2M4KA

Solution structure of the delta subunit of rna polymerase from bacillus subtilis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the Partially Disordered Full-Length delta Subunit of RNA Polymerase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit delta
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4kA00
4NC8A 2KRCA 2M4KA 4NC7A
chains in the Genus database with same CATH superfamily
3HOVJ 2LKSA 2B63J 2FQ3A 4LMYA 2QA4I 4KIGA 5TRDA 1Z3XA 2CV2A 1PP7U 3DPLC 4GCVA 4YIFA 1MNEA 3W6KB 3K4LA 1Y1VJ 3T1BA 2JJ7A 4WWCA 3E5UA 4CGZA 3CMMA 2L4AA 4XKBA 2ZB9A 4DW6A 3PIOF 2BYVE 3F8BA 4ZC3A 1L3LA 2MLGA 4IHYA 3DPTA 1VQKI 3QODA 4UNOA 4BY7J 4UVAA 1Q1HA 1ETKA 1XD7A 3CC2I 4C3JJ 4BUPA 4M9SA 4KN7X 3WODF 1LVAA 2Y48A 5J1RA 4E7JA 1QRYA 2H09A 3K4CA 3G2BA 2QKMB 1FMVA 4C3HJ 4DZJA 2F5VA 2CSOA 4XNFA 3WU0A 1AU7A 2NOGA 3FBIB 2ZO4A 1KONA 3Q0UA 1S8NA 3ZN0A 4EV0A 2F4OB 1DU0A 3GTQJ 2CQQA 1FX7A 1JUPA 2A3SA 2R93J 4HZFA 3ZQ7A 2RREA 2VKHA 2FMYA 3CJNA 2IGNA 5M5XJ 1EJ9A 2RQPA 2Y0SA 4M9XA 2OCCH 2RNJA 2X48A 2V6EA 5E17F 2M8GX 2NXNB 2H8WA 3C1DA 1XG1A 3LQQA 1BR2A 1I3QJ 3PNTA 1S3JA 3OV8A 2OPTA 2QKLB 2LRDA 3HOTA 2R7UA 1VF9A 3OL4A 4ZYEA 3SFZA 4ZJZA 5K7HA 2IGMA 4A6EA 2FUG2 1X3ZB 2KRHA 3IRRA 3E97A 1ZELA 3G71I 1P2FA 5B66C 1FNNA 1JJ6C 1ZG1A 1T33A 3DEEA 2CH0A 2QF7A 4BH9A 4B47A 2CGPA 3Q0WA 3OY9A 2LKXA 5IOZA 1BI1A 2IW5A 1MSFC 4AM3A 1N78A 3PNVA 3S1NJ 2VQGA 1XTAA 2DLLA 2EIMH 3DV8A 3ZOBA 1TL8A 3IH3A 2VE9A 1BI3A 3RKYA 1B8IB 3F8NA 2R5ZA 3VODA 3K1PA 1Z7UA 1R1VA 4Y33A 5FLVA 4NNJA 5FB2A 4PZJA 2WAQA 1Y39A 3MZYA 4J01A 3FK7A 1OISA 5JLXA 3DCFA 5JR3A 1AA7A 1R22A 1P92A 1T95A 2AXLA 2BW3A 2DT6A 2DT5A 2LNBA 2YR2A 1VQ8I 5F04A 1UMQA 4F52A 3LWFA 1UJ8A 5H6RA 2KRCA 1K61A 2W25A 1S72I 4KA4A 2LMDA 1POGA 4MQVA 4PSXA 2XB5A 1EH8A 3CP8A 4CICA 3IAM2 2E60A 3CC7I 4PCQA 2X1CA 3MQ0A 4CCMA 3P5JA 3ABUA 4N9IA 4I02A 5GADJ 3A01A 2GLOA 3FXJA 2L3DA 5GPAA 1LE8A 3BOQA 1LVKA 1ON1A 4RM2A 3BR5A 4JK1X 4M6XA 5HODA 5M5WJ 4B1RA 1UCRA 2YU3A 2W4SA 3RIRA 3LAPA 3K70C 4KDPA 3HDDA 3ASOH 1VFCA 4RGSA 4RGUA 2DDAA 5M5YJ 2Q1ZB 1STZA 2EFOA 1D1CA 1TWGJ 3ZQLA 3GXOA 3WTZA 2QQAA 1KQ8A 1ZRDA 5HLHA 1TT5B 3IH4A 2JZYA 3ZQFA 2MD5A 3G4SI 4BQAA 1FOKA 2EZLA 1W36C 1ORKA 5KAIC 4FX4A 1S7EA 4NQWA 3HSEA 1S6LA 4MO7A 3V8KA 4FT8A 4FTHA 1TNTA 4BQNA 3GLLA 4YFNF 2QEXI 2WB1N 1L0OC 3H9JA 4FASD 3F6VA 4M74A 2FEZA 2DI3A 2DJIA 3TO6A 1DUXC 2LVSA 4KISA 1MMSA 4PJNA 1JGGA 3OS0A 2N8GA 3CJTB 1A31A 1WSUA 1F36A 2L9NA 3SZTA 5LD2C 3ECHA 3HUGB 5DUIA 3OS2A 3S1RJ 1HKQA 1NK2P 4XRSG 2P5KA 2AS5F 3TDZC 2BW3B 2ZCWA 3MEXA 1U8BA 3EUAA 4YRVA 3BC8A 1UFMA 4NC8A 3RZOJ 4LIUA 4C3IJ 3F21A 1RIOH 1IXCA 4CYCB 3WGIA 3RYPA 4EM1A 2BY3A 2A6TA 4Q5SF 2XSDC 2LH9A 3CJQB 2QYOA 3H35A 4M6YA 1WH7A 1B8IA 1C0WA 2HZDA 4GFBA 4A3CJ 3JREA 4MNUA 2DOFA 2V1UA 5IYCJ 4AWXB 1OYYA 2E5ZA 4U7DA 3SZPA 1V5FA 2FBHA 3PSFA 2BBYA 4U88A 3DLLF 4IO9F 2ELJA 4UXNA 5EDNA 1Z05A 1A5JA 1KU9A 4PJMA 4KUMA 3FM5A 3JW4A 3S15J 2LOOA 4V19K 4ON0A 3I54A 1TWAJ 1X1PA 3OIOA 5FD5A 4EGYA 3Q5FA 1SFXA 1OKRA 4L0ZB 2OA4A 1MJBA 3ASNH 2EILH 2KT0A 3G1MA 4LK1F 3GZNB 3H0DA 1PDNC 4EJVA 2QSFX 1U9NA 2FJ1A 3JRGA 3FXRA 1T98A 4XOTA 2VQHA 3LFKA 3MAJA 3LL7A 3TKYA 3MKWB 2ID3A 3G6EI 3CCEI 1S9HA 1SMYF 1BR4A 3H3ZA 1DP7P 2LLKA 3GTPJ 1R36A 4CDGA 2YX7A 3D0SA 1AOYA 3BPXA 1AWCA 4RAYA 1WCMJ 5L3GA 2DFFA 1RUNA 1WJFA 3FK6A 2Q2EB 3EUKL 4KIFA 2Q8KA 4CHUA 2LY9A 2HVSA 1A6QA 3J7AY 1YI2I 2DA1A 4BEHB 3QYEA 2PMHA 2HPIA 2WAEA 3D5LA 3FXMA 1KU3A 1OR7A 4LGWA 2XAFA 2A68F 2LDUA 2W00A 3SDGA 3BR3A 1EH7A 5BOXA 1D5VA 3GW2A 2XIGA 5C44J 3K69A 2QBYB 2EBIA 2L9SA 2VJ4A 3QRFF 1R1TA 3VFZA 2OZ6A 2GM4A 2LBFA 1FSHA 1P4WA 2HQRA 3I55I 1SD6A 2E2IJ 2P7VB 4NUBA 1TWCJ 2M4GA 1DPRA 3M8EA 2HKOA 3EPZA 4HA8A 1ZRCA 1SD7A 3AL0B 4OOIA 2M45A 4X0GA 1V4RA 2Y9ZA 1YHQI 1I1GA 3NQOA 2P0WA 1XGMA 2ESNA 4IF4A 2F6CA 1AKHB 1R5HA 5F64A 2X0LA 3Q9SA 4G94A 1P4AA 3J7AO 5L3BA 2AXTC 2ID6A 1HDDC 2IJLA 1OCPA 2DTRA 3ML6A 1YO5C 3QPHA 4UV9A 2FOWA 2DMQA 1YE9A 3S14J 3J7YJ 2NS8A 4FE7A 3IV5A 1YOVB 3HOYJ 2AQEA 2ZBKA 2H8RA 3LMMA 2DTZA 2XF5A 2L7FP 4IHTA 3WTXC 3NARA 1JE8A 5AIPA 1XS9A 1G59A 3H3UA 4XLFA 2L02A 2M87A 3GF2A 1KU7A 1APLC 1WGXA 5EEHA 4DYRA 1Z7LA 4M3BA 4UVBA 1W0UA 2FA5A 2EJRA 5D4SA 1X4PA 4ZTFA 2Z9OA 4X6AJ 1LEAA 3GCMA 5CQGA 2EIKH 2R5YA 5DUKA 1K79A 2CW7A 2KLOA 1JJ8C 2ZJPF 2HFHA 1UZCA 4XSXF 1ZAOA 1GT0C 3GTOJ 5B5EC 3M9AA 2CMPA 4NQWB 4KFCA 1MD0A 4ZDOA 3BTLA 2KISA 3IP4B 1K4SA 5C4XJ 5LHIA 2V7FA 2W7NA 3K4JA 4GYIA 1DPUA 3VYTB 1Z67A 1S7OA 2K7LA 4MTEA 3W2AA 3NEUA 2CYYA 2CQKA 2DMPA 3LAJA 5GP9A 4JQFA 3CTAA 3B73A 3BR1A 1IN6A 3V7RA 5LEKA 4B09A 2JA8J 1VQMI 1MKMA 2JRTA 1ETQA 4I01A 2IA0A 1WPKA 2Z5UA 1X4OA 1LE8B 3FXUA 4M71A 1Z0XA 1IAWA 2KIMA 2KMUA 1XSDA 4HNUA 1YIJI 2IBDA 2FOKA 3A01B 4XOPA 3CCLI 1B72B 2JUCA 3KCCA 3R0AA 3ZMVA 2BV6A 4Y4RA 2V1NA 1F5TA 5IT9Z 2G7HA 2BEOA 2D2WA 1FOWA 2KL4A 2VN2A 2ECBA 4A3EJ 3HGGA 1CF7A 2Y30A 2DPUA 5DEQA 1MNDA 2GXBA 2P4WA 2VC0A 3M7GA 1FBSA 3NWSA 2XUBA 1W5CC 4RB3C 1YW8A 1G6NA 2CFXA 1UG2A 2MH2A 4D9JA 2E5NA 2K9MA 3OSGA 1R23A 2XGCA 1ZK8A 3EYIA 3JRFA 2XPWA 4I76A 2NRAC 3HOSA 2P6SA 1K6OA 1F43A 2OZUA 3PQJA 4QWQA 4ESBA 1YYVA 2VPRA 1QGPA 4AYBA 3HSRA 3JRBA 3K4MA 2VIXA 2R5ZB 2PJRB 4IPAA 5CVJA 5J1UA 2PG4A 3CC4I 3RDIA 3AG1H 2HKXA 3AG3H 3K9TA 1R5ID 5TISC 5ED4A 3T8RA 5E8GA 2EFWA 4GDFA 4HRIA 2L01A 1JI8A 1FLIA 4HNVA 4OWRB 2V26A 4U0WA 1T08B 2VT2A 3VSLA 5FRNA 2PMUA 2VL8A 5EEAA 1XN7A 2OU2A 5B3SH 1VQPI 1FYKA 4IHSA 2CRGA 4YFXF 3S93A 4A2UA 2VKEA 1XMKA 5KK1A 3L2UA 2ZSHB 5FKLA 4XKWA 1X1CA 1W7PD 2HPMA 3KE2A 5E79C 5HDKA 3K7AJ 1GV2A 3BR6A 4BBSJ 3QWLA 4M72A 1MBJA 4RB1A 2GXGA 3PNYA 4BQQA 4GRIA 3ZPLA 3FHZA 4B43A 1SFOJ 3K4BA 3E6BA 3A0HC 4A0YA 3I3LA 3AG2H 2QUFA 2M1BA 5BQTA 4XK4A 4I6ZA 3DTEA 3KIOA 1E0EA 1WKMA 3GTJJ 5HLTA 3I59B 4UVCA 1O4XA 4DJAA 5ILUA 2R4GA 3L1PA 3UNGC 1X2NA 2E35A 4XLNF 3V8JA 2HR3A 5L3EA 3DLAA 1LFPA 3ISPA 4NB5A 2ZMEA 4QPOA 4XSZF 3HSFA 4LG0A 1IRFA 3AAFA 2EPFA 4Q47A 1WH5A 4A3LJ 4XQFA 3CDLA 2DOAA 3WG9A 2E2HJ 3ZP5A 4KJZA 3F8CA 4H4KC 1D8KA 3ZGKA 2ZXHA 2K27A 3GZ6A 2RC4A 3BLYA 1VZ0A 2JVGA 3GFJA 4A5NA 4HX4A 3GLXA 4G9YA 4QTRA 1RRJA 1XCBA 3S2WA 4U87A 5LEJA 3CF2A 2R5YB 3L2RA 4BE2A 2JQ7A 3HOWJ 2MABA 2VJIA 3CCVI 2DODA 1EKEA 2NVTJ 1MBFA 4IX7A 2VJJA 1YW7A 1PUFB 4KT5C 1Y1WJ 1BC8C 4B3XA 1P4XA 2FX0A 4N4OB 4G7OF 2UV1A 4PJ0C 4AIDA 5D4RA 1X1AA 1Y8QB 3WTTC 2DA7A 2VODA 4JYKA 1GVDA 1ZYRF 4RGRA 3DWLE 4CXFA 2FNPA 3WGHA 4HLYA 4IHXA 1SFEA 4XLHA 3O2PE 4FISA 2M0CA 4M3DA 4M6VA 4BAYA 4OIQF 5F0HA 2NOJB 2GA2A 3B02A 1FP1D 1IN5A 5J40A 4R79A 1BC7C 2XROA 4IQJA 1I1SA 2DFHA 3HPHA 4Y3OA 2VONA 3FXOA 2MFZA 3GFIA 2M30A 2BVMA 1LPQA 1YIOA 4PUSA 4L5EA 4UY8I 2DYRH 2COBA 3DP7A 4KNYA 3EYYA 4BXXJ 3FBNB 1SFUA 2VI6A 3I4NJ 3REOA 4D5FA 2ME6A 4QLCU 3RSNA 3JRCA 2VKVA 4EATA 3BQYA 1XDUA 4RGXA 1H9GA 4ZYGA 2VXDA 3KLOA 2F4IA 2F5DA 1BI2A 5E3LA 1GXPA 1LFBA 4B4CA 2ZMEB 5L3DA 3ZMTA 5JLWA 2KDOA 3IH2A 4BQOA 2MH9A 3KEYA 1I27A 2HQNA 2G7UA 1XC5A 2VQCA 4W1UA 1A6IA 3CDIA 2J5PA 3PL8A 4MQ9F 2UXXA 1A04A 2XAHA 1KQ0A 3C2GA 1ACIA 1BL0A 1HC8A 1D3YA 2W48A 3WTVC 3LA3A 2M3AA 2DBBA 2FU4A 4OAYA 5JHUA 3I5UA 2OF7A 3PFYA 2EK5A 1TBXA 1NG6A 3OYJA 1MMAA 2H94A 1DDNA 4LD5A 2Q0OA 4Q48A 1BJZA 3I59A 2VBYA 1K83J 1OCOH 3BPVA 2PLYA 5LGUA 1HW2A 1WHUA 3CP2A 4P55A 2MG4A 3JR9A 4L9TA 2MYSA 2XASA 3SEQA 2LG4A 1BA5A 1FOXA 1OFCX 2DK8A 2ZFWA 1MZBA 4A3IJ 2BOLA 4XKCA 4S04A 4ENJA 2GXAA 1SVOA 5ILVA 1IV8A 4BKXA 1RI7A 3CMEI 2FQ4A 4GO1A 2KP6A 4HF2A 3OYIA 1W4MA 3ZMZA 1D1BA 3IRQA 4KMUX 2HVRA 2Y9YA 3BR0A 