2M4KA

Solution structure of the delta subunit of rna polymerase from bacillus subtilis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Study of the Partially Disordered Full-Length delta Subunit of RNA Polymerase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit delta
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4kA00
4NC7A 2M4KA 2KRCA 4NC8A
chains in the Genus database with same CATH superfamily
5DM7F 4D7NA 1AA7A 2J5OA 1NK2P 1SEUA 5CKTA 2CUEA 2JPCA 2X6WA 1T0FC 3MCZA 1KU9A 2HPIA 3U1KA 3OOPA 1R1TA 1OYWA 3E0JB 2XF6A 2XB5A 3GFJA 1IDYA 1MKMA 3I4NJ 2AQFA 1G6NA 2CYYA 2FU4A 4LLNA 3SDGA 2CRGA 4GCVA 3OYGA 2CMPA 2DOAA 3PL8A 2CFOA 2ME6A 3S1QJ 3PQKA 1XPXA 4Y52J 5J8FA 2VASA 1O4XA 1XSXA 2CV2A 2O8XA 4N4OB 5E3MA 2DFFA 1LUJB 4NQWB 2HOTA 2JUGA 3IUOA 4EJVA 1I50J 4OIOF 3DPTA 1IUFA 5K7ZA 1JT6A 2EINH 1MJBA 1TWCJ 3FMQA 1HKTA 1OCZH 3DFGA 3SYTA 3GO5A 3CD6I 1QA6A 5CVUA 3QOPA 4O6JA 2A3SA 3V8KA 1H89C 1S3JA 3RQIA 1FTZA 1R4NB 2ZMEC 1B6AA 2HXOA 3BZCA 1B9NA 1TNSA 3KLNA 1TTYA 4NBQA 1YRNB 2D1VA 3I4MJ 5DUKA 1V3FA 3CMEI 3BG6A 1FNNA 4DBRA 4NB5A 2EWNA 2XAFA 1GV5A 1D1BA 4ABZA 3B02A 4DZPA 1ZRFA 4OIPF 1HDDC 1FIPA 1SD4A 3FF5A 3S3NA 1Z77A 1SVMA 2HR3A 2UWMA 3SZPA 1DGRM 2ADUA 2QVOA 3CCMI 2VODA 1QHHD 3HOVJ 2K86A 2OUMA 3H3UA 2M1BA 4QPOA 3SFZA 5F64A 4B3AA 3WU1B 5F0CA 4I0BA 4S04A 1R6RA 4HLYA 5H2FC 3Q9SA 4ESBA 4G6DA 2HFHA 5B5EC 3ZR8X 1IGNA 4KT6A 5F08A 2ETHA 1TW3A 3SZGA 5FO5A 4BAYA 2ZXJA 4EGZA 2OTJI 1BIBA 1T39A 2DQLA 2JVGA 4IHVA 1LEAA 2DW4A 2YSRA 3FXQA 3GUDA 3FXLA 2FXAA 2R0QC 1V5EA 1G3WA 1Z3XA 2DJNA 1TT5B 4AVZA 4CA0A 3MEXA 2IGOA 2XF5A 2FBHA 3CLQA 4NQWA 2RREA 2PLYA 3EUHA 3OYHA 2K3PA 3CCEI 1WJCA 4BL0B 4XKCA 5B3SH 4KN4X 2XB0X 4M9SA 4DIQA 2L0KA 2ACJA 5DCMA 4MFDA 2G9WA 1JGSA 4D0PA 3VWBA 3BR2A 4QTRA 2R7ZJ 3U2RA 3T0YA 1R7JA 3ZMZA 1MMNA 1T33A 5HODA 4JQFA 2LYCA 5HVQC 1MBKA 5IY5H 2AHQA 4FT8A 1J9IA 3BTCA 2E60A 2IW5A 1WJAA 2H1KA 1DPRA 1IW7F 2IP2A 3HM5A 4MQVA 1S72I 4I2OA 5FGMA 1FBSA 2STWA 4JX4A 3V8JA 5IYCJ 3L9FA 1S29A 2VOPA 3E6DA 1IRGA 5LEKA 1GDTA 2ZBKA 3FKIJ 2M3AA 1YO5C 2E7XA 2HOAA 2DXIA 4C2UA 4XORA 1YI2I 2EFQA 4IKFA 2HDWA 5TRDA 4L5JA 1K4SA 2YPRA 4J19A 3FHNA 3A01A 3GWZA 5HNFA 1KU2A 2LKPA 2X0LA 2XRLA 1UZCA 1TP4A 1D5VA 2KZVA 3J81K 1I1SA 5JLXA 4A3IJ 5LRSA 3HDDA 2WV1A 4P55A 4ETSA 2FA5A 4BJ5C 3E6CC 3HOYJ 1DU6A 5FKNA 3C2HA 3CTAA 3RZOJ 3V7SA 1FYMA 2F5VA 4MHGA 4C9YA 1JKPC 3GMEA 4UVCA 2ID6A 1F4KA 2IT0A 4NHJA 1XG1A 1K79A 1MMDA 5ICFA 3BROA 1RIOH 2EFNA 2XAJA 1A35A 4Y17A 2R5YB 2LR8A 2L2OA 2IGMA 1OCOH 1Q1HA 1XGMA 4YELA 4M6XA 3KETA 1QU3A 3D0SA 3QYBA 2P6SA 2CU7A 2JA8J 4A3FJ 2R7QA 3S1NJ 2M34A 2Z33A 4PFPA 1UHMA 2O5RA 2DMNA 2M8GX 3DQVC 4DGWB 3WE3A 2J5PA 3DKYA 3F0CA 4Z6YA 5EGOB 4A93J 3BG9A 2L4AA 1ONVA 4EM2A 3RJPA 3WTSC 2H6CA 4WXDA 3EUAA 3FXMA 4UUTA 2XVCA 2R7WA 3CUOA 2M9HA 2LF7A 5E18F 1A04A 5ICGA 1BR2A 1I5ZA 3DKXA 2PFBA 4RB2C 5F1JA 1K78B 4XK4A 5CVIA 5KVRA 1TQPA 1XDSA 4HQEA 1YX5A 4XSXF 5IOZA 1QGPA 5B66C 3ABMH 3HOXJ 2DMQA 2VKHA 3TO7A 3CO7C 1YTYA 1IN5A 1WH5A 3BR0A 5LD2C 1J0RA 1AKHB 1S7OA 1Y0NA 2X6XA 2K9SA 2IA1A 4V19K 