4BDY A;  3OL4 A;  3OYN A;  2R7X A;  3BCB A;  4XL9 A;  2AQF A;  2F5V A;  1X1C A;  2DXI A;  5LFA A;  3AFH A;  2M4K A;  1FMW A;  4FET A;  3DTI A;  3K10 A;  4C9Y A;  4OAZ A;  2LOO A;  2KQR A;  3DKX A;  2VL8 A;  3VYR B;  3S3N A;  2R7R A;  2JSP A;  2KRH A;  2VJ5 A;  2MYS A;  2DT6 A;  4BQO A;  2X1D A;  2Z1D A;  1D1A A;  4ZTF A;  1X4P A;  4QPQ A;  3OYE A;  2KDO A;  3H9Q A;  4EAT A;  3OYJ A;  4Y33 A;  2DCE A;  4HEA 2;  2M3A A;  1SFK A;  2JA2 A;  2VJJ A;  4XLH A;  4AYB A;  2HPM A;  2R7S A;  2ZSH B;  4J00 A;  3C2G A;  4XOP A;  4Y4R A;  4ZYA A;  4IZZ A;  5HLT A;  4BDZ A;  3NWS A;  1MW7 A;  3DKY A;  3CP2 A;  3MKZ A;  1LDK B;  2XF7 A;  3HG9 A;  4PFO A;  3RTR A;  3AKZ A;  3VWB A;  3LFU A;  4YEJ A;  1X4O A;  2KP6 A;  3K4B A;  4C30 A;  4KT6 A;  1JI8 A;  1OR7 C;  3K4L A;  1WJ5 A;  3HPH A;  4II3 A;  5KCM A;  2ELJ A;  2RRE A;  1MMG A;  3DLA A;  4CCO A;  3ZGK A;  2XDV A;  3LSM A;  4ZTJ A;  2LY2 A;  1DGR M;  3OOU A;  2F6C A;  2K9M A;  3BG6 A;  4BXF A;  2CW7 A;  4BL0 B;  3L2W A;  1K6Y A;  2E5N A;  3LSK A;  3HL2 A;  4BUP A;  2R7W A;  2KZV A;  3HKZ A;  3DEE A;  4HST A;  3G2B A;  3SDB A;  3ZCO A;  2HU9 A;  3VSL A;  2WY8 Q;  2JVG A;  2Z16 A;  3RSN A;  3K70 C;  2VAS A;  3W2A A;  3D5R C;  3LSH A;  3L2Q A;  4BQN A;  5CQE A;  3VYS B;  4BJ5 C;  4YEL A;  2W4S A;  5FRM A;  3MKW B;  2R4G A;  3H5N A;  3BLY A;  2V1N A;  3CP8 A;  4B47 A;  2ZXH A;  2VQH A;  2LYC A;  4E7K A;  3HOT A;  5TGT A;  4DBR A;  2IS1 A;  2E60 A;  2IGO A;  3V42 A;  3EUA A;  3OYI A;  4RM3 A;  4U7B A;  3LSG A;  3KX2 A;  2RNG A;  4BS9 A;  2BOL A;  4BE2 A;  4BE0 A;  3PJR A;  3HPG A;  3PNV A;  2Z2S B;  2VJI A;  3OIP A;  4R79 A;  4CA0 A;  3M1C A;  2L5Q A;  1DP3 A;  1YX5 A;  3J7A Y;  2LRD A;  2VQC A;  3SZG A;  3K6G A;  3L2U A;  2L9N A;  2VJ4 A;  4PJJ A;  1WJF A;  2W7N A;  1UG0 A;  3LMM A;  1NG7 A;  2K3P A;  4HSR A;  2HDW A;  4BEH B;  2BW3 B;  4J01 A;  4XKC A;  4BEH A;  3E0J B;  1IRX A;  2BVM A;  2OUM A;  5FRN A;  1KON A;  1Z3Y A;  3DU6 A;  2L7K A;  2Q1Z B;  4HRI A;  4E7I A;  3OR2 C;  1OLT A;  3QYB A;  2M7B A;  2CH0 A;  2KPM A;  3ZQQ A;  2VKD A;  4D1Q A;  2K5C A;  2CV0 A;  2NOJ B;  4RMN A;  3CMM A;  2KMU A;  1BOB A;  4RM2 A;  2I8D A;  3S3O A;  2HVR A;  3CZ6 A;  3TBI A;  4ZJZ A;  1D1B A;  3LL7 A;  4XLC A;  2WY7 Q;  4D9J A;  2VQG A;  3NWT A;  4AU7 A;  3LSI A;  2LY1 A;  4XN3 A;  3I9V 2;  2X6W A;  2AQE A;  3W2V A;  2WAE A;  2KHM A;  1X19 A;  1V5F A;  2JUG A;  1DGW Y;  3E1S A;  4II2 A;  4KIS A;  3HC7 A;  3AL0 B;  3H9G A;  1YX3 A;  3BCA A;  3MMY B;  3RQ4 A;  1P9Q C;  2ZSI B;  4ZDO A;  2VPL A;  4NC7 A;  2MAB A;  3UNG C;  4BJ6 C;  3HOS A;  4P1W A;  5HNF A;  3S3M A;  2WA0 A;  4U87 A;  3L2R A;  4B3X A;  3DQV C;  4AVZ A;  3GBG A;  3I3L A;  4ZDP A;  1UEL B;  3OYG A;  4BGD A;  3W2W A;  3PSI A;  3ZRG A;  1FMV A;  4DGW B;  1X1A A;  4LIV A;  2WAF A;  4CCL A;  4NQW B;  1D0X A;  1ERD A;  5LD2 C;  2R7U A;  3OYF A;  2R7O A;  1WFX A;  2XAU A;  5FRO A;  3S32 A;  1TZL A;  3DU5 A;  4LIT A;  2X6Y A;  4X0G A;  3FDY A;  2Y0S A;  1LVK A;  3DPU A;  3OYA A;  2O5R A;  4MLO A;  1T0F C;  3HXL A;  1SAU A;  4RLF A;  4PFP A;  2PJR B;  2ZFU A;  1D1C A;  2IGM A;  2UUZ A;  3BG7 A;  4XKW A;  2HZD A;  4E7J A;  1VZ0 A;  1YE9 A;  2IS6 A;  2OV7 A;  4BAC A;  4JOM A;  3TMO A;  1QU3 A;  5CPR B;  3OL3 A;  4E7H A;  2XF6 A;  3FKJ A;  4ITV A;  4C2U A;  1AA7 A;  1QHH D;  2CUJ A;  1U0J A;  4XLA A;  2CUZ A;  3H9J A;  3OY9 A;  4E4H A;  2M0M A;  2M4G A;  4ANJ A;  3PFY A;  4CH7 A;  2VQL A;  4XKV A;  2DOA A;  3KYL A;  1WJC A;  2HQA A;  3H5R A;  4HNT A;  2V7F A;  4F93 B;  2GOM A;  2XF5 A;  3HUG B;  1PJR A;  2VIX A;  5CQG A;  1S9H A;  1BR2 A;  3U21 A;  3IP4 B;  2V9K A;  2OC6 A;  4F91 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...