3OYAA 1FP2A 2ETHA 3VDXA 1KYZA 4FE4A 5FKMA 3BCBA 1OYIA 4RDUA 1ZLKA 5K7FA 3LSJA 3JAMZ 3BZCA 2ISYA 1EA3A 5F0FA 4GXOA 2JSPA 3W6JB 2NVUB 4EJOA 4PFPA 4IOAF 3GX4X 1IRXA 2CUFA 4UB6C 3W2VA 1ITYA 5D5XB 5J4YA 4OMZA 4A0ZA 1HKSA 5IYBJ 1WJDA 2DA5A 1WJEA 3CESA 2XDVA 3OYEA 3DU5A 3R0JA 1R4NB 2DCEA 2OAZA 3P9CA 3RQIA 4BHBA 5K5QA 4XRMA 3H9GA 5BS6A 1FTTA 2IVMA 2QLZA 3LA2A 2IS4A 3OL3A 3RKQA 3LNQA 4I09A 3E7LA 2JMWA 3J81K 4A3KJ 4ZDLA 2EZKA 5TJJA 3W2WA 2DA2A 3CDHA 2R92J 5E8IA 2DXIA 2EIJH 2PI0A 3VEPA 2W24A 2XAGA 1ODDA 3FXKA 4MLOA 2VBXA 2VASA 3ZR8X 1OCRH 2BE5F 5JI6A 2D45A 2OQGA 1X58A 2DFEA 3HC7A 2M2EA 2RGVA 1XSVA 2I10A 4PGGA 3D1NI 1QU3A 2Z3YA 2YSRA 1W7PB 1S29A 2LBFB 1BOAA 3PO3J 2XGEA 4IVNA 4DBQA 2EV0A 1BM9A 3ZQQA 2STWA 2DA6A 1A35A 1UHMA 1GDTA 1OCZH 5B1AH 2PJPA 2G9WA 5IY5H 3SQNA 2HDDA 3RYRA 2ISZA 4A12A 2F5EA 1E3PA 1X2MA 3WHBA 3MZHA 1YLFA 1RNLA 3LFUA 2HTSA 3LSRA 3JAMK 4LOCA 2QQ9A 2X6WA 3TMOA 3K2AA 2LTPA 3R61A 5DCMB 2ZXIA 3I53A 2QQ8A 4M9ZA 4LJZF 5DM6F 3HG9A 4N0BA 5E18F 3OS1A 3RJPA 3KETA 1T39A 2CJJA 1LDKB 1JKRC 3K2ZA 2F5CA 5J47A 1YJWI 2RDPA 4WCGA 1JKOC 2K9NA 1RC9A 3JCUC 5IP6A 1GLNA 1R71A 1PP8F 2D5VA 1DGRM 2K02A 2XVCA 2DO7A 1Z1DA 4A5MA 4GYGA 2Z33A 1MBKA 1G4DA 2GA1A 2HYJA 2PX9A 2E1MC 4L5IA 1W1WE 2O3FA 4C2MJ 2HXOA 3H5AA 1IXSB 2NVXJ 3PFIA 5LBQA 1H89C 3DXJF 2RKHA 1YTYA 3TGNA 3TO9A 2ZMEC 2F5FA 2PBIA 3DU6A 3K4NA 2MC3A 3L2WA 4KIBA 4C9YA 4U0YA 2P8TA 1B59A 2JT1A 2CO5A 5CVIA 2BZTA 2KRFA 2KZVA 3WU1B 5HVQC 2DA4A 3B6AA 5GTHC 2YPRA 3OIPA 3R4KA 2O9LA 3GUDA 3QPTA 1FYLA 3F6OA 4OINF 2DMTA 4L9NA 5H6QA 4BJTA 5JFRA 1UHSA 5EGOA 5HDNA 3CCYA 3L00A 3A2KA 1MH3A 2XAUA 4B3AA 2GIZA 2DQLA 5DD4A 3F3XA 2PQ8A 4LLNA 1FWZA 3HBLA 3K1MA 3FXQA 2YU9J 1WVRA 2CWEA 1FMWA 4LITA 2UUZA 3CCJI 1ZARA 1ONVA 3HTSB 1YJNI 2IGKA 3DFGA 3PJRA 3DBHB 1X3WB 3QP6A 2L7MP 1HW5A 4WXHA 1UELB 4MEXF 2O03A 5J1YA 1PUFA 3GBGA 4ENKA 3L09A 2A69F 3O6BB 4A69C 5K7ZA 3K10A 4PSWA 3GWZA 4HW0A 3M8FA 1FT9A 2EB7A 2VB6A 2FMLA 2V9VA 2KJCA 3CCQI 3BWGA 2MD0A 1I6HJ 1IF1A 1G3WA 1YJ9I 3CCSI 2YUSA 1ZREA 2W84A 4HNTA 3OYDA 3E6DA 1JKPC 5BNGA 4HV5A 1QPMA 3FKIJ 1GUUA 4LB5A 2X6OA 4Y15A 3JTHA 1UAAA 2L7KA 4RMNA 1SD5A 3V7SA 2L9RA 2NNNA 4E6KG 2HOEA 2XGDA 4ENMA 3PQKA 2KZGA 3SXYA 3COAC 2DFIA 1MSEC 4RB2C 5HS8A 2L0KA 4HQEA 4G12A 2IRFG 3V42A 1T0FA 3PUBA 1D0XA 3F8MA 4HEA2 1BW6A 1MIJA 2XRNA 3HB9A 3RQ4A 3BJ6A 3ZQHA 3ZMUA 1UG0A 2F4MB 1BR1A 5A2QZ 3N4MA 3GO5A 5IOYA 2JPBA 2K5CA 4HV6A 3KLNA 1BOBA 3ZN1A 5HNFA 3VYRB 4UV8A 1HOMA 1WFXA 1PUEE 1R1UA 2MGQA 5HS9A 3C18A 1USTA 2KKOA 3K0LA 3QAHA 4B44A 4BDYA 1VQ5I 2PJRA 5LGNA 3WG7H 1B4AA 3CLOA 1SVMA 3MKYB 3ZRGA 3HTUA 1FTZA 2OC6A 3U2RA 1LUJB 5K5RA 3MN2A 1MJAA 2BXZA 2ZC2A 1RKTA 5B1BH 3HGYA 4N4NB 4CCNA 2ME0A 3EQLF 5D5WB 2O6GE 3MKZA 2X1DA 3KPHA 1SAUA 2VKDA 3QP5A 4E7SA 3RPUA 1SEUA 1I3AA 3S2DJ 2X6XA 5FKKA 1I6XA 3BG7A 2JA7J 1SVLA 1IRGA 1IN7A 3SEZA 1B72A 3VYUB 4F93B 3HOXJ 3GTKJ 4IL6C 3LSTA 3OR2C 4MIMA 4NC6A 5HDGA 5EGOB 4ZH4F 1HW1A 2HNHA 4L9VA 4IHVA 2NYXA 2VPLA 1WZ2A 2A6EF 4F55A 2HEOA 1ETWA 4NDLA 3K6GA 1FOYA 1B1BA 3DBRB 1AHDP 4CO8A 2GOMA 2QWWA 3I58A 2Z16A 3JRHA 3KP6A 3N05A 3FKJA 2X85A 3OYBA 2CUEA 4OU0A 3I56I 2HOSA 2KIUA 2LSOA 1OMIA 5DDGA 2H1KA 1HSJA 3SYTA 2O0YA 4II2A 2E7XA 1T38A 3TO7A 3E6MA 1LNWA 2VJ5A 4IJAA 2M5WA 2IS6A 1GV5A 4ZYDA 4A3GJ 4XN3A 2W85A 3DTIA 1U5TB 3F8FA 3HRUA 2NAZA 4LIVA 3JRIA 3BTJA 2O8KA 3RCOA 4PDKA 1YW9A 1U5TC 2CG4A 2R7RA 4DZPA 1JUMA 1ETYA 2K85A 1ZKGA 2H27A 2DU9A 2PMZA 1TQPA 4IRIA 3L9FA 2ACJA 1B9NA 3TW6A 4A3JJ 2MBFA 3ELKA 1ZG5A 3QU6A 3HM5A 3OYNA 1EF4A 1JHHA 4XONA 1H8AC 2A61A 4G8XA 3KEOA 2JK3A 1XX5A 4DBRA 4A3BJ 1V54H 2EZHA 3IHUA 2LP0A 2Y75A 3CUOA 3V8LA 1RESA 5F1RA 3A02A 1K78A 2M4KA 1XDSA 3HRMA 4AVZA 4HAMA 4LLLA 1U2WA 1WJAA 3HKZA 1LJ9A 5DTDA 1SAXA 1D5YA 3H36A 2ZNZA 4HYEA 1KU2A 4M3GA 1BIBA 1JHFA 3G73A 5D6FA 3S3NA 4MTDA 1NK3P 2QZ8A 3KP4A 4A93J 5CVUA 4XLPF 2A5WA 1U3EM 1S5LC 3FX3A 1IN8A 1EV7A 1SANA 1MBEA 2R7VA 3B6CA 4P96A 3ZMSA 4FX0A 4J00A 1BW5A 2C6YA 2GWRA 2X51A 3I71A 2H6CA 1ZR4A 5L3CA 2VLAA 1I39A 4TV7A 2X9DA 4JX5A 2PN6A 4CUGA 2STTA 4D1QA 2W82A 1HDPA 4MFDA 1HKTA 4DOZA 1YX5A 2E36A 4IOCF 4XBFA 3UR3C 2L9VA 3CLQA 4Z2YA 4NHJA 3A1YA 2R7TA 1N25A 2Z1DA 1JGSA 1CQTA 2RAEA 4XN0A 5IYDJ 2VOOA 1JTYA 2KHMA 4XRFA 3DBLB 4P9FA 9ANTA 1V5EA 3V4GA 3X2QH 1BJAA 4A6DA 1GHCA 3LSGA 5F1JA 4RM3A 4ZZLA 4CYDA 2CFOA 5D5UB 2PEXA 4RA2A 1RUOA 2EH3A 1B9MA 1KGSA 3FWEA 2EZIA 4ESFA 3J80Z 2IA1A 4EGZA 2HZTA 4BXUA 4X1EA 1VQNI 3IKTA 1V3FA 3GFLA 2LF8A 2WBMA 3H9QA 3K4KA 3MMYB 2XRLA 2O8XA 1MJ9A 1H9TA 2P6TA 4AYBN 3IWZA 1ZGAA 4KICA 5E20A 3LSIA 1OLTA 2VBZA 1FEXA 2XHKA 2MW8A 4S0HB 3W3CA 2HDWA 3I4PA 4XLCA 4E7KA 1MDMB 3JSOA 3BG9A 5IP7J 3ABTA 4Y17A 5CYVA 1LDDA 1TNSA 2EFPA 3T0YA 3DPUA 5ICEA 1OYWA 4D7MA 2WV0A 4E70A 2QSGX 2W1OA 1ZRFA 3E0JB 2K86A 3HL2A 3LSHA 5FFXA 2ZJ2A 4CZZA 3HPGA 2ZJRF 4U0VA 3M3YJ 2RV8A 2GIVA 2OUMA 4I0AA 2ZFUA 2D1VA 2BGCA 4IXAA 5D8LB 1Z77A 2WAFA 2BHZA 1T6SA 3C2HA 5LRSA 2V9PA 4CCOA 2E1CA 1G2HA 2HTJA 3V7CA 4RBOA 3G1OA 2JN6A 3ZQGA 4A3FJ 4ZTJA 3OYKA 3ZMDA 5EZGA 2V4JC 4IHWA 1F4KA 2UWMA 4I98B 3QOEA 2Y0SN 4HDUA 3SFIA 4IZZA 5HLGA 5K1YA 2F48A 5H20A 3BG3A 4O6JA 4N9HA 3U9GA 2HGCA 1MMNA 2KDZA 1SFKA 3NAUA 5EJCA 3FM3A 2V6CA 2HQ5A 3CUQB 2R7ZJ 3TW7A 4YFKF 4E7LA 1F9NA 5HLIA 5IT3A 3KP5A 3DKYA 4RAGA 3F72A 1KZHA 2W57A 1U9OA 2E71A 2EWNA 4ZYAA 2M34A 2ZKZA 2AO9A 2LF7A 1Q1VA 2CW8A 2LY2A 2VE8A 2KQRA 3ECOA 2KFDA 2K9SA 1HF0A 1Y0NA 4II3A 4F3QA 4KT6A 2XAJA 1R4MB 2JSCA 2VUMJ 1X1DA 4ITVA 1E17A 4I0BA 4G6TB 4HQMA 4DYCA 3ABKH 4W97A 2XF6A 3ULQB 3OYHA 2K40A 2G0EA 3PM1A 1O3RA 1WI3A 2VBWA 2DAOA 2XPVA 3H1CA 3E5QA 4BACA 2UZKA 2EV5A 3FHNA 3FDYA 3RZDJ 1OPCA 1P7IA 2R7QA 4Q4ZF 5DYMA 4XORA 2QENA 1YFHA 2XGXA 4Y7NJ 3M4OJ 3BQZA 1MDMA 1GVJA 5FKNA 5M3MJ 4EJUA 4BHPA 4PJJA 4LK0F 4FCYA 3CCUI 4HX7A 1J7KA 1WRJA 5LRRA 3CF5F 4JP0A 3O8HA 2JUGA 1FPQA 3M07A 4WK8F 5FROA 4UB8C 4Y13A 4Z6YA 3BCAA 4XMYA 4BU2A 2ZJQF 4ENNA 2D1HA 1H0MA 2XF7A 3UKGA 1I5ZA 3QU3A 1G3SA 3L2CA 4RB0A 3PSIA 2GZWA 4RLFA 3R6SA 3MZ8A 3A03A 2KIFA 2M7AA 3J7ZI 3LSPA 3H92A 3LOCA 2DW4A 2COMA 4BNCA 4J19A 1PYVA 3CO6C 1IJWC 3H0GJ 2RNGA 3MD2A 5F08A 4QIWN 1OCTC 4E7HA 1J09A 2BVLA 4L9JA 4AC0A 3EUHC 5LFAA 4AIKA 5ERIA 4EVIA 3ROUA 1KA8A 1IDYA 4MFEA 1E2XA 3S1QJ 5F27A 2DMUA 1J2XA 3ONQA 3OYLA 3TL4X 2OJED 2FF4A 4O5VA 3KX2A 1SMTA 4HPQA 3A0BC 1NHAA 4AU7A 4DNCA 5FO5A 3RKWA 5HNHA 4M3FA 2WAQN 2Z99A 4KYWA 3FMSA 3IAS2 4L0YB 1IV6A 3DQVC 1HXDA 3VPRA 2GBYA 2NVYJ 2DDBA 2A07F 1JT6A 1R00A 5EEGA 4EM0B 2R7OA 2R7FA 4R1HA 1IO2A 2MSYA 2DQRA 3K70D 2I8DA 3CD6I 2Y0MA 1QVUA 5BPIA 2QGUA 1J0RA 1LB2A 3MFKA 1VI0A 2V9KA 2O7OA 4BL0B 2B9SA 3IL2A 1OJLA 3DTKA 1K78B 3BROA 1MMGA 3QPSA 1VQ6I 5J4VA 2X4HA 1T0FC 4LG0B 5CKTA 3S16J 3H5NA 1V5GA 4ZZDA 1OCCH 1DP3A 2ZXJA 2K4JA 3GFMA 3OYMA 1D1AA 3E3VA 1TQMA 1BI0A 1M1EB 2EFNA 3VB2A 3CUQC 3HOZJ 4D5CA 3ABMH 1QVTA 1U5TA 1BIAA 4L5JA 3TOBA 2FSWA 2O5RA 2L54A 2OQRA 4ZYHA 3H3VK 4BY1J 1MBHA 3OR1C 1D8JA 5E1ZB 2IA2A 1F1ZA 2H1LA 1YX3A 2FE3A 2CQ7A 1ZGWA 3SDBA 4YELA 1O3TA 3QQAA 2DN0A 5ICFA 4M3EA 1XPXA 3WGGA 1XMAA 1WJ5A 3WE2A 1XMXA 3L7WA 3S8PA 2XAQA 2ICWG 2AHQA 2E1MB 2IEKA 3AKZA 1TTYA 5FRMA 1P9QC 1LQ1A 3E5XA 3VWBA 2R7XA 1HLVA 3OOPA 1HBXG 2EINH 1G3TA 1MNMC 1ZGJA 2E7WA 5EG0B 4A3DJ 2TRTA 2QSHX 3VOEA 1HCRA 1ZLJA 2FD5A 5EYRA 1IG7A 2VOPA 1JUSA 2YX4A 3TEDA 4DIQA 1CGPA 2CQNA 5CQEA 4MHGA 5JHFA 5BPDA 4ZDPA 3LSKA 1TW2A 4IQ4A 2XKOA 4PGHA 5DV5A 4C2UA 4E4HA 1Y8RB 1FZPB 2DOEA 1D0ZA 2H6BA 5E3MA 4S05A 2K3FA 5J8CA 3OYGA 3QYFA 1UHWA 4AIJA 1PVEA 3U1KA 