1N25A 1RESA 2KRHA 5DV5A 1ETQA 1JTXA 5F1RA 3WHCA 3PUBA 4YIIA 2E1MC 2NVTJ 4EEFG 1UCRA 1RC9A 4U88A 2HQAA 4OAZA 3BG3A 3LAPA 2HXIA 4HX7A 3BOQA 3FK6A 4ENMA 2H94A 2HOEA 1D8KA 2KZGA 3ZQLA 5EYRA 3CCYA 2WB1A 5JVTA 5IOYA 2E1NA 4E6KG 1LJ9A 1EKEA 4LLGF 4RGSA 2LLKA 3BY6A 2FJ1A 3CJQB 2PI0A 3GTQJ 2M45A 4ZH4F 2COBA 1MH3A 5H6RA 5TJJA 1T8IA 1IN7A 2MFZA 1X2NA 3TOBA 3S32A 3N4MA 3CJTB 4IXAA 4ON0A 2CW0F 3GFIA 1J75A 4Z2YA 2M0CA 4Y4RA 2JA7J 2IS2A 2V1DA 3JRFA 4B3XA 4IZZA 3DXJF 1WGXA 1XSDA 3IAS2 1XMXA 1ZRDA 4IRGA 4C30A 1YW7A 5E1ZB 3R4KA 2PJRA 4CCLA 1BW6A 1X4OA 4BDZA 2FD5A 2PMZN 3RPQA 3SFIA 3A2KA 1B9MA 3GLXA 2WTEA 3SQNA 3C18A 4CCKA 1G3YA 1AU7A 2E35A 2H6BA 2AS5F 4DNCA 2D1HA 3FISA 5DUIA 3RYRA 4L9TA 3DEWA 1A6QA 2XRNA 3CCRI 4EJOA 2GOXB 5A2QZ 1VQPI 1W36D 1XN7A 4E7IA 1IRXA 1T2KA 2VQLA 1Y6IA 3K4BA 2G7HA 2DMTA 2E1OA 2GAUA 2EIJH 2V6EA 1RUOA 1GXQA 5ICCA 1JJ8C 1FOXA 4ZYAA 2GBYA 2OZUA 3B6CA 1FY7A 3FMRA 2F5EA 3KEYA 2EZLA 3K2ZA 2BYVE 3T8RA 1Z9CA 1NK3P 1MSFC 2TDXA 3MVPA 3PNYA 4RLFA 3HYIA 2KPMA 3HIFA 5GTIC 3QPLA 1TQIA 3A1YA 4A3LJ 4PUSA 3QPSA 3MFKA 3O6BB 1RRJA 3JRGA 2EA2A 1W5TA 5EJCA 5C4JJ 5GAEJ 3DV8A 3OS0A 2CWEA 3S2HJ 1FLIA 2FBIA 2LP0A 3OYNA 3DLLF 2RNJA 3QP6A 2HGCA 2PN6A 2VBZA 1R71A 1WQ2A 1WJFA 1ZH5A 2R7DA 4B8XA 4BEHA 5J4YA 4LB5A 5EEGA 3W6JB 4CYCA 2K9QA 1TL8A 3LNQA 2KT0A 4IHXA 1SMTA 4AWXB 1TBXA 4HX8A 3KP3A 3TBIA 1T38A 3U21A 1GLNA 2K5CA 4A6DA 1C0WA 2M0MA 1VQ4I 2XGXA 2IS6A 2EPFA 1MMAA 3W2WA 2YUSA 3RZDJ 5DCMB 5E3OA 1Z6TA 2NS8A 1TC3C 2JRTA 2Y2ZA 2IRFG 1ZTRA 3RKQA 3GZNB 4PSWA 3G2BA 1RUNA 4BJTA 4HX4A 3S17J 3S3OA 1YLFA 1XDUA 3SDBA 3OYAA 2HVQA 4MQ9F 2YS9A 1W4MA 3BJOA 4BNCA 1FZPB 2XAQA 3MZYA 1H88C 5J1UA 1R1UA 5HLGA 3MAJA 5E1XA 3WODF 4XONA 1Y0UA 1S8NA 4V2FA 3R60A 3G1MA 1VZ0A 3WTUC 2BW3A 4XLFA 1Z91A 1U5TC 4MIMA 2ZFUA 1YW8A 2P4WA 1HF0A 3AL0C 3W6VA 1X1PA 3DLAA 1HW1A 4A0YA 3TEDA 3BPXA 5EDNA 4C3HJ 9ANTA 5K5OA 3K4MA 2Y30A 4D9JA 2VE9A 1JHHA 2HZDA 4U7DA 1A36A 3IHUA 5ILSA 1JUSA 3S8PA 2DPUA 3J80K 1UELB 4G7ZF 5C4XJ 1YE9A 1T98A 2CQ7A 3LSKA 2X85A 2JTVA 5D5XB 2PEXA 4HBLA 1F5TA 2Z5UA 4C2TA 1ETWA 2ZB9A 3OS1A 3JTHA 4RMNA 3IV5A 2ZJ2A 2VXZA 4UV9A 4F3QA 1FWZA 2LRDA 5IP9J 1OCRH 4KA4A 1D0XA 2VT2A 3LFUA 2VQGA 4IHTA 2MABA 4R1HA 4XKVA 4AIDA 2VC1A 5C3EJ 2B63J 1E0EA 4M73A 2GIVA 3BCBA 3ZRGA 1W7PD 4BH9A 2A6HF 2HU9A 3ASOH 1ZRCA 1QRYA 1XMAA 4RB0A 4EATA 4BBRJ 4CGZA 3GTMJ 1X4PA 3BWGA 1D5YA 1OISA 2V9KA 3ULQB 4FCYA 1I6XA 2X48A 4MEYF 3WG9A 2JMWA 1W0TA 2R5ZA 1B59A 1N77A 1BM9A 2Y75A 1UG2A 5FLXZ 4F55A 2EV6A 5F0FA 4CO8A 3OIQA 4E7KA 2M30A 4WX9A 1LB2A 1OYYA 3OYEA 2BY1A 3WE2A 1YFHA 1FP1D 2GZWA 1QVTA 1EV7A 1BR1A 3BPVA 2N8GA 2XV4S 4ZDOA 1YYVA 2ZFWA 1N78A 4IL6C 3I58A 5K5QA 4ZJZA 5EF6A 2JUCA 1D1AA 3ABKH 4YIRX 2R93J 2VONA 2LG4A 5LHGA 4WF2A 2QENA 5EGOA 3IKTA 3QRFF 3SEQA 1K6OA 3LFKA 5LLQA 1WJ5A 4NC8A 4BUPA 1JT0A 3MKYB 1JKQC 1KU7A 3ZMDA 1AHDP 1WJEA 6PAXA 3G71I 1S7AA 2JSCA 4RM3A 2V7FA 3I53A 3OYCA 2LBFA 2GA2A 2DN0A 3CMAI 4WK8F 4LMYA 5CVRA 4HQMA 1I39A 3AG3H 1QPMA 2LFBA 1IAWA 3WTVC 3JAMZ 1BL0A 3I59B 3HOSA 2QUFA 2CQKA 3AFHA 2V9VA 2QYOA 4ANJA 2LSOA 2P0WA 