2E1OA 1R49A 4O3MA 3RKXA 3OYFA 4BEHA 1QPIA 1O3QA 3ZQCA 3HOUJ 2XB0X 3D5RC 3G3ZA 4F92B 1Z21A 3WTWC 4XLAA 2BY0A 2QQBA 4D0PA 1R5GA 3AFHA 1IC8A 2J5OA 2DYSH 1VTNC 4RAZA 4XLEA 5J6XA 4BXFA 3ERMA 2OBPA 5KVRA 3GYHX 4AD9A 2XC7A 2LREA 1HQCA 1GXQA 5FKOA 4AIHA 2YS9A 2TCTA 1QBJA 1WWXA 1QQIA 2IGOA 3P7NA 2M7BA 3GTLJ 3EETA 4XKVA 1JTXA 1G3YA 3KP7A 1H88C 1USSA 2VQLA 1YITI 1EH6A 1KQ9A 1K6YA 3I0TA 3BTIA 4CH7A 2R7DA 3T5XA 1NH3A 1LEBA 1VQ9I 4XM3A 1FJLA 4XRSA 2JA5J 2JRMA 2L5QA 1XGOA 3CUQA 4BBRJ 5D5VB 1K4TA 2QVOA 4PJLA 5D6EA 4NBQA 4WXDA 1Z3YA 1FY7A 4B48A 2Y31A 3BDDA 2GAUA 1VQ7I 3S32A 3FIWA 3CCMI 5FLXK 5HS7A 3OWTA 5JVGF 2VT3A 1X19A 2CV1A 5GAEJ 3U1DA 2WY7Q 2K3PA 1E3HA 1O3SA 1T8IA 4E7ZA 1W5SA 2HOAA 3ZCOA 1U8RA 1P7JA 2V1DA 2R3SA 2JTVA 2EQRA 4F91B 3U21A 3WTYC 2DT7B 2IT0A 1FBUA 5BMZA 3FF5A 1O7FA 3TDUC 1R6RA 3S2HJ 3IWFA 5DM7F 4MEYF 2R0QC 1SC7A 2O61A 3BP8A 4ASNA 2VC1A 4LLGF 4M73A 4A0XA 4FETA 5GTIC 3IKVA 1REPC 2HYFA 5KCMA 3CZ6A 2P7CB 5H2FC 3M1EA 4P5OA 1YRNB 1Y6IA 3Q3SA 5ICCA 3AG4H 2WTEA 4G7ZF 3RPQA 3JTGA 3GVAA 5C3EJ 1RR8C 3ESWB 3HRTA 4DYQA 1ZQ3P 2E1NA 4DQ2A 1VQLI 3CQZJ 3LQRA 3CCRI 4YIRX 3MKLA 4EEFG 2HDCA 2ZNYA 1FC3A 1P6RA 2WB1A 4CYCA 2ESHA 2ZXWH 1IZ1A 4F7ZA 1RZ4A 3HIFA 3OOUA 4H0EA 2E2JJ 3NWTA 3DF8A 1VQ4I 2FNAA 3I9V2 5DCFA 4ETSA 4A3MJ 3BJOA 4D7NA 2P81A 3HUGA 3P9IA 2DA3A 4EJWA 2CU7A 1J75A 1BBYA 4P9UA 2WV1A 3HEFA 4LG3A 1TC3C 2GQQA 3FMQA 3TQNA 1NG7A 4XIDA 1TP4A 1FYMA 1XGSA 2L4MA 2XKPA 5CPRB 2Q2EA 2P5LC 1W0TA 2GOXB 1LFUP 5DCMA 1HSTA 1PJRA 4P1WA 4GGGA 5E3OA 4BHCA 2Z2SB 1XCVA 3M8JA 4CCKA 1V55H 2EV6A 1ZH5A 1XGNA 1Y0UA 3CMAI 4HF0A 2M9HA 3S1MJ 3G1LA 4BE0A 4L18B 2JVHA 3PO2J 1ERDA 2UXNA 3E6CC 3EDPA 2JWTA 5DS9A 1T56A 3KYLA 2DPDA 4FQGA 1ON2A 2CS3A 4OIPF 5AIQA 4G6QA 3D5SC 2F2EA 4G7HF 4JBAA 4BJ6C 4YG2F 2NNYA 2E19A 3PUFA 1W7PA 2HQAA 4LB6B 2AQFA 3BG6A 1U0JA 2FBKA 1YS7A 4QPQA 1R9TJ 3QOPA 4V2FA 4C2TA 3QYBA 3F22A 2R7WA 1VNDA 4CA0A 3C2BA 4AUXA 1IGNA 1MGTA 3F9KA 2IS1A 2CUJA 1O7LA 1OQYA 2BY1A 3I64A 4CCJA 3OYCA 3CMYA 4CCLA 4V2GA 4BS9A 1XB4A 1U78A 2CUZA 2HXIA 3BG5A 2NS7A 1FIAA 4U7BA 5CVVA 3GTMJ 1FBQA 1ZG3A 2HS5A 4C30A 5LLQA 5LHGA 2K9LA 5F0CA 1ZTRA 1T2KA 2WADA 2QCOA 3KFWX 2KIQA 3RI4A 5GPCA 3T8TA 2TDXA 4HSRA 3NRVA 3S3MA 4HLXA 1E3OC 2WA0A 4XL9A 2PMZN 1N75A 2LK2A 4EJTA 1O57A 2M8EA 1J9IA 2ELHA 2ELKA 2RQQA 3O8GA 5E1XA 3WTSC 4IRGA 5ILSA 4JX4A 3WHCA 4CSWA 3J80K 2LKPA 2B0LA 3BR2A 3ZXSA 4I99C 2EFQA 3I4MJ 1LDJA 3OIQA 2MA3A 2DK5A 4KN4X 5CLSA 3PIPF 1DU6A 2Y2ZA 4HX8A 1J5YA 3CO7C 1QNTA 2A5YB 2PFBA 2XSJC 3GEZA 1FSEA 1RETA 3IC7A 3L2VA 1IRZA 2LR8A 1IUFA 3HZJA 2CV0A 3BTCA 1TZLA 3Q0VA 4QSHA 1QZYA 2X1EA 3MVPA 1TW3A 4XR6A 2XV4S 1YS6A 4HDVA 1R58A 2KJBA 2IXSA 2LY1A 4UUSA 1K7AA 4IKFA 2MC4A 2CW0F 2JA6J 4YIIA 1W5TA 1ZN2A 4MGRA 5FLXZ 1ETOA 3GTGJ 4WX9A 1D0YA 1XSXA 2Y69H 4PK4A 3F0CA 1N77A 5K5OA 1IXRC 1WQ2A 3JSPA 4HBLA 5EZHA 1ETXA 1ENHA 4OAZA 4EM2A 4HF1A 2HWVA 2HI3A 4WF2A 1WJCA 2RVCA 3KZYA 3OSFA 3HRSA 5A2QK 2A05A 1ULYA 1YG2A 2NS0A 4BGDA 2VXZA 4AVPA 2XPUA 4ABZA 4RLQA 2R7SA 2K9QA 3HKZN 1RR7A 1Z91A 2KPMA 2JA2A 5KNLA 1OR7C 1UB9A 1ETVA 3FMRA 2BHYA 1YQAA 5GAHJ 3HHHA 2HOTA 3TBIA 3KZZA 1SD4A 1MH4A 3HJEA 1DGWY 4B8XA 3TOAA 5F6FA 5M3FJ 2E34A 3JRAA 3O3KA 3GMEA 3BZKA 2ADUA 3F23A 1IW7F 3M1CA 2P5VA 4HSTA 4WXCA 1VQOI 2NVQJ 1QZZA 3BZ6A 2M0MA 3ZQIA 1JXSA 3K1NA 3MCZA 2EA2A 4NC7A 1TT0A 3CJRB 4R8HA 1X3UA 3L2QA 3S17J 2DJNA 5CJ9A 4BDZA 1IN4A 3IUOA 3KYDB 3VYSB 2LC2A 5E1WA 5LHHA 2WWYA 1ZR2A 4EQQA 4IEJA 1R7JA 4UUVA 3KEQA 4ESJA 4CZCA 4UHTA 2WY8Q 1IDZA 1Y56A 5JVTA 2A6HF 2IS2A 1WJBA 3DKWA 3W6VA 5LGTA 2FBIA 4BYYA 4OMYA 1RKWA 5J3LA 5TGTA 3FXLA 3TP3A 5FD6A 2MLKA 1JKQC 3WU2C 3FZVA 5EF6A 5AONA 1CF7B 4JX6A 3BJAA 4LFUA 1U6GA 1W36D 2V79A 3HXLA 2DMNA 2LFBA 5CVRA 5IPAA 2EA4A 2ZSIB 1MW7A 5FLMJ 3MWMA 4I2OA 3DEUA 2JPCA 2OV7A 3N97A 1DQUA 3KP3A 1TLHB 3FISA 5D8KB 4OIOF 5ICGA 3KYCB 1Z6RA 4JOMA 4BE1A 5KAFC 3VSKA 3J81Z 4K2EA 1RPWA 4Y52J 1TQIA 3QPLA 3HYIA 4BJ5C 1BN5A 2QBYA 2L2OA 2I5UA 2IPQX 1MBGA 4UUSB 4ANJA 3C7JA 5KHDA 1X1BA 2L7ZA 3KP2A 5FFZA 4XICA 1A36A 5FGMA 1QHHD 1HA8A 6PAXA 4YEJA 2LD5A 2FXAA 4EMSA 5FJ8J 3C3WA 2OTJI 4FHTA 4RS8A 3Q9VA 4E7IA 3LSMA 3WE3A 5IP9J 1I50J 3ABLH 1TWHJ 4OIRF 3H5RA 3JRDA 1WI9A 2V1XA 3SJMA 3SHFA 3ERED 1J59A 1JT0A 2OTLI 3AL0C 3R60A 5GAGJ 2WC2A 3OMYA 5IT9K 1QHGA 3DKXA 3P9KA 4PFOA 4G6DA 2X6YA 2CQXA 2BY2A 3RTRA 5J8FA 5EG0A 1MMDA 3TP0A 3EUHA 4I7HA 4UUTA 2HVQA 5E3NA 2B7EA 4HOBA 1TWFJ 1B6AA 1S7AA 2RN7A 1Z9CA 5L3FA 2FRHA 1YRNA 3DEWA 1ZHFA 5C4JJ 3BT9A 2IP2A 4KITB 3HHGA 2OCEA 3BY6A 3GZ5A 1G8XA 4RAFA 4DGWB 2HYGD 1Z6TA 3RPUD 3KZIC 2HU9A 5DD8A 3S3OA 1AKHA 2BXYA 2QM3A 1QA6A 3SZGA 3A4CA 4HG2A 2ECCA 4IRHA 4KMFA 1QO0D 1QZEA 1KYWA 2LYCA 1IUYA 2IAIA 3LA7A 1LKXA 1NTCA 5HOOA 2K4BA 3E1SA 2OD5A 1FIPA 3WTUC
chains in the Genus database with same CATH topology
3OYGA 3QYFA 2HNHA 3S93A 2VPLA 3L2UA 2ZSHB 4F55A 1Z3XA 4XKWA 3K6GA 1X1CA 3OYFA 4BEHA 3DPLC 2HPMA 2CV2A 1MNEA 2GOMA 2Z16A 3D5RC 3K4LA 4F92B 3N05A 3FKJA 1Z21A 2X85A 3PNYA 4BQQA 4XLAA 4GRIA 3OYBA 3CMMA 4B43A 3AFHA 3K4BA 4XKBA 3SYTA 3I3LA 4ZC3A 4II2A 4XLEA 3DPTA 3QODA 2VJ5A 4BXFA 2IS6A 3DTEA 1E0EA 4XN3A 4BUPA 3DTIA 4E7JA 5HLTA 2XC7A 3K4CA 4LIVA 3G2BA 2LREA 4DJAA 2QKMB 1FMVA 2R4GA 3UNGC 2F5VA 4XNFA 3RCOA 3DLAA 1LFPA 2IGOA 4QPOA 3FBIB 2M7BA 1KONA 4XQFA 2R7RA 2DOAA 4XKVA 2PMZA 2VQLA 1K6YA 4KJZA 4CH7A 4H4KC 3ZGKA 2ZXHA 2RREA 2VKHA 3BLYA 1VZ0A 2JVGA 2IGNA 4XM3A 2Y0SA 3OYNA 4U87A 2L5QA 4XONA 3CF2A 3L2RA 4PJLA 4BE2A 2MABA 2VJIA 2V6EA 1BR2A 1Z3YA 4B48A 3PNTA 3S32A 4DBRA 2QKLB 2LRDA 2VJJA 3HOTA 4IX7A 2R7UA 3OWTA 3OL4A 4ZJZA 2CV1A 1X19A 2WY7Q 2IGMA 2K3PA 4B3XA 2FUG2 2KRHA 4N4OB 4E7ZA 1ZELA 2UV1A 3ZCOA 2M4KA 1X1AA 2CH0A 3DEEA 4AVZA 4F91B 3U21A 1WJAA 2DT7B 3HKZA 4B47A 3DWLE 3OY9A 4XLHA 1R6RA 1N78A 3PNVA 2VQGA 3S3NA 2NOJB 2A5WA 4FETA 5KCMA 4R79A 3CZ6A 2R7VA 4IQJA 4Y33A 4P5OA 4NNJA 4J00A 1Y6IA 3HPHA 4Y3OA 2MFZA 2WAQA 2X51A 4J01A 2BVMA 1AA7A 4PUSA 2VLAA 1T95A 2BW3A 2DT6A 4CUGA 4D1QA 2W82A 4F52A 3FBNB 2KRCA 3RSNA 4EATA 4DOZA 4PSXA 3CP8A 1YX5A 3IAM2 2VXDA 3UR3C 2E60A 2WB1A 2F4IA 2X1CA 3A1YA 4CCMA 2R7TA 2Z1DA 3OOUA 2KDOA 4XN0A 4BQOA 3KEYA 2KHMA 3NWTA 3I9V2 2VQCA 1V5EA 3PL8A 4RM2A 1LVKA 3LSGA 4RM3A 3C2GA 2CFOA 2M3AA 4OAYA 2W4SA 4LG3A 3K70C 1NG7A 3PFYA 3OYJA 1NG6A 2WBMA 3H9QA 3K4KA 5CPRB 1MMAA 3MMYB 2GOXB 2Q1ZB 1D1CA 1PJRA 4P1WA 3LSIA 1OLTA 2Z2SB 3M8JA 4CCKA 3W3CA 3CP2A 2HDWA 4XLCA 4E7KA 1W36C 2MYSA 3SEQA 2LG4A 2BOLA 4XKCA 3DPUA 4BE0A 2JVHA 1ERDA 2KP6A 4BQNA 2W1OA 3E0JB 3OYIA 3KYLA 2CS3A 3H9JA 1D1BA 4FASD 3D5SC 3HL2A 4KISA 2DJIA 2HVRA 4BJ6C 3LSHA 2HQAA 2AQFA 3OYAA 3BG6A 4PJNA 3VDXA 1U0JA 4QPQA 3HPGA 3OS0A 3BCBA 4C2TA 3QYBA 2L9NA 2OUMA 2R7WA 4CA0A 2ZFUA 5LD2C 1EA3A 2JSPA 3HUGB 4PFPA 3OS2A 2WAFA 3F9KA 2IS1A 1IRXA 2CUJA 3W2VA 3C2HA 2BW3B 3EUAA 3OYCA 4CCOA 3BC8A 1WJDA 4NC8A 4CCLA 4LIUA 4BS9A 4CCJA 4YRVA 1WJEA 3CESA 2XDVA 3OYEA 3DU5A 2CUZA 2DCEA 4ZTJA 3OYKA 3H9GA 2A6TA 4U7BA 2V4JC 2LH9A 3CJQB 3OL3A 2IS4A 2UWMA 3H35A 3QOEA 4C30A 4IZZA 2HZDA 2K9LA 2WADA 4ZDLA 3W2WA 1MMNA 1SFKA 4HSRA 2E5ZA 3S3MA 2DXIA 2WA0A 4XL9A 1V5FA 3PSFA 4E7LA 1N75A 2ELJA 4MLOA 4PJMA 2VASA 2RQQA 3ZR8X 3DKYA 2LOOA 4CSWA 3HC7A 3ZXSA 4ZYAA 1QU3A 2LBFB 3OIQA 2LY2A 2CW8A 2KQRA 3H0DA 4DBQA 4II3A 4F3QA 3ZQQA 4KT6A 4XOTA 2VQHA 3LL7A 3MKWB 1X1DA 4ITVA 2XSJC 3L2VA 1S9HA 1BR4A 4G6TB 2CV0A 1TZLA 2XF6A 3OYHA 2X1EA 4XR6A 3LFUA 2IXSA 2LY1A 1WJFA 2Q2EB 3EUKL 4IKFA 2X6WA 2MC4A 3TMOA 4BACA 2HVSA 3J7AY 2ZXIA 3FHNA 4BEHB 3FDYA 1D0YA 4PK4A 1N77A 3QYEA 2R7QA 2HPIA 2WAEA 3D5LA 3HG9A 4XORA 4OAZA 3OS1A 2W00A 1WJCA 1LDKB 4PJJA 4BGDA 2VXZA 2L9SA 2VJ4A 1GLNA 4RLQA 1DGRM 2R7SA 2JUGA 2KPMA 2LBFA 5FROA 2JA2A 2E1MC 5KNLA 1OR7C 3BCAA 4XMYA 4BU2A 3H5AA 4NUBA 2M4GA 2XF7A 3TBIA 3EPZA 3AL0B 1DGWY 4X0GA 3PSIA 3DU6A 4RLFA 3K4NA 3L2WA 2M7AA 2P0WA 4C9YA 3M1CA 2F6CA 4HSTA 1PYVA 2KZVA 2M0MA 5HVQC 2RNGA 3MD2A 3OIPA 4NC7A 4E7HA 1J09A 2BVLA 1TT0A 3EUHC 3CJRB 5LFAA 3L2QA 4BJTA 1YE9A 4BDZA 3IUOA 3VYSB 2LC2A 3ONQA 3OYLA 3A2KA 3TL4X 2XAUA 3KX2A 4HPQA 4CZCA 2AQEA 3LMMA 2XF5A 2WY8Q 4AU7A 1Y56A 5HNHA 1G59A 2IS2A 4XLFA 1WJBA 1FMWA 4LITA 2UUZA 5TGTA 1Z7LA 3IAS2 2IGKA 3DQVC 3PJRA 1UELB 1X4PA 4ZTFA 2R7OA 1W36D 5CQGA 3GBGA 3HXLA 2CW7A 2KLOA 3K70D 2I8DA 3K10A 2ZSIB 4PSWA 1MW7A 2CMPA 4NQWB 2V9KA 2VB6A 4BL0B 3DTKA 2MD0A 2OV7A 4ZDOA 1DQUA 3IP4B 1MMGA 2V7FA 4JOMA 2W7NA 4BE1A 3K4JA 3VSKA 3VYTB 4HNTA 1T0FC 3OYDA 5CKTA 3W2AA 3H5NA 1V5GA 1DP3A 4BJ5C 1UAAA 3OYMA 4JQFA 1D1AA 2L2OA 2L7KA 4RMNA 4ANJA 5KHDA 1X1BA 4E6KG 1QHHD 1HA8A 4YEJA 2O5RA 1X4OA 2KMUA 3V42A 4HNUA 3PUBA 3OR1C 1D0XA 4XOPA 4HEA2 4E7IA 3LSMA 3RQ4A 1YX3A 1UG0A 1BR1A 4Y4RA 3SDBA 2V1NA 3H5RA 4YELA 2K5CA 3AL0C 1WJ5A 1BOBA 2KL4A 5HNFA 3VYRB 3OMYA 3S8PA 1QHGA 1WFXA 3DKXA 1MNDA 3NWSA 4PFOA 4B44A 4BDYA 2PJRA 2E1MB 2X6YA 3AKZA 3RTRA 1MMDA 1P9QC 5FRMA 4D9JA 2HVQA 2E5NA 2K9MA 2R7XA 3VWBA 3MKYB 3ZRGA 3HOSA 2OC6A 4AYBA 3K4MA 2VIXA 2PJRB 4KITB 4N4NB 4CCNA 3MKZA 2X1DA 1G8XA 4DGWB 1SAUA 4DIQA 3RPUD 2VKDA 5CQEA 5JHFA 1JI8A 2HU9A 4HRIA 4E7SA 3S3OA 4ZDPA 2X6XA 3SZGA 3A4CA 3LSKA 4HG2A 3BG7A 4OWRB 4IQ4A 2V26A 3SEZA 4C2UA 4E4HA 3VYUB 2LYCA 4F93B 1D0ZA 3VSLA 5FRNA 1LKXA 2VL8A 5HOOA 3OR2C 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC8 A;  2KRC A;  2M4K A;  4NC7 A; 
#chains in the Genus database with same CATH topology
 3HOV J;  2LKS A;  2B63 J;  2FQ3 A;  4LMY A;  2QA4 I;  4KIG A;  5TRD A;  1Z3X A;  2CV2 A;  1PP7 U;  3DPL C;  4GCV A;  4YIF A;  1MNE A;  3W6K B;  3K4L A;  1Y1V J;  3T1B A;  2JJ7 A;  4WWC A;  3E5U A;  4CGZ A;  3CMM A;  2L4A A;  4XKB A;  2ZB9 A;  4DW6 A;  3PIO F;  2BYV E;  3F8B A;  4ZC3 A;  1L3L A;  2MLG A;  4IHY A;  3DPT A;  1VQK I;  3QOD A;  4UNO A;  4BY7 J;  4UVA A;  1Q1H A;  1ETK A;  1XD7 A;  3CC2 I;  4C3J J;  4BUP A;  4M9S A;  4KN7 X;  3WOD F;  1LVA A;  2Y48 A;  5J1R A;  4E7J A;  1QRY A;  2H09 A;  3K4C A;  3G2B A;  2QKM B;  1FMV A;  4C3H J;  4DZJ A;  2F5V A;  2CSO A;  4XNF A;  3WU0 A;  1AU7 A;  2NOG A;  3FBI B;  2ZO4 A;  1KON A;  3Q0U A;  1S8N A;  3ZN0 A;  4EV0 A;  2F4O B;  1DU0 A;  3GTQ J;  2CQQ A;  1FX7 A;  1JUP A;  2A3S A;  2R93 J;  4HZF A;  3ZQ7 A;  2RRE A;  2VKH A;  2FMY A;  3CJN A;  2IGN A;  5M5X J;  1EJ9 A;  2RQP A;  2Y0S A;  4M9X A;  2OCC H;  2RNJ A;  2X48 A;  2V6E A;  5E17 F;  2M8G X;  2NXN B;  2H8W A;  3C1D A;  1XG1 A;  3LQQ A;  1BR2 A;  1I3Q J;  3PNT A;  1S3J A;  3OV8 A;  2OPT A;  2QKL B;  2LRD A;  3HOT A;  2R7U A;  1VF9 A;  3OL4 A;  4ZYE A;  3SFZ A;  4ZJZ A;  5K7H A;  2IGM A;  4A6E A;  2FUG 2;  1X3Z B;  2KRH A;  3IRR A;  3E97 A;  1ZEL A;  3G71 I;  1P2F A;  5B66 C;  1FNN A;  1JJ6 C;  1ZG1 A;  1T33 A;  3DEE A;  2CH0 A;  2QF7 A;  4BH9 A;  4B47 A;  2CGP A;  3Q0W A;  3OY9 A;  2LKX A;  5IOZ A;  1BI1 A;  2IW5 A;  1MSF C;  4AM3 A;  1N78 A;  3PNV A;  3S1N J;  2VQG A;  1XTA A;  2DLL A;  2EIM H;  3DV8 A;  3ZOB A;  1TL8 A;  3IH3 A;  2VE9 A;  1BI3 A;  3RKY A;  1B8I B;  3F8N A;  2R5Z A;  3VOD A;  3K1P A;  1Z7U A;  1R1V A;  4Y33 A;  5FLV A;  4NNJ A;  5FB2 A;  4PZJ A;  2WAQ A;  1Y39 A;  3MZY A;  4J01 A;  3FK7 A;  1OIS A;  5JLX A;  3DCF A;  5JR3 A;  1AA7 A;  1R22 A;  1P92 A;  1T95 A;  2AXL A;  2BW3 A;  2DT6 A;  2DT5 A;  2LNB A;  2YR2 A;  1VQ8 I;  5F04 A;  1UMQ A;  4F52 A;  3LWF A;  1UJ8 A;  5H6R A;  2KRC A;  1K61 A;  2W25 A;  1S72 I;  4KA4 A;  2LMD A;  1POG A;  4MQV A;  4PSX A;  2XB5 A;  1EH8 A;  3CP8 A;  4CIC A;  3IAM 2;  2E60 A;  3CC7 I;  4PCQ A;  2X1C A;  3MQ0 A;  4CCM A;  3P5J A;  3ABU A;  4N9I A;  4I02 A;  5GAD J;  3A01 A;  2GLO A;  3FXJ A;  2L3D A;  5GPA A;  1LE8 A;  3BOQ A;  1LVK A;  1ON1 A;  4RM2 A;  3BR5 A;  4JK1 X;  4M6X A;  5HOD A;  5M5W J;  4B1R A;  1UCR A;  2YU3 A;  2W4S A;  3RIR A;  3LAP A;  3K70 C;  4KDP A;  3HDD A;  3ASO H;  1VFC A;  4RGS A;  4RGU A;  2DDA A;  5M5Y J;  2Q1Z B;  1STZ A;  2EFO A;  1D1C A;  1TWG J;  3ZQL A;  3GXO A;  3WTZ A;  2QQA A;  1KQ8 A;  1ZRD A;  5HLH A;  1TT5 B;  3IH4 A;  2JZY A;  3ZQF A;  2MD5 A;  3G4S I;  4BQA A;  1FOK A;  2EZL A;  1W36 C;  1ORK A;  5KAI C;  4FX4 A;  1S7E A;  4NQW A;  3HSE A;  1S6L A;  4MO7 A;  3V8K A;  4FT8 A;  4FTH A;  1TNT A;  4BQN A;  3GLL A;  4YFN F;  2QEX I;  2WB1 N;  1L0O C;  3H9J A;  4FAS D;  3F6V A;  4M74 A;  2FEZ A;  2DI3 A;  2DJI A;  3TO6 A;  1DUX C;  2LVS A;  4KIS A;  1MMS A;  4PJN A;  1JGG A;  3OS0 A;  2N8G A;  3CJT B;  1A31 A;  1WSU A;  1F36 A;  2L9N A;  3SZT A;  5LD2 C;  3ECH A;  3HUG B;  5DUI A;  3OS2 A;  3S1R J;  1HKQ A;  1NK2 P;  4XRS G;  2P5K A;  2AS5 F;  3TDZ C;  2BW3 B;  2ZCW A;  3MEX A;  1U8B A;  3EUA A;  4YRV A;  3BC8 A;  1UFM A;  4NC8 A;  3RZO J;  4LIU A;  4C3I J;  3F21 A;  1RIO H;  1IXC A;  4CYC B;  3WGI A;  3RYP A;  4EM1 A;  2BY3 A;  2A6T A;  4Q5S F;  2XSD C;  2LH9 A;  3CJQ B;  2QYO A;  3H35 A;  4M6Y A;  1WH7 A;  1B8I A;  1C0W A;  2HZD A;  4GFB A;  4A3C J;  3JRE A;  4MNU A;  2DOF A;  2V1U A;  5IYC J;  4AWX B;  1OYY A;  2E5Z A;  4U7D A;  3SZP A;  1V5F A;  2FBH A;  3PSF A;  2BBY A;  4U88 A;  3DLL F;  4IO9 F;  2ELJ A;  4UXN A;  5EDN A;  1Z05 A;  1A5J A;  1KU9 A;  4PJM A;  4KUM A;  3FM5 A;  3JW4 A;  3S15 J;  2LOO A;  4V19 K;  4ON0 A;  3I54 A;  1TWA J;  1X1P A;  3OIO A;  5FD5 A;  4EGY A;  3Q5F A;  1SFX A;  1OKR A;  4L0Z B;  2OA4 A;  1MJB A;  3ASN H;  2EIL H;  2KT0 A;  3G1M A;  4LK1 F;  3GZN B;  3H0D A;  1PDN C;  4EJV A;  2QSF X;  1U9N A;  2FJ1 A;  3JRG A;  3FXR A;  1T98 A;  4XOT A;  2VQH A;  3LFK A;  3MAJ A;  3LL7 A;  3TKY A;  3MKW B;  2ID3 A;  3G6E I;  3CCE I;  1S9H A;  1SMY F;  1BR4 A;  3H3Z A;  1DP7 P;  2LLK A;  3GTP J;  1R36 A;  4CDG A;  2YX7 A;  3D0S A;  1AOY A;  3BPX A;  1AWC A;  4RAY A;  1WCM J;  5L3G A;  2DFF A;  1RUN A;  1WJF A;  3FK6 A;  2Q2E B;  3EUK L;  4KIF A;  2Q8K A;  4CHU A;  2LY9 A;  2HVS A;  1A6Q A;  3J7A Y;  1YI2 I;  2DA1 A;  4BEH B;  3QYE A;  2PMH A;  2HPI A;  2WAE A;  3D5L A;  3FXM A;  1KU3 A;  1OR7 A;  4LGW A;  2XAF A;  2A68 F;  2LDU A;  2W00 A;  3SDG A;  3BR3 A;  1EH7 A;  5BOX A;  1D5V A;  3GW2 A;  2XIG A;  5C44 J;  3K69 A;  2QBY B;  2EBI A;  2L9S A;  2VJ4 A;  3QRF F;  1R1T A;  3VFZ A;  2OZ6 A;  2GM4 A;  2LBF A;  1FSH A;  1P4W A;  2HQR A;  3I55 I;  1SD6 A;  2E2I J;  2P7V B;  4NUB A;  1TWC J;  2M4G A;  1DPR A;  3M8E A;  2HKO A;  3EPZ A;  4HA8 A;  1ZRC A;  1SD7 A;  3AL0 B;  4OOI A;  2M45 A;  4X0G A;  1V4R A;  2Y9Z A;  1YHQ I;  1I1G A;  3NQO A;  2P0W A;  1XGM A;  2ESN A;  4IF4 A;  2F6C A;  1AKH B;  1R5H A;  5F64 A;  2X0L A;  3Q9S A;  4G94 A;  1P4A A;  3J7A O;  5L3B A;  2AXT C;  2ID6 A;  1HDD C;  2IJL A;  1OCP A;  2DTR A;  3ML6 A;  1YO5 C;  3QPH A;  4UV9 A;  2FOW A;  2DMQ A;  1YE9 A;  3S14 J;  3J7Y J;  2NS8 A;  4FE7 A;  3IV5 A;  1YOV B;  3HOY J;  2AQE A;  2ZBK A;  2H8R A;  3LMM A;  2DTZ A;  2XF5 A;  2L7F P;  4IHT A;  3WTX C;  3NAR A;  1JE8 A;  5AIP A;  1XS9 A;  1G59 A;  3H3U A;  4XLF A;  2L02 A;  2M87 A;  3GF2 A;  1KU7 A;  1APL C;  1WGX A;  5EEH A;  4DYR A;  1Z7L A;  4M3B A;  4UVB A;  1W0U A;  