4MTDA 2DLLA 3H36A 1R5ID 1IF1A 1TQMA 3H1CA 1X1CA 2GXAA 2DO7A 2GXBA 3OYBA 3KLOA 1SFXA 3D1NI 3L7WA 1FC3A 4B4CA 1WFXA 2ESHA 1O3QA 5E79C 2YR2A 3CCQI 2PMZA 1USSA 2MGQA 1NHAA 2E5ZA 1UAAA 1HCRA 4UXNA 1X2MA 1KQ0A 1XTAA 3HTUA 1VQKI 1RR8C 1FP2A 2NS7A 2RNGA 4C2MJ 4XL9A 3WGIA 2O61A 3TW7A 1TWFJ 4G6QA 1L0OC 2M4KA 1Y1WJ 3BTIA 1EH7A 4BJ6C 5M5YJ 2Y9YA 1P9QC 1J09A 2ZXHA 5J1RA 3VEPA 2JA5J 1Y8RB 3KP2A 1VQMI 1B8IB 5CQGA 2OQRA 2P7VB 4XKWA 1B72B 4HEA2 3PO2J 2CO5A 1Z0XA 2RQQA 1WVRA 4A3BJ 1QNTA 4U87A 1PP8F 1V55H 4N4NB 1FYKA 1FOWA 3OYFA 3H5AA 1RETA 1ETVA 3CDLA 1HKQA 2JT1A 4F92B 3L2RA 2IA2A 2R7OA 1V54H 1U3EM 2DA6A 2FSWA 3IH4A 3KYLA 2HQRA 4EJWA 2L54A 2OAZA 4LOCA 3O2PE 5H6QA 3GLLA 4UY8I 4Y33A 3VSLA 3OYMA 3V7CA 3AG1H 1ZGWA 1FPQA 1LKXA 2G0EA 5E1WA 4IQJA 4LGWA 1VQNI 2P5LC 4EGYA 4ZYHA 5BS6A 2HVSA 1ETXA 2IBDA 3FKJA 2G7UA 1YW9A 3FM3A 2OCCH 3FMSA 4Y7NJ 1BI2A 3KX2A 1ULYA 4IQ4A 2MD5A 4Q47A 2FNPA 1JI8A 1ZR2A 3IAM2 1IV8A 1QQIA 3RYPA 5D6EA 2LD5A 3CJRB 2HTSA 2BXZA 3K4CA 2UXNA 3PFIA 4A0XA 1D0ZA 4CZCA 3ISPA 1O3SA 1YJWI 3A02A 1EJ9A 1VI0A 5DEQA 1NG7A 1XGSA 2BHZA 1PJRA 2LF8A 3LQQA 1U8BA 2XPVA 4I98B 3S1MJ 4I0AA 2GQQA 2EZHA 3K9TA 5CJ9A 3IC7A 3KIOA 2OTLI 4QSHA 2EV0A 1SAXA 2V9PA 4RAFA 3ZQCA 2BXYA 3HGYA 4MO7A 1HC8A 3EPZA 3RPUD 1GVJA 5BMZA 2EILH 3UNGC 3RQ4A 2Q1ZB 5CYVA 5DD8A 3M8EA 1VQ5I 1HA8A 3LSGA 3PSIA 2BW3B 3P5JA 4PJLA 2R7TA 3SHFA 1XMKA 2XUBA 3IP4B 4M6VA 2VJ5A 4EV0A 1PUEE 3J7ZI 3BTLA 2OPTA 2EV5A 2IXSA 2R3SA 5TISC 5GP9A 3ECHA 2YU3A 1YS7A 1U5TA 5D6FA 1LFPA 3FX3A 3KZYA 1ITYA 1R5GA 5D4SA 4PJMA 2Q2EB 1WZ2A 2NNYA 4IO9F 4L0ZB 2R4GA 1FMWA 2CQQA 3L00A 3AG2H 3GVAA 4BXFA 4BDYA 3ECOA 1ON2A 4RAGA 1PP7U 3GCMA 4KDPA 1ETOA 5EZHA 3CF5F 3DTIA 4F7ZA 5L3DA 4ZTJA 5LFAA 1R5HA 4L5IA 4IOCF 1LFBA 5L3BA 5EG0B 3H3ZA 4IEJA 5CLSA 4RB1A 2VPLA 3HRSA 3Q3SA 3Q5FA 4OIQF 1MIJA 2WA0A 1KYWA 1MNEA 4ZYEA 4KIFA 2DAOA 1W0UA 3ABTA 4UUSA 4BHCA 3E6MA 2IPQX 3COAC 3H35A 3HRTA 1D8JA 2M7AA 3H5NA 2ECBA 3BR5A 3J81Z 2Q2EA 4KNYA 4U0VA 1NG6A 4FQGA 4E7LA 4UUVA 3QYFA 1KZHA 2GOMA 2QM3A 4XBFA 3DU6A 1XX5A 5LBQA 2V79A 3CDHA 1GHCA 3HPGA 1SD5A 3CC7I 3JRDA 3LQRA 3QU3A 5D4RA 1H0MA 2H8WA 3FIWA 4A0ZA 3R0JA 1MMGA 1SFEA 1CQTA 2MG4A 3M8JA 3VYRB 1R00A 5ILVA 3CC2I 2OQGA 3I71A 4I76A 4CXFA 1G4DA 3DEEA 1JTYA 4GXOA 2OBPA 5GPCA 2MSYA 2VI6A 3ERED 1FJLA 3QU6A 3UR3C 1QO0D 3FBIB 4X6AJ 3C1DA 3K70C 3LA2A 2RDPA 1F1ZA 3Q0VA 3L2QA 4JX6A 1JKRC 2HI3A 2VL8A 5HLHA 1LE8A 3R6SA 5HS8A 2A69F 3S15J 4DYQA 3WGHA 5IP6A 1IC8A 4AUXA 1FT9A 4Y3OA 2VLAA 2PMHA 4FX0A 4KITB 5BOXA 4K2EA 2CFXA 1IRZA 5FFZA 4FTHA 1YIJI 2JN6A 3J7AO 3BT9A 1HLVA 4FASD 2EJRA 3ESWB 3IWZA 3GTJJ 4CDGA 4A3KJ 5DCFA 2ZXIA 1R23A 4AU7A 3OSGA 5DYMA 2P7CB 4UB8C 3K7AJ 1X19A 2E7WA 1J2XA 2JWTA 1XCBA 2L7FP 3E6BA 1QZEA 3LSHA 2B0LA 3QAHA 1I27A 2O03A 4X0GA 1NH3A 5KK1A 4IOAF 3W6KB 2KLOA 3LA7A 2JRMA 2NVUB 2D45A 4L9NA 2H8RA 1XC5A 1VTNC 2OZ6A 5ERIA 5JLWA 2WB1N 1VQ9I 1IV6A 5EEAA 5KAFC 3LOCA 3K1MA 3L2CA 4BXXJ 1G2HA 4XMYA 3BQYA 1STZA 4B44A 3HC7A 3HUGB 1FBQA 2DA4A 4PK4A 3DPUA 2W25A 1KU3A 2WY7Q 4MLOA 2LBFB 5DS9A 1JXSA 3KEQA 5FD5A 4CSWA 3HHHA 1IXSB 4XIDA 