2FA5 A;  2EJR A;  5D4S A;  1X4P A;  4ZTF A;  2Z9O A;  4X6A J;  1LEA A;  3GCM A;  5CQG A;  2EIK H;  2R5Y A;  5DUK A;  1K79 A;  2CW7 A;  2KLO A;  1JJ8 C;  2ZJP F;  2HFH A;  1UZC A;  4XSX F;  1ZAO A;  1GT0 C;  3GTO J;  5B5E C;  3M9A A;  2CMP A;  4NQW B;  4KFC A;  1MD0 A;  4ZDO A;  3BTL A;  2KIS A;  3IP4 B;  1K4S A;  5C4X J;  5LHI A;  2V7F A;  2W7N A;  3K4J A;  4GYI A;  1DPU A;  3VYT B;  1Z67 A;  1S7O A;  2K7L A;  4MTE A;  3W2A A;  3NEU A;  2CYY A;  2CQK A;  2DMP A;  3LAJ A;  5GP9 A;  4JQF A;  3CTA A;  3B73 A;  3BR1 A;  1IN6 A;  3V7R A;  5LEK A;  4B09 A;  2JA8 J;  1VQM I;  1MKM A;  2JRT A;  1ETQ A;  4I01 A;  2IA0 A;  1WPK A;  2Z5U A;  1X4O A;  1LE8 B;  3FXU A;  4M71 A;  1Z0X A;  1IAW A;  2KIM A;  2KMU A;  1XSD A;  4HNU A;  1YIJ I;  2IBD A;  2FOK A;  3A01 B;  4XOP A;  3CCL I;  1B72 B;  2JUC A;  3KCC A;  3R0A A;  3ZMV A;  2BV6 A;  4Y4R A;  2V1N A;  1F5T A;  5IT9 Z;  2G7H A;  2BEO A;  2D2W A;  1FOW A;  2KL4 A;  2VN2 A;  2ECB A;  4A3E J;  3HGG A;  1CF7 A;  2Y30 A;  2DPU A;  5DEQ A;  1MND A;  2GXB A;  2P4W A;  2VC0 A;  3M7G A;  1FBS A;  3NWS A;  2XUB A;  1W5C C;  4RB3 C;  1YW8 A;  1G6N A;  2CFX A;  1UG2 A;  2MH2 A;  4D9J A;  2E5N A;  2K9M A;  3OSG A;  1R23 A;  2XGC A;  1ZK8 A;  3EYI A;  3JRF A;  2XPW A;  4I76 A;  2NRA C;  3HOS A;  2P6S A;  1K6O A;  1F43 A;  2OZU A;  3PQJ A;  4QWQ A;  4ESB A;  1YYV A;  2VPR A;  1QGP A;  4AYB A;  3HSR A;  3JRB A;  3K4M A;  2VIX A;  2R5Z B;  2PJR B;  4IPA A;  5CVJ A;  5J1U A;  2PG4 A;  3CC4 I;  3RDI A;  3AG1 H;  2HKX A;  3AG3 H;  3K9T A;  1R5I D;  5TIS C;  5ED4 A;  3T8R A;  5E8G A;  2EFW A;  4GDF A;  4HRI A;  2L01 A;  1JI8 A;  1FLI A;  4HNV A;  4OWR B;  2V26 A;  4U0W A;  1T08 B;  2VT2 A;  3VSL A;  5FRN A;  2PMU A;  2VL8 A;  5EEA A;  1XN7 A;  2OU2 A;  5B3S H;  1VQP I;  1FYK A;  4IHS A;  2CRG A;  4YFX F;  3S93 A;  4A2U A;  2VKE A;  1XMK A;  5KK1 A;  3L2U A;  2ZSH B;  5FKL A;  4XKW A;  1X1C A;  1W7P D;  2HPM A;  3KE2 A;  5E79 C;  5HDK A;  3K7A J;  1GV2 A;  3BR6 A;  4BBS J;  3QWL A;  4M72 A;  1MBJ A;  4RB1 A;  2GXG A;  3PNY A;  4BQQ A;  4GRI A;  3ZPL A;  3FHZ A;  4B43 A;  1SFO J;  3K4B A;  3E6B A;  3A0H C;  4A0Y A;  3I3L A;  3AG2 H;  2QUF A;  2M1B A;  5BQT A;  4XK4 A;  4I6Z A;  3DTE A;  3KIO A;  1E0E A;  1WKM A;  3GTJ J;  5HLT A;  3I59 B;  4UVC A;  1O4X A;  4DJA A;  5ILU A;  2R4G A;  3L1P A;  3UNG C;  1X2N A;  2E35 A;  4XLN F;  3V8J A;  2HR3 A;  5L3E A;  3DLA A;  1LFP A;  3ISP A;  4NB5 A;  2ZME A;  4QPO A;  4XSZ F;  3HSF A;  4LG0 A;  1IRF A;  3AAF A;  2EPF A;  4Q47 A;  1WH5 A;  4A3L J;  4XQF A;  3CDL A;  2DOA A;  3WG9 A;  2E2H J;  3ZP5 A;  4KJZ A;  3F8C A;  4H4K C;  1D8K A;  3ZGK A;  2ZXH A;  2K27 A;  3GZ6 A;  2RC4 A;  3BLY A;  1VZ0 A;  2JVG A;  3GFJ A;  4A5N A;  4HX4 A;  3GLX A;  4G9Y A;  4QTR A;  1RRJ A;  1XCB A;  3S2W A;  4U87 A;  5LEJ A;  3CF2 A;  2R5Y B;  3L2R A;  4BE2 A;  2JQ7 A;  3HOW J;  2MAB A;  2VJI A;  3CCV I;  2DOD A;  1EKE A;  2NVT J;  1MBF A;  4IX7 A;  2VJJ A;  1YW7 A;  1PUF B;  4KT5 C;  1Y1W J;  1BC8 C;  4B3X A;  1P4X A;  2FX0 A;  4N4O B;  4G7O F;  2UV1 A;  4PJ0 C;  4AID A;  5D4R A;  1X1A A;  1Y8Q B;  3WTT C;  2DA7 A;  2VOD A;  4JYK A;  1GVD A;  1ZYR F;  4RGR A;  3DWL E;  4CXF A;  2FNP A;  3WGH A;  4HLY A;  4IHX A;  1SFE A;  4XLH A;  3O2P E;  4FIS A;  2M0C A;  4M3D A;  4M6V A;  4BAY A;  4OIQ F;  5F0H A;  2NOJ B;  2GA2 A;  3B02 A;  1FP1 D;  1IN5 A;  5J40 A;  4R79 A;  1BC7 C;  2XRO A;  4IQJ A;  1I1S A;  2DFH A;  3HPH A;  4Y3O A;  2VON A;  3FXO A;  2MFZ A;  3GFI A;  2M30 A;  2BVM A;  1LPQ A;  1YIO A;  4PUS A;  4L5E A;  4UY8 I;  2DYR H;  2COB A;  3DP7 A;  4KNY A;  3EYY A;  4BXX J;  3FBN B;  1SFU A;  2VI6 A;  3I4N J;  3REO A;  4D5F A;  2ME6 A;  4QLC U;  3RSN A;  3JRC A;  2VKV A;  4EAT A;  3BQY A;  1XDU A;  4RGX A;  1H9G A;  4ZYG A;  2VXD A;  3KLO A;  2F4I A;  2F5D A;  1BI2 A;  5E3L A;  1GXP A;  1LFB A;  4B4C A;  2ZME B;  5L3D A;  3ZMT A;  5JLW A;  2KDO A;  3IH2 A;  4BQO A;  2MH9 A;  3KEY A;  1I27 A;  2HQN A;  2G7U A;  1XC5 A;  2VQC A;  4W1U A;  1A6I A;  3CDI A;  2J5P A;  3PL8 A;  4MQ9 F;  2UXX A;  1A04 A;  2XAH A;  1KQ0 A;  3C2G A;  1ACI A;  1BL0 A;  1HC8 A;  1D3Y A;  2W48 A;  3WTV C;  3LA3 A;  2M3A A;  2DBB A;  2FU4 A;  4OAY A;  5JHU A;  3I5U A;  2OF7 A;  3PFY A;  2EK5 A;  1TBX A;  1NG6 A;  3OYJ A;  1MMA A;  2H94 A;  1DDN A;  4LD5 A;  2Q0O A;  4Q48 A;  1BJZ A;  3I59 A;  2VBY A;  1K83 J;  1OCO H;  3BPV A;  2PLY A;  5LGU A;  1HW2 A;  1WHU A;  3CP2 A;  4P55 A;  2MG4 A;  3JR9 A;  4L9T A;  2MYS A;  2XAS A;  3SEQ A;  2LG4 A;  1BA5 A;  1FOX A;  1OFC X;  2DK8 A;  2ZFW A;  1MZB A;  4A3I J;  2BOL A;  4XKC A;  4S04 A;  4ENJ A;  2GXA A;  1SVO A;  5ILV A;  1IV8 A;  4BKX A;  1RI7 A;  3CME I;  2FQ4 A;  4GO1 A;  2KP6 A;  4HF2 A;  3OYI A;  1W4M A;  3ZMZ A;  1D1B A;  3IRQ A;  4KMU X;  2HVR A;  2Y9Y A;  3BR0 A;  3OYA A;  1FP2 A;  2ETH A;  3VDX A;  1KYZ A;  4FE4 A;  5FKM A;  3BCB A;  1OYI A;  4RDU A;  1ZLK A;  5K7F A;  3LSJ A;  3JAM Z;  3BZC A;  2ISY A;  1EA3 A;  5F0F A;  4GXO A;  2JSP A;  3W6J B;  2NVU B;  4EJO A;  4PFP A;  4IOA F;  3GX4 X;  1IRX A;  2CUF A;  4UB6 C;  3W2V A;  1ITY A;  5D5X B;  5J4Y A;  4OMZ A;  4A0Z A;  1HKS A;  5IYB J;  1WJD A;  2DA5 A;  1WJE A;  3CES A;  2XDV A;  3OYE A;  3DU5 A;  3R0J A;  1R4N B;  2DCE A;  2OAZ A;  3P9C A;  3RQI A;  4BHB A;  5K5Q A;  4XRM A;  3H9G A;  5BS6 A;  1FTT A;  2IVM A;  2QLZ A;  3LA2 A;  2IS4 A;  3OL3 A;  3RKQ A;  3LNQ A;  4I09 A;  3E7L A;  2JMW A;  3J81 K;  4A3K J;  4ZDL A;  2EZK A;  5TJJ A;  3W2W A;  2DA2 A;  3CDH A;  2R92 J;  5E8I A;  2DXI A;  2EIJ H;  2PI0 A;  3VEP A;  2W24 A;  2XAG A;  1ODD A;  3FXK A;  4MLO A;  2VBX A;  2VAS A;  3ZR8 X;  1OCR H;  2BE5 F;  5JI6 A;  2D45 A;  2OQG A;  1X58 A;  2DFE A;  3HC7 A;  2M2E A;  2RGV A;  1XSV A;  2I10 A;  4PGG A;  3D1N I;  1QU3 A;  2Z3Y A;  2YSR A;  1W7P B;  1S29 A;  2LBF B;  1BOA A;  3PO3 J;  2XGE A;  4IVN A;  4DBQ A;  2EV0 A;  1BM9 A;  3ZQQ A;  2STW A;  2DA6 A;  1A35 A;  1UHM A;  1GDT A;  1OCZ H;  5B1A H;  2PJP A;  2G9W A;  5IY5 H;  3SQN A;  2HDD A;  3RYR A;  2ISZ A;  4A12 A;  2F5E A;  1E3P A;  1X2M A;  3WHB A;  3MZH A;  1YLF A;  1RNL A;  3LFU A;  2HTS A;  3LSR A;  3JAM K;  4LOC A;  2QQ9 A;  2X6W A;  3TMO A;  3K2A A;  2LTP A;  3R61 A;  5DCM B;  2ZXI A;  3I53 A;  2QQ8 A;  4M9Z A;  4LJZ F;  5DM6 F;  3HG9 A;  4N0B A;  5E18 F;  3OS1 A;  3RJP A;  3KET A;  1T39 A;  2CJJ A;  1LDK B;  1JKR C;  3K2Z A;  2F5C A;  5J47 A;  1YJW I;  2RDP A;  4WCG A;  1JKO C;  2K9N A;  1RC9 A;  3JCU C;  5IP6 A;  1GLN A;  1R71 A;  1PP8 F;  2D5V A;  1DGR M;  2K02 A;  2XVC A;  2DO7 A;  1Z1D A;  4A5M A;  4GYG A;  2Z33 A;  1MBK A;  1G4D A;  2GA1 A;  2HYJ A;  2PX9 A;  2E1M C;  4L5I A;  1W1W E;  2O3F A;  4C2M J;  2HXO A;  3H5A A;  1IXS B;  2NVX J;  3PFI A;  5LBQ A;  1H89 C;  3DXJ F;  2RKH A;  1YTY A;  3TGN A;  3TO9 A;  2ZME C;  2F5F A;  2PBI A;  3DU6 A;  3K4N A;  2MC3 A;  3L2W A;  4KIB A;  4C9Y A;  4U0Y A;  2P8T A;  1B59 A;  2JT1 A;  2CO5 A;  5CVI A;  2BZT A;  2KRF A;  2KZV A;  3WU1 B;  5HVQ C;  2DA4 A;  3B6A A;  5GTH C;  2YPR A;  3OIP A;  3R4K A;  2O9L A;  3GUD A;  3QPT A;  1FYL A;  3F6O A;  4OIN F;  2DMT A;  4L9N A;  5H6Q A;  4BJT A;  5JFR A;  1UHS A;  5EGO A;  5HDN A;  3CCY A;  3L00 A;  3A2K A;  1MH3 A;  2XAU A;  4B3A A;  2GIZ A;  2DQL A;  5DD4 A;  3F3X A;  2PQ8 A;  4LLN A;  1FWZ A;  3HBL A;  3K1M A;  3FXQ A;  2YU9 J;  1WVR A;  2CWE A;  1FMW A;  4LIT A;  2UUZ A;  3CCJ I;  1ZAR A;  1ONV A;  3HTS B;  1YJN I;  2IGK A;  3DFG A;  3PJR A;  3DBH B;  1X3W B;  3QP6 A;  2L7M P;  1HW5 A;  4WXH A;  1UEL B;  4MEX F;  2O03 A;  5J1Y A;  1PUF A;  3GBG A;  4ENK A;  3L09 A;  2A69 F;  3O6B B;  4A69 C;  5K7Z A;  3K10 A;  4PSW A;  3GWZ A;  4HW0 A;  3M8F A;  1FT9 A;  2EB7 A;  2VB6 A;  2FML A;  2V9V A;  2KJC A;  3CCQ I;  3BWG A;  2MD0 A;  1I6H J;  1IF1 A;  1G3W A;  1YJ9 I;  3CCS I;  2YUS A;  1ZRE A;  2W84 A;  4HNT A;  3OYD A;  3E6D A;  1JKP C;  5BNG A;  4HV5 A;  1QPM A;  3FKI J;  1GUU A;  4LB5 A;  2X6O A;  4Y15 A;  3JTH A;  1UAA A;  2L7K A;  4RMN A;  1SD5 A;  3V7S A;  2L9R A;  2NNN A;  4E6K G;  2HOE A;  2XGD A;  4ENM A;  3PQK A;  2KZG A;  3SXY A;  3COA C;  2DFI A;  1MSE C;  4RB2 C;  5HS8 A;  2L0K A;  4HQE A;  4G12 A;  2IRF G;  3V42 A;  1T0F A;  3PUB A;  1D0X A;  3F8M A;  4HEA 2;  1BW6 A;  1MIJ A;  2XRN A;  3HB9 A;  3RQ4 A;  3BJ6 A;  3ZQH A;  3ZMU A;  1UG0 A;  2F4M B;  1BR1 A;  5A2Q Z;  3N4M A;  3GO5 A;  5IOY A;  2JPB A;  2K5C A;  4HV6 A;  3KLN A;  1BOB A;  3ZN1 A;  5HNF A;  3VYR B;  4UV8 A;  1HOM A;  1WFX A;  1PUE E;  1R1U A;  2MGQ A;  5HS9 A;  3C18 A;  1UST A;  2KKO A;  3K0L A;  3QAH A;  4B44 A;  4BDY A;  1VQ5 I;  2PJR A;  5LGN A;  3WG7 H;  1B4A A;  3CLO A;  1SVM A;  3MKY B;  3ZRG A;  3HTU A;  1FTZ A;  2OC6 A;  3U2R A;  1LUJ B;  5K5R A;  3MN2 A;  1MJA A;  2BXZ A;  2ZC2 A;  1RKT A;  5B1B H;  3HGY A;  4N4N B;  4CCN A;  2ME0 A;  3EQL F;  5D5W B;  2O6G E;  3MKZ A;  2X1D A;  3KPH A;  1SAU A;  2VKD A;  3QP5 A;  4E7S A;  3RPU A;  1SEU A;  1I3A A;  3S2D J;  2X6X A;  5FKK A;  1I6X A;  3BG7 A;  2JA7 J;  1SVL A;  1IRG A;  1IN7 A;  3SEZ A;  1B72 A;  3VYU B;  4F93 B;  3HOX J;  3GTK J;  4IL6 C;  3LST A;  3OR2 C;  4MIM A;  4NC6 A;  5HDG A;  5EGO B;  4ZH4 F;  1HW1 A;  2HNH A;  4L9V A;  4IHV A;  2NYX A;  2VPL A;  1WZ2 A;  2A6E F;  4F55 A;  2HEO A;  1ETW A;  4NDL A;  3K6G A;  1FOY A;  1B1B A;  3DBR B;  1AHD P;  4CO8 A;  2GOM A;  2QWW A;  3I58 A;  2Z16 A;  3JRH A;  3KP6 A;  3N05 A;  3FKJ A;  2X85 A;  3OYB A;  2CUE A;  4OU0 A;  3I56 I;  2HOS A;  2KIU A;  2LSO A;  1OMI A;  5DDG A;  2H1K A;  1HSJ A;  3SYT A;  2O0Y A;  4II2 A;  2E7X A;  1T38 A;  3TO7 A;  3E6M A;  1LNW A;  2VJ5 A;  4IJA A;  2M5W A;  2IS6 A;  1GV5 A;  4ZYD A;  4A3G J;  4XN3 A;  2W85 A;  3DTI A;  1U5T B;  3F8F A;  3HRU A;  2NAZ A;  4LIV A;  3JRI A;  3BTJ A;  2O8K A;  3RCO A;  4PDK A;  1YW9 A;  1U5T C;  2CG4 A;  2R7R A;  4DZP A;  1JUM A;  1ETY A;  2K85 A;  1ZKG A;  2H27 A;  2DU9 A;  2PMZ A;  1TQP A;  4IRI A;  3L9F A;  2ACJ A;  1B9N A;  3TW6 A;  4A3J J;  2MBF A;  3ELK A;  1ZG5 A;  3QU6 A;  3HM5 A;  3OYN A;  1EF4 A;  1JHH A;  4XON A;  1H8A C;  2A61 A;  4G8X A;  3KEO A;  2JK3 A;  1XX5 A;  4DBR A;  4A3B J;  1V54 H;  2EZH A;  3IHU A;  2LP0 A;  2Y75 A;  3CUO A;  3V8L A;  1RES A;  5F1R A;  3A02 A;  1K78 A;  2M4K A;  1XDS A;  3HRM A;  4AVZ A;  4HAM A;  4LLL A;  1U2W A;  1WJA A;  3HKZ A;  1LJ9 A;  5DTD A;  1SAX A;  1D5Y A;  3H36 A;  2ZNZ A;  4HYE A;  1KU2 A;  4M3G A;  1BIB A;  1JHF A;  3G73 A;  5D6F A;  3S3N A;  4MTD A;  1NK3 P;  2QZ8 A;  3KP4 A;  4A93 J;  5CVU A;  4XLP F;  2A5W A;  1U3E M;  1S5L C;  3FX3 A;  1IN8 A;  1EV7 A;  1SAN A;  1MBE A;  2R7V A;  3B6C A;  4P96 A;  3ZMS A;  4FX0 A;  4J00 A;  1BW5 A;  2C6Y A;  2GWR A;  2X51 A;  3I71 A;  2H6C A;  1ZR4 A;  5L3C A;  2VLA A;  1I39 A;  4TV7 A;  2X9D A;  4JX5 A;  2PN6 A;  4CUG A;  2STT A;  4D1Q A;  2W82 A;  1HDP A;  4MFD A;  1HKT A;  4DOZ A;  1YX5 A;  2E36 A;  4IOC F;  4XBF A;  3UR3 C;  2L9V A;  3CLQ A;  4Z2Y A;  4NHJ A;  3A1Y A;  2R7T A;  1N25 A;  2Z1D A;  1JGS A;  1CQT A;  2RAE A;  4XN0 A;  5IYD J;  2VOO A;  1JTY A;  2KHM A;  4XRF A;  3DBL B;  4P9F A;  9ANT A;  1V5E A;  3V4G A;  3X2Q H;  1BJA A;  4A6D A;  1GHC A;  3LSG A;  5F1J A;  4RM3 A;  4ZZL A;  4CYD A;  2CFO A;  5D5U B;  2PEX A;  4RA2 A;  1RUO A;  2EH3 A;  1B9M A;  1KGS A;  3FWE A;  2EZI A;  4ESF A;  3J80 Z;  2IA1 A;  4EGZ A;  2HZT A;  4BXU A;  4X1E A;  1VQN I;  3IKT A;  1V3F A;  3GFL A;  2LF8 A;  2WBM A;  3H9Q A;  3K4K A;  3MMY B;  2XRL A;  2O8X A;  1MJ9 A;  1H9T A;  2P6T A;  4AYB N;  3IWZ A;  1ZGA A;  4KIC A;  5E20 A;  3LSI A;  1OLT A;  2VBZ A;  1FEX A;  2XHK A;  2MW8 A;  4S0H B;  3W3C A;  2HDW A;  3I4P A;  4XLC A;  4E7K A;  1MDM B;  3JSO A;  3BG9 A;  5IP7 J;  3ABT A;  4Y17 A;  5CYV A;  1LDD A;  1TNS A;  2EFP A;  3T0Y A;  3DPU A;  5ICE A;  1OYW A;  4D7M A;  2WV0 A;  4E70 A;  2QSG X;  2W1O A;  1ZRF A;  3E0J B;  2K86 A;  3HL2 A;  3LSH A;  5FFX A;  2ZJ2 A;  4CZZ A;  3HPG A;  2ZJR F;  4U0V A;  3M3Y J;  2RV8 A;  2GIV A;  2OUM A;  4I0A A;  2ZFU A;  2D1V A;  2BGC A;  4IXA A;  5D8L B;  1Z77 A;  2WAF A;  2BHZ A;  1T6S A;  3C2H A;  5LRS A;  2V9P A;  4CCO A;  2E1C A;  1G2H A;  2HTJ A;  3V7C A;  4RBO A;  3G1O A;  2JN6 A;  3ZQG A;  4A3F J;  4ZTJ A;  3OYK A;  3ZMD A;  5EZG A;  2V4J C;  4IHW A;  1F4K A;  2UWM A;  4I98 B;  3QOE A;  2Y0S N;  4HDU A;  3SFI A;  4IZZ A;  5HLG A;  5K1Y A;  2F48 A;  5H20 A;  3BG3 A;  4O6J A;  4N9H A;  3U9G A;  2HGC A;  1MMN A;  2KDZ A;  1SFK A;  3NAU A;  5EJC A;  3FM3 A;  2V6C A;  2HQ5 A;  3CUQ B;  2R7Z J;  3TW7 A;  4YFK F;  4E7L A;  1F9N A;  5HLI A;  5IT3 A;  3KP5 A;  3DKY A;  4RAG A;  3F72 A;  1KZH A;  2W57 A;  1U9O A;  2E71 A;  2EWN A;  4ZYA A;  2M34 A;  2ZKZ A;  2AO9 A;  2LF7 A;  1Q1V A;  2CW8 A;  2LY2 A;  2VE8 A;  2KQR A;  3ECO A;  2KFD A;  2K9S A;  1HF0 A;  1Y0N A;  4II3 A;  4F3Q A;  4KT6 A;  2XAJ A;  1R4M B;  2JSC A;  2VUM J;  1X1D A;  4ITV A;  1E17 A;  4I0B A;  4G6T B;  4HQM A;  4DYC A;  3ABK H;  4W97 A;  2XF6 A;  3ULQ B;  3OYH A;  2K40 A;  2G0E A;  3PM1 A;  1O3R A;  1WI3 A;  2VBW A;  2DAO A;  2XPV A;  3H1C A;  3E5Q A;  4BAC A;  2UZK A;  2EV5 A;  3FHN A;  3FDY A;  3RZD J;  1OPC A;  1P7I A;  2R7Q A;  4Q4Z F;  5DYM A;  4XOR A;  2QEN A;  1YFH A;  2XGX A;  4Y7N J;  3M4O J;  3BQZ A;  1MDM A;  1GVJ A;  5FKN A;  5M3M J;  4EJU A;  4BHP A;  4PJJ A;  4LK0 F;  4FCY A;  3CCU I;  4HX7 A;  1J7K A;  1WRJ A;  5LRR A;  3CF5 F;  4JP0 A;  3O8H A;  2JUG A;  1FPQ A;  3M07 A;  4WK8 F;  5FRO A;  4UB8 C;  4Y13 A;  4Z6Y A;  3BCA A;  4XMY A;  4BU2 A;  2ZJQ F;  4ENN A;  2D1H A;  1H0M A;  2XF7 A;  3UKG A;  1I5Z A;  3QU3 A;  1G3S A;  3L2C A;  4RB0 A;  3PSI A;  2GZW A;  4RLF A;  3R6S A;  3MZ8 A;  3A03 A;  2KIF A;  2M7A A;  3J7Z I;  3LSP A;  3H92 A;  3LOC A;  2DW4 A;  2COM A;  4BNC A;  4J19 A;  1PYV A;  3CO6 C;  1IJW C;  3H0G J;  2RNG A;  3MD2 A;  5F08 A;  4QIW N;  1OCT C;  4E7H A;  1J09 A;  2BVL A;  4L9J A;  4AC0 A;  3EUH C;  5LFA A;  4AIK A;  5ERI A;  4EVI A;  3ROU A;  1KA8 A;  1IDY A;  4MFE A;  1E2X A;  3S1Q J;  5F27 A;  2DMU A;  1J2X A;  3ONQ A;  3OYL A;  3TL4 X;  2OJE D;  2FF4 A;  4O5V A;  3KX2 A;  1SMT A;  4HPQ A;  3A0B C;  1NHA A;  4AU7 A;  4DNC A;  5FO5 A;  3RKW A;  5HNH A;  4M3F A;  2WAQ N;  2Z99 A;  4KYW A;  3FMS A;  3IAS 2;  4L0Y B;  1IV6 A;  3DQV C;  1HXD A;  3VPR A;  2GBY A;  2NVY J;  2DDB A;  2A07 F;  1JT6 A;  1R00 A;  5EEG A;  4EM0 B;  2R7O A;  2R7F A;  4R1H A;  1IO2 A;  2MSY A;  2DQR A;  3K70 D;  2I8D A;  3CD6 I;  2Y0M A;  1QVU A;  5BPI A;  2QGU A;  1J0R A;  1LB2 A;  3MFK A;  1VI0 A;  2V9K A;  2O7O A;  4BL0 B;  2B9S A;  3IL2 A;  1OJL A;  3DTK A;  1K78 B;  3BRO A;  1MMG A;  3QPS A;  1VQ6 I;  5J4V A;  2X4H A;  1T0F C;  4LG0 B;  5CKT A;  3S16 J;  3H5N