2JJ7A 3DTKA 1T0FA 3G1LA 3I4PA 2F5DA 1JUPA 1RKTA 1H9TA 2WBMA 3MMYB 1P6RA 3TO9A 3VOEA 4F93B 2DA5A 3FM5A 3K2AA 4OU0A 2DMUA 2KQRA 4RA2A 5BQTA 4A3DJ 4IHWA 3JREA 1U2WA 3L2UA 3BQZA 5EEHA 3FHZA 3JR9A 3X2QH 1ON1A 2W85A 2RV8A 1GUUA 3GZ5A 3D5RC 4FETA 4E7HA 2L9RA 1WWXA 2CV1A 4R79A 2XSDC 5ILUA 2NRAC 1IN8A 2R7VA 2DDBA 3CMMA 3S16J 2DCEA 1ZLJA 2M4GA 1HW5A 1LVAA 1KONA 1DU0A 4IRHA 4PGHA 1IN6A 3F8FA 2BV6A 5HLIA 2PBIA 1X3WB 4EQQA 2WV0A 1BJAA 1F9NA 2DU9A 2LVSA 4F52A 1D0YA 5D8LB 2VQCA 4N9HA 3F6VA 1P4XA 5H20A 1SFUA 2K27A 1WPKA 1XCVA 3KP4A 5F0HA 4HZFA 1FYLA 2C6YA 2RGVA 3BR6A 4E70A 1OCCH 4X1EA 4Y13A 2DFIA 3EUKL 3JRAA 1S9HA 4RB3C 1TW2A 3BP8A 3P9CA 2XIGA 2HOSA 4IF4A 1YJ9I 3IH2A 1R58A 1T6SA 5LGTA 1HDPA 2ELJA 1OQYA 1F43A 1S5LC 3DBLB 4KYWA 4ZYGA 4B43A 3JRHA 4Q5SF 1ODDA 2R7FA 2LKXA 3VPRA 3KPHA 5CPRB 4XN0A 2QSGX 3PSFA 5B1BH 3ZQGA 4ZYDA 2NOGA 4I01A 4G12A 2W48A 3ZQ7A 2KFDA 3A03A 4L18B 3BZ6A 1JUMA 2ESNA 4PJJA 1MSEC 5F6FA 1SMYF 3K4KA 2ZSIB 2F5FA 5ICEA 4KIGA 2DODA 2QQAA 4UNOA 2PX9A 4BYYA 4OMZA 2WADA 2LDUA 5FB2A 3OIOA 2ZXWH 2DT5A 1UMQA 3R61A 4AYBN 4BE1A 3LSTA 4OWRB 2KIQA 3GTPJ 3C2GA 3WTTC 4MTEA 1UHSA 2QCOA 3PNTA 4WXHA 3OR2C 2ZJRF 4C3IJ 4BY7J 1G59A 2HQ5A 1U5TB 4KJZA 3LMMA 5C44J 3PFYA 3OIPA 2IJLA 4XN3A 1BC8C 2X9DA 4JOMA 5L3CA 4IX7A 2DT7B 2Z2SB 3IWFA 1OMIA 4XOPA 1WJDA 4ESFA 3HSRA 1WJBA 4AIKA 1XGOA 3K6GA 3H5RA 1BA5A 1WHUA 2CH0A 5DD4A 1EH6A 2X51A 3T8TA 2XAGA 4KICA 2IVMA 3GXOA 2JSPA 3CZ6A 1OCPA 3FBNB 1O57A 2HNHA 3FWEA 1P4AA 2DOEA 2QZ8A 4O5VA 3G4SI 1FIAA 2L01A 1ZN2A 2ICWG 3QPHA 3NAUA 2BE5F 2DI3A 5FLMJ 2ELKA 3WTYC 1DP3A 2LY1A 1BJZA 4YEJA 4BEHB 5HS7A 1P7JA 3EQLF 2IEKA 4RS8A 2DT6A 1I6HJ 1QPIA 3QOEA 2DK8A 1W36C 5FKOA 1HKSA 1MNDA 5HDGA 2VBWA 4P96A 5J8CA 4GDFA 4LIUA 3ROUA 3IRRA 2VJIA 1HBXG 1MJ9A 3PM1A 4LJZF 4W97A 5CQEA 1PVEA 4CYDA 2RN7A 3K70D 5FRNA 1BI3A 2NS0A 2O3FA 3OSFA 1SFOJ 3DP7A 2UZKA 3DTEA 4RLQA 3A0HC 4HNTA 3DCFA 3HSEA 1SVOA 5J4VA 1YX3A 3RKYA 3D5LA 3VYUB 1EA3A 2KJBA 3EDPA 3B6AA 2HWVA 5LGNA 3N97A 2KRFA 1VFCA 5L3GA 3ZQFA 1ZKGA 1TWHJ 5J6XA 1OYIA 3CQZJ 1I3QJ 3K4NA 1HSJA 3OV8A 4DYRA 1E3HA 1W7PA 3TOAA 2HS5A 1DP7P 2DFHA 1PYVA 2M8EA 2V6CA 5JHUA 4LK1F 2W00A 3FXJA 1HQCA 1XD7A 3TP0A 1AKHA 1UJ8A 1VQLI 2NVQJ 3A4CA 4L9JA 1MBGA 4ZZLA 2FE3A 4BE2A 4PJNA 2E2IJ 2X6YA 2VC0A 1X1AA 3NWSA 4XRSG 4MFEA 1VNDA 3CP8A 3I3LA 4OOIA 2VKEA 2GM4A 4L5EA 5FLVA 3O8GA 2P6TA 3P9IA 4AVPA 1OR7A 3CUQC 4CHUA 2F5CA 4HV5A 2ISZA 3ZQQA 3PIOF 3O8HA 2ELHA 5L3FA 2F6CA 3DWLE 5DM6F 3TQNA 1Z7UA 2FOWA 3BC8A 1W5CC 2FBKA 1G3TA 4BU2A 2R7XA 2RC4A 3W3CA 3H9GA 4TV7A 1NTCA 2K40A 3GX4X 4A3MJ 3FXOA 1TWGJ 1Z1DA 1YG2A 2YX7A 4HAMA 1U0JA 4CH7A 3M4OJ 3GYHX 2L4MA 1V5FA 2K9LA 3GF2A 1Z7LA 3ZQIA 4A3JJ 2R5ZB 2KDOA 2VB6A 1SD6A 3HOTA 4ZDPA 3BR1A 3VODA 2QQ9A 1LDJA 2XGDA 3F8CA 2R5YA 1WSUA 4BQAA 3TKYA 2CUJA 1SD7A 2E71A 3OY9A 1HW2A 4LIVA 4CUGA 3ZCOA 2QGUA 4D1QA 1PDNC 2DA3A 2ZMEB 1LPQA 4DYCA 1XS9A 2L02A 3RTRA 3JSOA 1RI7A 2A5YB 2DYRH 1LQ1A 3TMOA 4DOZA 4LLLA 5BPIA 4LD5A 4L0YB 3HOZJ 1O7FA 1OKRA 4A12A 3IRQA 3K10A 3SJMA 2KL4A 2VN2A 2WAEA 2XPWA 2NVXJ 2Y31A 3L09A 2KMUA 5JHFA 