A;  1V5G A;  4ZZD A;  1OCC H;  1DP3 A;  2ZXJ A;  2K4J A;  3GFM A;  3OYM A;  1D1A A;  3E3V A;  1TQM A;  1BI0 A;  1M1E B;  2EFN A;  3VB2 A;  3CUQ C;  3HOZ J;  4D5C A;  3ABM H;  1QVT A;  1U5T A;  1BIA A;  4L5J A;  3TOB A;  2FSW A;  2O5R A;  2L54 A;  2OQR A;  4ZYH A;  3H3V K;  4BY1 J;  1MBH A;  3OR1 C;  1D8J A;  5E1Z B;  2IA2 A;  1F1Z A;  2H1L A;  1YX3 A;  2FE3 A;  2CQ7 A;  1ZGW A;  3SDB A;  4YEL A;  1O3T A;  3QQA A;  2DN0 A;  5ICF A;  4M3E A;  1XPX A;  3WGG A;  1XMA A;  1WJ5 A;  3WE2 A;  1XMX A;  3L7W A;  3S8P A;  2XAQ A;  2ICW G;  2AHQ A;  2E1M B;  2IEK A;  3AKZ A;  1TTY A;  5FRM A;  1P9Q C;  1LQ1 A;  3E5X A;  3VWB A;  2R7X A;  1HLV A;  3OOP A;  1HBX G;  2EIN H;  1G3T A;  1MNM C;  1ZGJ A;  2E7W A;  5EG0 B;  4A3D J;  2TRT A;  2QSH X;  3VOE A;  1HCR A;  1ZLJ A;  2FD5 A;  5EYR A;  1IG7 A;  2VOP A;  1JUS A;  2YX4 A;  3TED A;  4DIQ A;  1CGP A;  2CQN A;  5CQE A;  4MHG A;  5JHF A;  5BPD A;  4ZDP A;  3LSK A;  1TW2 A;  4IQ4 A;  2XKO A;  4PGH A;  5DV5 A;  4C2U A;  4E4H A;  1Y8R B;  1FZP B;  2DOE A;  1D0Z A;  2H6B A;  5E3M A;  4S05 A;  2K3F A;  5J8C A;  3OYG A;  3QYF A;  1UHW A;  4AIJ A;  1PVE A;  3U1K A;  2E1O A;  1R49 A;  4O3M A;  3RKX A;  3OYF A;  4BEH A;  1QPI A;  1O3Q A;  3ZQC A;  3HOU J;  2XB0 X;  3D5R C;  3G3Z A;  4F92 B;  1Z21 A;  3WTW C;  4XLA A;  2BY0 A;  2QQB A;  4D0P A;  1R5G A;  3AFH A;  1IC8 A;  2J5O A;  2DYS H;  1VTN C;  4RAZ A;  4XLE A;  5J6X A;  4BXF A;  3ERM A;  2OBP A;  5KVR A;  3GYH X;  4AD9 A;  2XC7 A;  2LRE A;  1HQC A;  1GXQ A;  5FKO A;  4AIH A;  2YS9 A;  2TCT A;  1QBJ A;  1WWX A;  1QQI A;  2IGO A;  3P7N A;  2M7B A;  3GTL J;  3EET A;  4XKV A;  1JTX A;  1G3Y A;  3KP7 A;  1H88 C;  1USS A;  2VQL A;  1YIT I;  1EH6 A;  1KQ9 A;  1K6Y A;  3I0T A;  3BTI A;  4CH7 A;  2R7D A;  3T5X A;  1NH3 A;  1LEB A;  1VQ9 I;  4XM3 A;  1FJL A;  4XRS A;  2JA5 J;  2JRM A;  2L5Q A;  1XGO A;  3CUQ A;  4BBR J;  5D5V B;  1K4T A;  2QVO A;  4PJL A;  5D6E A;  4NBQ A;  4WXD A;  1Z3Y A;  1FY7 A;  4B48 A;  2Y31 A;  3BDD A;  2GAU A;  1VQ7 I;  3S32 A;  3FIW A;  3CCM I;  5FLX K;  5HS7 A;  3OWT A;  5JVG F;  2VT3 A;  1X19 A;  2CV1 A;  5GAE J;  3U1D A;  2WY7 Q;  2K3P A;  1E3H A;  1O3S A;  1T8I A;  4E7Z A;  1W5S A;  2HOA A;  3ZCO A;  1U8R A;  1P7J A;  2V1D A;  2R3S A;  2JTV A;  2EQR A;  4F91 B;  3U21 A;  3WTY C;  2DT7 B;  2IT0 A;  1FBU A;  5BMZ A;  3FF5 A;  1O7F A;  3TDU C;  1R6R A;  3S2H J;  3IWF A;  5DM7 F;  4MEY F;  2R0Q C;  1SC7 A;  2O61 A;  3BP8 A;  4ASN A;  2VC1 A;  4LLG F;  4M73 A;  4A0X A;  4FET A;  5GTI C;  3IKV A;  1REP C;  2HYF A;  5KCM A;  3CZ6 A;  2P7C B;  5H2F C;  3M1E A;  4P5O A;  1YRN B;  1Y6I A;  3Q3S A;  5ICC A;  3AG4 H;  2WTE A;  4G7Z F;  3RPQ A;  3JTG A;  3GVA A;  5C3E J;  1RR8 C;  3ESW B;  3HRT A;  4DYQ A;  1ZQ3 P;  2E1N A;  4DQ2 A;  1VQL I;  3CQZ J;  3LQR A;  3CCR I;  4YIR X;  3MKL A;  4EEF G;  2HDC A;  2ZNY A;  1FC3 A;  1P6R A;  2WB1 A;  4CYC A;  2ESH A;  2ZXW H;  1IZ1 A;  4F7Z A;  1RZ4 A;  3HIF A;  3OOU A;  4H0E A;  2E2J J;  3NWT A;  3DF8 A;  1VQ4 I;  2FNA A;  3I9V 2;  5DCF A;  4ETS A;  4A3M J;  3BJO A;  4D7N A;  2P81 A;  3HUG A;  3P9I A;  2DA3 A;  4EJW A;  2CU7 A;  1J75 A;  1BBY A;  4P9U A;  2WV1 A;  3HEF A;  4LG3 A;  1TC3 C;  2GQQ A;  3FMQ A;  3TQN A;  1NG7 A;  4XID A;  1TP4 A;  1FYM A;  1XGS A;  2L4M A;  2XKP A;  5CPR B;  2Q2E A;  2P5L C;  1W0T A;  2GOX B;  1LFU P;  5DCM A;  1HST A;  1PJR A;  4P1W A;  4GGG A;  5E3O A;  4BHC A;  2Z2S B;  1XCV A;  3M8J A;  4CCK A;  1V55 H;  2EV6 A;  1ZH5 A;  1XGN A;  1Y0U A;  3CMA I;  4HF0 A;  2M9H A;  3S1M J;  3G1L A;  4BE0 A;  4L18 B;  2JVH A;  3PO2 J;  1ERD A;  2UXN A;  3E6C C;  3EDP A;  2JWT A;  5DS9 A;  1T56 A;  3KYL A;  2DPD A;  4FQG A;  1ON2 A;  2CS3 A;  4OIP F;  5AIQ A;  4G6Q A;  3D5S C;  2F2E A;  4G7H F;  4JBA A;  4BJ6 C;  4YG2 F;  2NNY A;  2E19 A;  3PUF A;  1W7P A;  2HQA A;  4LB6 B;  2AQF A;  3BG6 A;  1U0J A;  2FBK A;  1YS7 A;  4QPQ A;  1R9T J;  3QOP A;  4V2F A;  4C2T A;  3QYB A;  3F22 A;  2R7W A;  1VND A;  4CA0 A;  3C2B A;  4AUX A;  1IGN A;  1MGT A;  3F9K A;  2IS1 A;  2CUJ A;  1O7L A;  1OQY A;  2BY1 A;  3I64 A;  4CCJ A;  3OYC A;  3CMY A;  4CCL A;  4V2G A;  4BS9 A;  1XB4 A;  1U78 A;  2CUZ A;  2HXI A;  3BG5 A;  2NS7 A;  1FIA A;  4U7B A;  5CVV A;  3GTM J;  1FBQ A;  1ZG3 A;  2HS5 A;  4C30 A;  5LLQ A;  5LHG A;  2K9L A;  5F0C A;  1ZTR A;  1T2K A;  2WAD A;  2QCO A;  3KFW X;  2KIQ A;  3RI4 A;  5GPC A;  3T8T A;  2TDX A;  4HSR A;  3NRV A;  3S3M A;  4HLX A;  1E3O C;  2WA0 A;  4XL9 A;  2PMZ N;  1N75 A;  2LK2 A;  4EJT A;  1O57 A;  2M8E A;  1J9I A;  2ELH A;  2ELK A;  2RQQ A;  3O8G A;  5E1X A;  3WTS C;  4IRG A;  5ILS A;  4JX4 A;  3WHC A;  4CSW A;  3J80 K;  2LKP A;  2B0L A;  3BR2 A;  3ZXS A;  4I99 C;  2EFQ A;  3I4M J;  1LDJ A;  3OIQ A;  2MA3 A;  2DK5 A;  4KN4 X;  5CLS A;  3PIP F;  1DU6 A;  2Y2Z A;  4HX8 A;  1J5Y A;  3CO7 C;  1QNT A;  2A5Y B;  2PFB A;  2XSJ C;  3GEZ A;  1FSE A;  1RET A;  3IC7 A;  3L2V A;  1IRZ A;  2LR8 A;  1IUF A;  3HZJ A;  2CV0 A;  3BTC A;  1TZL A;  3Q0V A;  4QSH A;  1QZY A;  2X1E A;  3MVP A;  1TW3 A;  4XR6 A;  2XV4 S;  1YS6 A;  4HDV A;  1R58 A;  2KJB A;  2IXS A;  2LY1 A;  4UUS A;  1K7A A;  4IKF A;  2MC4 A;  2CW0 F;  2JA6 J;  4YII A;  1W5T A;  1ZN2 A;  4MGR A;  5FLX Z;  1ETO A;  3GTG J;  4WX9 A;  1D0Y A;  1XSX A;  2Y69 H;  4PK4 A;  3F0C A;  1N77 A;  5K5O A;  1IXR C;  1WQ2 A;  3JSP A;  4HBL A;  5EZH A;  1ETX A;  1ENH A;  4OAZ A;  4EM2 A;  4HF1 A;  2HWV A;  2HI3 A;  4WF2 A;  1WJC A;  2RVC A;  3KZY A;  3OSF A;  3HRS A;  5A2Q K;  2A05 A;  1ULY A;  1YG2 A;  2NS0 A;  4BGD A;  2VXZ A;  4AVP A;  2XPU A;  4ABZ A;  4RLQ A;  2R7S A;  2K9Q A;  3HKZ N;  1RR7 A;  1Z91 A;  2KPM A;  2JA2 A;  5KNL A;  1OR7 C;  1UB9 A;  1ETV A;  3FMR A;  2BHY A;  1YQA A;  5GAH J;  3HHH A;  2HOT A;  3TBI A;  3KZZ A;  1SD4 A;  1MH4 A;  3HJE A;  1DGW Y;  4B8X A;  3TOA A;  5F6F A;  5M3F J;  2E34 A;  3JRA A;  3O3K A;  3GME A;  3BZK A;  2ADU A;  3F23 A;  1IW7 F;  3M1C A;  2P5V A;  4HST A;  4WXC A;  1VQO I;  2NVQ J;  1QZZ A;  3BZ6 A;  2M0M A;  3ZQI A;  1JXS A;  3K1N A;  3MCZ A;  2EA2 A;  4NC7 A;  1TT0 A;  3CJR B;  4R8H A;  1X3U A;  3L2Q A;  3S17 J;  2DJN A;  5CJ9 A;  4BDZ A;  1IN4 A;  3IUO A;  3KYD B;  3VYS B;  2LC2 A;  5E1W A;  5LHH A;  2WWY A;  1ZR2 A;  4EQQ A;  4IEJ A;  1R7J A;  4UUV A;  3KEQ A;  4ESJ A;  4CZC A;  4UHT A;  2WY8 Q;  1IDZ A;  1Y56 A;  5JVT A;  2A6H F;  2IS2 A;  1WJB A;  3DKW A;  3W6V A;  5LGT A;  2FBI A;  4BYY A;  4OMY A;  1RKW A;  5J3L A;  5TGT A;  3FXL A;  3TP3 A;  5FD6 A;  2MLK A;  1JKQ C;  3WU2 C;  3FZV A;  5EF6 A;  5AON A;  1CF7 B;  4JX6 A;  3BJA A;  4LFU A;  1U6G A;  1W36 D;  2V79 A;  3HXL A;  2DMN A;  2LFB A;  5CVR A;  5IPA A;  2EA4 A;  2ZSI B;  1MW7 A;  5FLM J;  3MWM A;  4I2O A;  3DEU A;  2JPC A;  2OV7 A;  3N97 A;  1DQU A;  3KP3 A;  1TLH B;  3FIS A;  5D8K B;  4OIO F;  5ICG A;  3KYC B;  1Z6R A;  4JOM A;  4BE1 A;  5KAF C;  3VSK A;  3J81 Z;  4K2E A;  1RPW A;  4Y52 J;  1TQI A;  3QPL A;  3HYI A;  4BJ5 C;  1BN5 A;  2QBY A;  2L2O A;  2I5U A;  2IPQ X;  1MBG A;  4UUS B;  4ANJ A;  3C7J A;  5KHD A;  1X1B A;  2L7Z A;  3KP2 A;  5FFZ A;  4XIC A;  1A36 A;  5FGM A;  1QHH D;  1HA8 A;  6PAX A;  4YEJ A;  2LD5 A;  2FXA A;  4EMS A;  5FJ8 J;  3C3W A;  2OTJ I;  4FHT A;  4RS8 A;  3Q9V A;  4E7I A;  3LSM A;  3WE3 A;  5IP9 J;  1I50 J;  3ABL H;  1TWH J;  4OIR F;  3H5R A;  3JRD A;  1WI9 A;  2V1X A;  3SJM A;  3SHF A;  3ERE D;  1J59 A;  1JT0 A;  2OTL I;  3AL0 C;  3R60 A;  5GAG J;  2WC2 A;  3OMY A;  5IT9 K;  1QHG A;  3DKX A;  3P9K A;  4PFO A;  4G6D A;  2X6Y A;  2CQX A;  2BY2 A;  3RTR A;  5J8F A;  5EG0 A;  1MMD A;  3TP0 A;  3EUH A;  4I7H A;  4UUT A;  2HVQ A;  5E3N A;  2B7E A;  4HOB A;  1TWF J;  1B6A A;  1S7A A;  2RN7 A;  1Z9C A;  5L3F A;  2FRH A;  1YRN A;  3DEW A;  1ZHF A;  5C4J J;  3BT9 A;  2IP2 A;  4KIT B;  3HHG A;  2OCE A;  3BY6 A;  3GZ5 A;  1G8X A;  4RAF A;  4DGW B;  2HYG D;  1Z6T A;  3RPU D;  3KZI C;  2HU9 A;  5DD8 A;  3S3O A;  1AKH A;  2BXY A;  2QM3 A;  1QA6 A;  3SZG A;  3A4C A;  4HG2 A;  2ECC A;  4IRH A;  4KMF A;  1QO0 D;  1QZE A;  1KYW A;  2LYC A;  1IUY A;  2IAI A;  3LA7 A;  1LKX A;  1NTC A;  5HOO A;  2K4B A;  3E1S A;  2OD5 A;  1FIP A;  3WTU C; 