2CGPA 2EA4A 4DZJA 2HEOA 2OD5A 4PCQA 3BCAA 1WI3A 4XNFA 2LY2A 2PG4A 3ZMTA 2DPDA 3GEZA 3RIRA 3HPHA 2L7KA 2VE8A 1DPUA 1IXCA 1X3UA 2E2JJ 2W7NA 2BZTA 3NARA 5JR3A 1MDMA 2P81A 4AIHA 3KP5A 3REOA 3CCSI 3HOUJ 2KIFA 2KKOA 3M9AA 5FKLA 5M3MJ 2MA3A 1B72A 2O9LA 3H0GJ 1YS6A 1VQ6I 1UHWA 2Y48A 1K83J 1EH8A 4XM3A 3V8LA 4BACA 1KQ9A 1U9NA 2ZO4A 4HSRA 4G8XA 4YFXF 3OYIA 1B8IA 2QBYA 5K5RA 3CESA 1YIOA 3BG5A 5DTDA 1LE8B 1GXPA 3BG7A 1ACIA 2O8KA 1PUFA 2BY2A 4HNUA 4ITVA 1L3LA 1M1EB 4XRMA 1MH4A 2ECCA 3S93A 3BTJA 4V2GA 3MKLA 5M5XJ 1TZLA 2MYSA 1DGWY 2UV1A 3F6OA 2X1DA 4HG2A 2EFPA 2LKSA 2EIKH 3EETA 1HOMA 1TLHB 2BY3A 2KP6A 2VJ4A 2E34A 2TCTA 2A05A 4XQFA 5IYBJ 4AC0A 1D1CA 1G3SA 1QZZA 3F21A 1SFKA 2QQBA 2TRTA 4Q48A 5HOOA 1FTTA 1T56A 4DW6A 4HPQA 4A6EA 1BN5A 3EYIA 1QZYA 3E5XA 2GLOA 2HYJA 3HBLA 4XR6A 3ASNH 4EVIA 5HLTA 4BE0A 4G7HF 2QBYB 1ENHA 2HDDA 2CQNA 5KAIC 3LA3A 2E1CA 2PJRB 4WWCA 4ENNA 4ZTFA 4ESJA 3OS2A 5J1YA 1TT0A 2MLKA 1HSTA 2W57A 3D5SC 2A6EF 1O3RA 3EUHC 1Z21A 1GVDA 2PQ8A 5E8GA 2K4BA 2WC2A 3DPLC 3P9KA 4UVBA 2QKLB 2ZSHB 4WXCA 4PDKA 1X58A 2WAQN 2XKPA 2Q8KA 4E4HA 1JKOC 4ZZDA 1W5SA 2DTZA 3BLYA 3OYDA 2OF7A 3F23A 2LK2A 4M3DA 2KRCA 3NWTA 2FF4A 1BR4A 4LFUA 5HDKA 4HV6A 4BS9A 1DUXC 1RR7A 1ZGJA 2DBBA 3SXYA 2XF7A 3ZGKA 4O3MA 3J7YJ 2JQ7A 2VIXA 1AWCA 4DJAA 2X4HA 3KCCA 2W1OA 2MLGA 4J01A 1MMSA 5D5VB 2CG4A 1TWAJ 1A6IA 1APLC 3FZVA 1ZG1A 5IT9K 3S2DJ 4D5CA 4XOTA 5D5UB 5AIQA 4RM2A 1ZLKA 2EIMH 1IG7A 3CJNA 2XAHA 5GAHJ 3GW2A 1MBJA 3JCUC 1ZG5A 3CDIA 5J3LA 2I8DA 2JZYA 2H1LA 3WGGA 2FMLA 5D5WB 4B1RA 1ETYA 2R7SA 5IT3A 2KIUA 4CCMA 2XASA 4NUBA 5HS9A 4A2UA 5LGUA 2VKVA 4DQ2A 4UHTA 1BC7C 2R7UA 2IGNA 2HVRA 3H9QA 5AONA 3OMYA 1TNTA 3HGGA 2NXNB 3TP3A 4IJAA 1H8AC 3CF2A 3WHBA 3H92A 3OL3A 3UKGA 2L7ZA 4IRIA 1Z05A 3A0BC 5HDNA 1ZHFA 2NNNA 2GIZA 4ENKA 4KN7X 4DBQA 4HF2A 4D5FA 3TGNA 1WCMJ 2D5VA 3IKVA 3U9GA 3K0LA 2CW8A 1WKMA 2CUZA 5AIPA 1SC7A 2LOOA 3PJRA 3KZIC 3CMYA 1FOKA 2E36A 4BHBA 5JI6A 2R7RA 2FQ3A 2HDCA 4M6YA 2XC7A 2Z3YA 2QWWA 3CCUI 5KCMA 1ORKA 1DQUA 1B1BA 4U0WA 2KJCA 3RKXA 3JRIA 3DEUA 2HYFA 1OPCA 2Q0OA 3DF8A 4HNVA 2K4JA 2MW8A 2XPUA 4A5NA 5ED4A 1T95A 3I55I 1K7AA 5LHIA 3T5XA 4RAYA 2Z9OA 4CYCB 4GGGA 2CQXA 3HOWJ 3KYCB 2DFEA 5HNHA 3CLOA 1USTA 4BQOA 5EG0A 2P5VA 2VT3A 3I59A 1P92A 3OWTA 1SVLA 5M3FJ 2D2WA 4M72A 1K4TA 4CCOA 3S3MA 3GTOJ 2Z16A 4XLEA 1BI0A 4RGUA 1GT0C 5GAGJ 4EJUA 3A01B 4AM3A 3QPTA 4KISA 2MC3A 2DYSH 2RAEA 4E7SA 3S1RJ 2P8TA 4KIBA 4I09A 3F3XA 1LNWA 4LG3A 4BHPA 4UUSB 2BVMA 3GFLA 2OJED 3VYSB 2KDZA 4LB6B 1ZREA 4IHYA 1I3AA 3PNVA 4M9ZA 4G9YA 2BGCA 3ZP5A 2O6GE 4IHSA 3WTZA 2MD0A 2MC4A 3AG4H 2JA2A 4PSXA 4ASNA 1ZR4A 3L2VA 3WTXC 4S05A 1IO2A 3WU0A 3AKZA 1R22A 5FKMA 2O7OA 2FUG2 3M07A 4I02A 3HSFA 1EF4A 1J5YA 2K9NA 2M7BA 4B47A 1DDNA 2R92J 2DOFA 2WWYA 2B7EA 3ABUA 3C2BA 4OIRF 1SAUA 3KFWX 3FXRA 3O3KA 4NNJA 4C3JJ 2NOJB 3FK7A 3WTWC 3Q9VA 1KYZA 3PO3J 4PJ0C 5KNLA 1MBEA 3HHGA 4YFNF 3L1PA 3EYYA 1VF9A 1KQ8A 2OCEA 3WG7H 1UFMA 1JGGA 1MNMC 4KT5C 1QHGA 1UB9A 5CVVA 2CJJA 5IT9Z 4BQQA 1K78A 4MNUA 1D3YA 3KE2A 2VUMJ 4A69C 1BIAA 3JSPA 2L7MP 3H0DA 4ZC3A 3OR1C 3OYJA 4GYIA 5B1AH 3VSKA 2XGCA 2W24A 3M7GA 4HOBA 2QKMB 2DA1A 5FROA 4EM1A 2HPMA 1K6YA 3S14J 4G6TB 2A68F 4CZZA 1LDDA 2A07F 2DK5A 4AD9A 4MEXF 5D8KB 2EFOA 4PZJA 1Z67A 2DTRA 2XAUA 2V1NA 2MBFA 2QSHX 2VKDA 3ZMVA 4RDUA 1BW5A 1Y1VJ 2KHMA 4RGRA 3ZN1A 2K85A 2FQ4A 2I10A 2QSFX 3E1SA 3MD2A 3LAJA 3W2VA 2DDAA 4GRIA 4XRSA 3GTLJ 4FE7A 4I7HA 2A5WA 1RPWA 4CCJA 5KHDA 1QVUA 5EZGA 3RKWA 3QQAA 1H9GA 3SEZA 1OFCX 4XICA 1YHQI 2A61A 1P7IA 3PIPF 4EMSA 2UUZA 4M3EA 4XKBA 3G6EI 3OL4A 2Y69H 2QQ8A 2RVCA 2QEXI 1AOYA 4UB6C 2RQPA 2VBXA 5GPAA 2FRHA 3OOUA 4E7ZA 3LWFA 5IPAA 2FEZA 2Z99A 2OA4A 2WY8Q 1FMVA 2EZIA 2K9MA 3ONQA 4M3FA 4N0BA 1XB4A 3GBGA 3I64A 4P1WA 2AXTC 3MQ0A 2X1EA 4H4KC 4F91B 4XRFA 4EJTA 4JYKA 3DU5A 5K1YA 2I5UA 4HLXA 3LSJA 4D7MA 1ERDA 3E7LA 1A5JA 2CUFA 4I6ZA 4HRIA 3GFMA 1ZAOA 3R0AA 1FBUA 1PUFB 3MZHA 2E1MB 2Y0SA 2DQRA 5GTHC 3H3VK 3ML6A 3VB2A 1MJAA 3WU2C 4KMUX 2VXDA 3M1EA 3AL0B 4BKXA 3CCVI 1MD0A 5FLXK 2O0YA 4XLAA 4Q4ZF 2ZCWA 5FKKA 4JK1X 5E20A 4B09A 5L3EA 3FXUA 4GYGA 4QIWN 3LSIA 5J47A 4G94A 3F8NA 5M5WJ 5JVGF 3BDDA 2M2EA 4J00A 4LITA 1WRJA 3LSPA 1BOAA 3J80Z 1IDZA 1S7EA 3S2WA 3CUQA 4GFBA 4NDLA 4XLHA 1MGTA 2EFWA 2FMYA 2BBYA 3E5UA 2EBIA 4HF1A 1ZELA 4HDVA 1LFUP 1G8XA 3K69A 1W7PB 2EZKA 3HJEA 3K4LA 3NRVA 1OR7C 3FDYA 2F4MB 1R9TJ 2KIMA 1YQAA 3ABLH 3ERMA 1ETKA 2V4JC 2DA7A 4HYEA 2LTPA 2LC2A 4B48A 2M5WA 2IGKA 4M9XA 1YJNI 3V42A 5JFRA 2IAIA 3ZMUA 2BVLA 2ZMEA 4HSTA 2Z1DA 5DDGA 1B4AA 2VJJA 3HXLA 2EK5A 5J40A 2BOLA 3HG9A 1WI9A 3NQOA 5E3LA 2HYGD 2JVHA 1CGPA 4R8HA 3G1OA 1Q1VA 1P4WA 3H9JA 1RZ4A 3FXKA 2ZJPF 1I1GA 3L2WA 1F36A 3K1NA 4U0YA 3CCLI 1J59A 4IPAA 1U8RA 1O3TA 2IS4A 2YX4A 4M71A 3M8FA 4MGRA 2DMPA 1REPC 1FEXA 2K02A 1OJLA 4QLCU 3LSRA 2F48A 4OMYA 4XLNF 4KFCA 4CICA 1IRFA 3RCOA 3JTGA 1IN4A 3BZKA 4A3EJ 2BEOA 2HKOA 2F4IA 1KGSA 3KP7A 4BBSJ 3OYKA 3GTKJ 1OLTA 2ZNZA 4YRVA 3ZMSA 4A3GJ 4HF0A 1BI1A 4FX4A 2AXLA 2XHKA 4CCNA 2ZC2A 3NEUA 3T1BA 3TO6A 3HKZA 3MKZA 4YG2F 1Z3YA 1U6GA 1LEBA 3K1PA 2AQEA 4HA8A 3IL2A 3MZ8A 2FOKA 3HL2A 4H0EA 3Q0WA 2CV0A 2X1CA 1XGNA 3LSMA 5E17F 1IUYA 2KISA 3M3YJ 2GXGA 2LREA 1A31A 3HEFA 4Y15A 2L3DA 2MH9A 4BXUA 3M1CA 2M87A 3ZXSA 3ZN0A 1POGA 1MZBA 4AYBA 4AIJA 2L9NA 1YOVB 1U78A 2NVYJ 3E3VA 4II2A 3OYLA 1ZARA 1LVKA 3MKWB 4RGXA 3C3WA 4JBAA 1GV2A 2Y0SN 5BNGA 1E2XA 5GADJ 4NC7A 2F2EA 1VQOI 1N75A 1R49A 3DKWA 1E3PA 3HB9A 3VDXA 2IS1A 2WAQA 3JAMK 2VOOA 2JA6J 3W2AA 4ZDLA 2ZKZA 3BJAA 3E5QA 2STTA 2HTJA 2PMUA 1Y56A 2YU9J 2HKXA 2FX0A 2VQHA 3CO6C 2DA2A 4FE4A 1O7LA 3HUGA 2CS3A 3I9V2 4W1UA 2ZNYA 2XROA 4KMFA 1J7KA 3LL7A 2RKHA 3RI4A 2H27A 3B73A 3DBHB 1SANA 4XSZF 1ZGAA 3BR3A 3JW4A 3K4JA 4BGDA 2F4OB 5F27A 2FNAA 2ZJQF 4UVAA 1R36A 1VQ7I 2ME0A 2NAZA 2P5KA 3G73A 3RSNA 2VPRA 2EB7A 3HRMA 4I99C 2X6OA 1ZK8A 2GWRA 3G3ZA 5CVJA 2CSOA 1W1WE 1JHFA 4WCGA 1FSHA 1V5GA 2GA1A 2K3FA 3I5UA 4QPQA 4N9IA 4OINF 3CC4I 3QP5A 4S0HB 3KP6A 4BY1J 4HDUA 1OCTC 2PJPA 2QF7A 5LEJA 1KA8A 1FX7A 4IVNA 5F04A 4JX5A 2XKOA 3PQJA 3VYTB 2V1UA 3N05A 2H09A 3ELKA 1CF7A 4M3BA 4LG0B 4II3A 2JPBA 4FHTA 1Y8QB 2B9SA 3GTGJ 5K7HA 2HZTA 2ISYA 4KUMA 3F8MA 1V4RA 4PGGA 2Y0MA 2ID3A 