#chains in the Genus database with same CATH homology
 3OYG A;  3QYF A;  2HNH A;  3S93 A;  2VPL A;  3L2U A;  2ZSH B;  4F55 A;  1Z3X A;  4XKW A;  3K6G A;  1X1C A;  3OYF A;  4BEH A;  3DPL C;  2HPM A;  2CV2 A;  1MNE A;  2GOM A;  2Z16 A;  3D5R C;  3K4L A;  4F92 B;  3N05 A;  3FKJ A;  1Z21 A;  2X85 A;  3PNY A;  4BQQ A;  4XLA A;  4GRI A;  3OYB A;  3CMM A;  4B43 A;  3AFH A;  3K4B A;  4XKB A;  3SYT A;  3I3L A;  4ZC3 A;  4II2 A;  4XLE A;  3DPT A;  3QOD A;  2VJ5 A;  4BXF A;  2IS6 A;  3DTE A;  1E0E A;  4XN3 A;  4BUP A;  3DTI A;  4E7J A;  5HLT A;  2XC7 A;  3K4C A;  4LIV A;  3G2B A;  2LRE A;  4DJA A;  2QKM B;  1FMV A;  2R4G A;  3UNG C;  2F5V A;  4XNF A;  3RCO A;  3DLA A;  1LFP A;  2IGO A;  4QPO A;  3FBI B;  2M7B A;  1KON A;  4XQF A;  2R7R A;  2DOA A;  4XKV A;  2PMZ A;  2VQL A;  1K6Y A;  4KJZ A;  4CH7 A;  4H4K C;  3ZGK A;  2ZXH A;  2RRE A;  2VKH A;  3BLY A;  1VZ0 A;  2JVG A;  2IGN A;  4XM3 A;  2Y0S A;  3OYN A;  4U87 A;  2L5Q A;  4XON A;  3CF2 A;  3L2R A;  4PJL A;  4BE2 A;  2MAB A;  2VJI A;  2V6E A;  1BR2 A;  1Z3Y A;  4B48 A;  3PNT A;  3S32 A;  4DBR A;  2QKL B;  2LRD A;  2VJJ A;  3HOT A;  4IX7 A;  2R7U A;  3OWT A;  3OL4 A;  4ZJZ A;  2CV1 A;  1X19 A;  2WY7 Q;  2IGM A;  2K3P A;  4B3X A;  2FUG 2;  2KRH A;  4N4O B;  4E7Z A;  1ZEL A;  2UV1 A;  3ZCO A;  2M4K A;  1X1A A;  2CH0 A;  3DEE A;  4AVZ A;  4F91 B;  3U21 A;  1WJA A;  2DT7 B;  3HKZ A;  4B47 A;  3DWL E;  3OY9 A;  4XLH A;  1R6R A;  1N78 A;  3PNV A;  2VQG A;  3S3N A;  2NOJ B;  2A5W A;  4FET A;  5KCM A;  4R79 A;  3CZ6 A;  2R7V A;  4IQJ A;  4Y33 A;  4P5O A;  4NNJ A;  4J00 A;  1Y6I A;  3HPH A;  4Y3O A;  2MFZ A;  2WAQ A;  2X51 A;  4J01 A;  2BVM A;  1AA7 A;  4PUS A;  2VLA A;  1T95 A;  2BW3 A;  2DT6 A;  4CUG A;  4D1Q A;  2W82 A;  4F52 A;  3FBN B;  2KRC A;  3RSN A;  4EAT A;  4DOZ A;  4PSX A;  3CP8 A;  1YX5 A;  3IAM 2;  2VXD A;  3UR3 C;  2E60 A;  2WB1 A;  2F4I A;  2X1C A;  3A1Y A;  4CCM A;  2R7T A;  2Z1D A;  3OOU A;  2KDO A;  4XN0 A;  4BQO A;  3KEY A;  2KHM A;  3NWT A;  3I9V 2;  2VQC A;  1V5E A;  3PL8 A;  4RM2 A;  1LVK A;  3LSG A;  4RM3 A;  3C2G A;  2CFO A;  2M3A A;  4OAY A;  2W4S A;  4LG3 A;  3K70 C;  1NG7 A;  3PFY A;  3OYJ A;  1NG6 A;  2WBM A;  3H9Q A;  3K4K A;  5CPR B;  1MMA A;  3MMY B;  2GOX B;  2Q1Z B;  1D1C A;  1PJR A;  4P1W A;  3LSI A;  1OLT A;  2Z2S B;  3M8J A;  4CCK A;  3W3C A;  3CP2 A;  2HDW A;  4XLC A;  4E7K A;  1W36 C;  2MYS A;  3SEQ A;  2LG4 A;  2BOL A;  4XKC A;  3DPU A;  4BE0 A;  2JVH A;  1ERD A;  2KP6 A;  4BQN A;  2W1O A;  3E0J B;  3OYI A;  3KYL A;  2CS3 A;  3H9J A;  1D1B A;  4FAS D;  3D5S C;  3HL2 A;  4KIS A;  2DJI A;  2HVR A;  4BJ6 C;  3LSH A;  2HQA A;  2AQF A;  3OYA A;  3BG6 A;  4PJN A;  3VDX A;  1U0J A;  4QPQ A;  3HPG A;  3OS0 A;  3BCB A;  4C2T A;  3QYB A;  2L9N A;  2OUM A;  2R7W A;  4CA0 A;  2ZFU A;  5LD2 C;  1EA3 A;  2JSP A;  3HUG B;  4PFP A;  3OS2 A;  2WAF A;  3F9K A;  2IS1 A;  1IRX A;  2CUJ A;  3W2V A;  3C2H A;  2BW3 B;  3EUA A;  3OYC A;  4CCO A;  3BC8 A;  1WJD A;  4NC8 A;  4CCL A;  4LIU A;  4BS9 A;  4CCJ A;  4YRV A;  1WJE A;  3CES A;  2XDV A;  3OYE A;  3DU5 A;  2CUZ A;  2DCE A;  4ZTJ A;  3OYK A;  3H9G A;  2A6T A;  4U7B A;  2V4J C;  2LH9 A;  3CJQ B;  3OL3 A;  2IS4 A;  2UWM A;  3H35 A;  3QOE A;  4C30 A;  4IZZ A;  2HZD A;  2K9L A;  2WAD A;  4ZDL A;  3W2W A;  1MMN A;  1SFK A;  4HSR A;  2E5Z A;  3S3M A;  2DXI A;  2WA0 A;  4XL9 A;  1V5F A;  3PSF A;  4E7L A;  1N75 A;  2ELJ A;  4MLO A;  4PJM A;  2VAS A;  2RQQ A;  3ZR8 X;  3DKY A;  2LOO A;  4CSW A;  3HC7 A;  3ZXS A;  4ZYA A;  1QU3 A;  2LBF B;  3OIQ A;  2LY2 A;  2CW8 A;  2KQR A;  3H0D A;  4DBQ A;  4II3 A;  4F3Q A;  3ZQQ A;  4KT6 A;  4XOT A;  2VQH A;  3LL7 A;  3MKW B;  1X1D A;  4ITV A;  2XSJ C;  3L2V A;  1S9H A;  1BR4 A;  4G6T B;  2CV0 A;  1TZL A;  2XF6 A;  3OYH A;  2X1E A;  4XR6 A;  3LFU A;  2IXS A;  2LY1 A;  1WJF A;  2Q2E B;  3EUK L;  4IKF A;  2X6W A;  2MC4 A;  3TMO A;  4BAC A;  2HVS A;  3J7A Y;  2ZXI A;  3FHN A;  4BEH B;  3FDY A;  1D0Y A;  4PK4 A;  1N77 A;  3QYE A;  2R7Q A;  2HPI A;  2WAE A;  3D5L A;  3HG9 A;  4XOR A;  4OAZ A;  3OS1 A;  2W00 A;  1WJC A;  1LDK B;  4PJJ A;  4BGD A;  2VXZ A;  2L9S A;  2VJ4 A;  1GLN A;  4RLQ A;  1DGR M;  2R7S A;  2JUG A;  2KPM A;  2LBF A;  5FRO A;  2JA2 A;  2E1M C;  5KNL A;  1OR7 C;  3BCA A;  4XMY A;  4BU2 A;  3H5A A;  4NUB A;  2M4G A;  2XF7 A;  3TBI A;  3EPZ A;  3AL0 B;  1DGW Y;  4X0G A;  3PSI A;  3DU6 A;  4RLF A;  3K4N A;  3L2W A;  2M7A A;  2P0W A;  4C9Y A;  3M1C A;  2F6C A;  4HST A;  1PYV A;  2KZV A;  2M0M A;  5HVQ C;  2RNG A;  3MD2 A;  3OIP A;  4NC7 A;  4E7H A;  1J09 A;  2BVL A;  1TT0 A;  3EUH C;  3CJR B;  5LFA A;  3L2Q A;  4BJT A;  1YE9 A;  4BDZ A;  3IUO A;  3VYS B;  2LC2 A;  3ONQ A;  3OYL A;  3A2K A;  3TL4 X;  2XAU A;  3KX2 A;  4HPQ A;  4CZC A;  2AQE A;  3LMM A;  2XF5 A;  2WY8 Q;  4AU7 A;  1Y56 A;  5HNH A;  1G59 A;  2IS2 A;  4XLF A;  1WJB A;  1FMW A;  4LIT A;  2UUZ A;  5TGT A;  1Z7L A;  3IAS 2;  2IGK A;  3DQV C;  3PJR A;  1UEL B;  1X4P A;  4ZTF A;  2R7O A;  1W36 D;  5CQG A;  3GBG A;  3HXL A;  2CW7 A;  2KLO A;  3K70 D;  2I8D A;  3K10 A;  2ZSI B;  4PSW A;  1MW7 A;  2CMP A;  4NQW B;  2V9K A;  2VB6 A;  4BL0 B;  3DTK A;  2MD0 A;  2OV7 A;  4ZDO A;  1DQU A;  3IP4 B;  1MMG A;  2V7F A;  4JOM A;  2W7N A;  4BE1 A;  3K4J A;  3VSK A;  3VYT B;  4HNT A;  1T0F C;  3OYD A;  5CKT A;  3W2A A;  3H5N A;  1V5G A;  1DP3 A;  4BJ5 C;  1UAA A;  3OYM A;  4JQF A;  1D1A A;  2L2O A;  2L7K A;  4RMN A;  4ANJ A;  5KHD A;  1X1B A;  4E6K G;  1QHH D;  1HA8 A;  4YEJ A;  2O5R A;  1X4O A;  2KMU A;  3V42 A;  4HNU A;  3PUB A;  3OR1 C;  1D0X A;  4XOP A;  4HEA 2;  4E7I A;  3LSM A;  3RQ4 A;  1YX3 A;  1UG0 A;  1BR1 A;  4Y4R A;  3SDB A;  2V1N A;  3H5R A;  4YEL A;  2K5C A;  3AL0 C;  1WJ5 A;  1BOB A;  2KL4 A;  5HNF A;  3VYR B;  3OMY A;  3S8P A;  1QHG A;  1WFX A;  3DKX A;  1MND A;  3NWS A;  4PFO A;  4B44 A;  4BDY A;  2PJR A;  2E1M B;  2X6Y A;  3AKZ A;  3RTR A;  1MMD A;  1P9Q C;  5FRM A;  4D9J A;  2HVQ A;  2E5N A;  2K9M A;  2R7X A;  3VWB A;  3MKY B;  3ZRG A;  3HOS A;  2OC6 A;  4AYB A;  3K4M A;  2VIX A;  2PJR B;  4KIT B;  4N4N B;  4CCN A;  3MKZ A;  2X1D A;  1G8X A;  4DGW B;  1SAU A;  4DIQ A;  3RPU D;  2VKD A;  5CQE A;  5JHF A;  1JI8 A;  2HU9 A;  4HRI A;  4E7S A;  3S3O A;  4ZDP A;  2X6X A;  3SZG A;  3A4C A;  3LSK A;  4HG2 A;  3BG7 A;  4OWR B;  4IQ4 A;  2V26 A;  3SEZ A;  4C2U A;  4E4H A;  3VYU B;  2LYC A;  4F93 B;  1D0Z A;  3VSL A;  5FRN A;  1LKX A;  2VL8 A;  5HOO A;  3OR2 C;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...