2LMDA 2L9SA 2XSJC 3MWMA 5FFXA 4M3GA 4RBOA 1IXRC 2EQRA 3RPUA 1FSEA 3F9KA 1ZQ3P 1E17A 1X1DA 1Z6RA 1HXDA 1Y39A 3F8BA 2V1XA 4RAZA 3TW6A 1E3OC 1BOBA 4M74A 4A5MA 4YFKF 4G7OF 2L9VA 2OU2A 1JJ6C 5FRMA 1U9OA 2LNBA 3DBRB 1XSVA 3HRUA 2E2HJ 1K61A 3CCJI 3HKZN 2HQNA 5TGTA 1VQ8I 3ZPLA 1S6LA 1P2FA 5BPDA 2E19A 1X1BA 1RKWA 2WAFA 4OAYA 3I56I 3KEOA 3JRBA 3AAFA 4XLCA 5IYDJ 3KZZA 2K7LA 2UXXA 2JK3A 4GO1A 3QWLA 1LDKB 1T08B 1IJWC 4ENJA 4A3CJ 4UV8A 3IH3A 2BHYA 3PUFA 2COMA 2XDVA 2DJIA 1MW7A 3U1DA 5IP7J 2L5QA 3VFZA 1UG0A 1QBJA 3HTSB 4P9FA 3JRCA 2EH3A 5E3NA 1X3ZB 3ZOBA 3ZQHA 2OC6A 1JE8A 2QLZA 2AO9A 4JP0A 5LHHA 1MBFA 2W4SA 5FD6A 3QYEA 2Y9ZA 1YITI 3GZ6A 4E7JA 1WH7A 1IZ1A 3P7NA 4LK0F 3V7RA 1ZG3A 3CP2A 3Q0UA 3J7AY 3QODA 3HZJA 2CW7A 1CF7B 1YRNA 3MN2A 1MDMB 2E5NA 4HW0A 2IA0A 4PFOA 3I54A 4U7BA 4QWQA 2A6TA 4XLPF 1R4MB 3V4GA 4FISA 4P9UA 5K7FA 1BBYA 4LG0A 3RDIA 3SZTA 4L9VA 2QA4I 2MH2A 3E97A 4YIFA 1MBHA 2VBYA 2BY0A 3I0TA 2LH9A 3TDZC 3C7JA 2W82A 3TL4X 2OV7A 3BJ6A 4P5OA 4EM0B 4NC6A 1RNLA 2V26A 3F72A 1FOYA 3TDUC 2LY9A 2W84A 4BQNA 5FJ8J 3KYDB 3F22A 5E8IA 2XGEA 1ZYRF 1R1VA 2NYXA 3CUQB 5A2QK 5LRRA
chains in the Genus database with same CATH topology
4C2TA 3EUKL 1AA7A 1S9HA 3OS1A 4RMNA 5CKTA 2X6WA 5HNHA 1T0FC 2VXZA 4BQOA 2HPIA 4F3QA 2LRDA 3OWTA 1D0XA 3LFUA 2VQGA 3E0JB 2ELJA 2XF6A 2MABA 4CCOA 2AQFA 4B43A 4XKVA 3S3MA 2Z16A 3OYGA 1E0EA 4XLEA 2CMPA 2DOAA 3BCBA 3PL8A 2CFOA 5CPRB 3ZRGA 4XN0A 4KISA 2HU9A 4E7SA 3PSFA 2VASA 2CV2A 4EATA 4LG3A 4N4OB 1X4PA 2BVMA 4NQWB 2JUGA 3IUOA 3VYSB 3DPTA 2V9KA 3PNVA 4PJJA 3K4KA 2ZSIB 2MD0A 1N77A 2MC4A 3SYTA 4PSXA 2JA2A 4F55A 3L2VA 3OIQA 4E7KA 2WADA 3AKZA 2FUG2 3OYEA 4BE1A 4OWRB 1BR1A 2M7BA 4B47A 4ZDOA 3C2GA 1N78A 1SAUA 3PNTA 3OR2C 1G59A 3BG6A 4KJZA 4NNJA 4ZJZA 1D1AA 3LMMA 2NOJB 4DBRA 3PFYA 2LG4A 1D1BA 3OIPA 5KNLA 4XN3A 3SEQA 4JOMA 1WJ5A 4IX7A 4NC8A 2DT7B 2Z2SB 4BUPA 3MKYB 3S3NA 4XOPA 1WJDA 1WJBA 1WJEA 2UWMA 4RM3A 1QHGA 1DGRM 2V7FA 3OYCA 4BQQA 2LBFA 1QHHD 3K6GA 3H0DA 3H5RA 2OUMA 4QPOA 4ZC3A 3OR1C 1R6RA 2CH0A 3OYJA 3VSKA 2X51A 3ZR8X 2QKMB 5FROA 3HOSA 4KT6A 3SZGA 2HPMA 1K6YA 3AFHA 4G6TB 2JSPA 3CZ6A 4ANJA 3FBNB 2JVGA 2P0WA 2HNHA 2XAUA 2V1NA 1V5EA 2VKDA 1X1CA 1Z3XA 3OYBA 4AVZA 4CA0A 2IGOA 2XF5A 1DP3A 2KHMA 2LY1A 4YEJA 4BEHB 3E1SA 3MD2A 2RREA 3W2VA 1WFXA 4GRIA 2K3PA 3OYHA 1WJCA 2DT6A 2A5WA 4BL0B 4CCJA 3QOEA 5KHDA 4XKCA 3SEZA 1W36C 4DIQA 2PMZA 1MNDA 1UAAA 2E5ZA 3VWBA 4LIUA 2VJIA 2RNGA 2UUZA 4XL9A 4XKBA 5CQEA 3K70D 3OL4A 5FRNA 2M4KA 1MMNA 4BJ6C 4JQFA 2LYCA 5HVQC 1P9QC 3OOUA 1J09A 2E60A 4E7ZA 1WJAA 2ZXHA 5CQGA 4XKWA 3DTEA 4RLQA 2WY8Q 1FMVA 3ONQA 2K9MA 4HEA2 4HNTA 3GBGA 4P1WA 4F91B 2X1EA 4H4KC 2RQQA 1YX3A 4U87A 3D5LA 3DU5A 3VYUB 4N4NB 1EA3A 3OYFA 3H5AA 1ERDA 2M3AA 4C2UA 2DXIA 4XORA 4F92B 4HRIA 3L2RA 4IKFA 2HDWA 2R7OA 3K4NA 3FHNA 2E1MB 2Y0SA 5HNFA 3KYLA 2VXDA 1PYVA 3AL0B 2KZVA 2W00A 3A4CA 4XLAA 4Y33A 3VSLA 4BJ5C 3OYMA 3C2HA 1LKXA 3LSIA 4BE2A 4PJNA 2F5VA 4J00A 4IQJA 2X6YA 4LITA 4C9YA 3NWSA 1X1AA 2HVSA 4XLHA 3FKJA 3CP8A 3I3LA 3KX2A 4IQ4A 1MMDA 1JI8A 1ZELA 3IAM2 1G8XA 3CJRB 3K4CA 3ZQQA 4CZCA 1D0ZA 2L2OA 2IGMA 3K4LA 1OR7C 3FDYA 2F6CA 4YELA 3DWLE 1NG7A 1QU3A 1PJRA 3QYBA 2V4JC 3BC8A 2LC2A 4B48A 4BU2A 2R7XA 3W3CA 2IGKA 3H9GA 3V42A 2R7QA 2BVLA 4PFPA 2O5RA 4HSTA 3DQVC 4DGWB 2Z1DA 3HXLA 1U0JA 2VJJA 4CH7A 3DKYA 2BOLA 3HG9A 1V5FA 3EPZA 2K9LA 2JVHA 1Z7LA 3RPUD 3UNGC 3RQ4A 2Q1ZB 2KDOA 3EUAA 2VB6A 3H9JA 2R7WA 3HOTA 3L2WA 1HA8A 1BR2A 3DKXA 3LSGA 3PSIA 4ZDPA 2BW3B 4PJLA 2R7TA 2IS4A 2CUJA 3IP4B 1YX5A 2VJ5A 3OY9A 4LIVA 2VKHA 4CUGA 3ZCOA 4D1QA 3RCOA 5LD2C 2IXSA 2X6XA 3RTRA 2F4IA 1LFPA 2KRHA 3OYKA 1OLTA 4YRVA 4PJMA 2Q2EB 3TMOA 4DOZA 3PUBA 2E1MC 4CCNA 2R4GA 1FMWA 3K10A 2KL4A 2WAEA 2HQAA 3HKZA 3MKZA 2KMUA 4OAZA 4BXFA 5JHFA 1Z3YA 4BDYA 2AQEA 3HL2A 2CV0A 2X1CA 3LSMA 3BCAA 3DTIA 4XNFA 4ZTJA 2LY2A 5LFAA 2LREA 2WB1A 4E6KG 3M1CA 3HPHA 3ZXSA 2L7KA 2VPLA 4AYBA 2L9NA 2WA0A 3CJQB 2W7NA 1MNEA 4II2A 3OYLA 1LVKA 3MKWB 2MFZA 4NC7A 1N75A 3S32A 3H35A 2M7AA 3H5NA 3VDXA 4XM3A 2WAQA 2IS1A 4Y4RA 2IS2A 3W2AA 1NG6A 4ZDLA 4BACA 4E7LA 4B3XA 4IZZA 3QYFA 4HSRA 3IAS2 1Y56A 2GOMA 3OYIA 4C30A 2VQHA 3CESA 3DU6A 2PJRA 4CCLA 1X4OA 2CS3A 3BG7A 3HPGA 4BDZA 3I9V2 3A2KA 3LL7A 4HNUA 4CCKA 4ITVA 1MMGA 3S93A 3M8JA 3K4JA 3VYRB 4BGDA 1TZLA 2MYSA 1DGWY 2UV1A 2X1DA 3DEEA 4HG2A 1W36D 2GOXB 2KP6A 3RSNA 2VJ4A 4XQFA 4E7IA 1IRXA 3UR3C 1D1CA 2VQLA 1Y6IA 3FBIB 3K4BA 1SFKA 5HOOA 3K70C 4HPQA 3L2QA 2V6EA 2VL8A 1V5GA 4ZYAA 4QPQA 4XR6A 5HLTA 3KEYA 4BE0A 4RLFA 3PNYA 2KPMA 2PJRB 4ZTFA 3OS2A 4Y3OA 2VLAA 1TT0A 4KITB 3A1YA 4PUSA 3VYTB 3N05A 3D5SC 3EUHC 1Z21A 4II3A 3DPLC 4FASD 3OS0A 2QKLB 2ZSHB 4E4HA 2ZXIA 3OYNA 4AU7A 3BLYA 2XSJC 2L9SA 3OYDA 1X19A 3LSHA 1WJFA 2KRCA 3NWTA 1BR4A 3F9KA 4BS9A 4BEHA 1X1DA 4X0GA 2XF7A 3ZGKA 2KLOA 1BOBA 2VIXA 4DJAA 5FRMA 2W1OA 4J01A 3TBIA 3U21A 1GLNA 2K5CA 5TGTA 4XMYA 2M0MA 4B44A 4XOTA 2IS6A 3HC7A 4RM2A 3HUGB 1MMAA 4PK4A 1X1BA 2WAFA 3DPUA 4OAYA 3W2WA 2WY7Q 4MLOA 2LBFB 4XLCA 4CSWA 1LDKB 4PSWA 3G2BA 3DTKA 2I8DA 4BJTA 3S3OA 2WBMA 3MMYB 3SDBA 2R7SA 3OYAA 4F93B 4CCMA 2HVQA 4NUBA 2KQRA 2DJIA 1MW7A 2XDVA 2L5QA 1UG0A 2R7UA 2IGNA 2HVRA 3L2UA 3H9QA 2OC6A 3OMYA 3CF2A 4FETA 3D5RC 4XONA 2W4SA 3QYEA 3OL3A 4E7HA 1VZ0A 4E7JA 2BW3A 2CV1A 4R79A 3CP2A 3J7AY 3QODA 4XLFA 2CW7A 4DBQA 2R7VA 2E5NA 3CMMA 2ZFUA 4PFOA 4U7BA 2A6TA 2DCEA 2CW8A 2M4GA 3AL0C 3PJRA 2CUZA 1KONA 2LOOA 3DLAA 2R7RA 2XC7A 3K4MA 4D9JA 5KCMA 1DQUA 2HZDA 2LH9A 2W82A 3TL4X 1D0YA 4F52A 2VQCA 2OV7A 3S8PA 1UELB 4P5OA 1YE9A 2V26A 4BQNA 1T95A 3LSKA 2X85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC7 A;  2M4K A;  2KRC A;  4NC8 A; 
#chains in the Genus database with same CATH topology
 5DM7 F;  4D7N A;  1AA7 A;  2J5O A;  1NK2 P;  1SEU A;  5CKT A;  2CUE A;  2JPC A;  2X6W A;  1T0F C;  3MCZ A;  1KU9 A;  2HPI A;  3U1K A;  3OOP A;  1R1T A;  1OYW A;  3E0J B;  2XF6 A;  2XB5 A;  3GFJ A;  1IDY A;  1MKM A;  3I4N J;  2AQF A;  1G6N A;  2CYY A;  2FU4 A;  4LLN A;  3SDG A;  2CRG A;  4GCV A;  3OYG A;  2CMP A;  2DOA A;  3PL8 A;  2CFO A;  2ME6 A;  3S1Q J;  3PQK A;  1XPX A;  4Y52 J;  5J8F A;  2VAS A;  1O4X A;  1XSX A;  2CV2 A;  2O8X A;  4N4O B;  5E3M A;  2DFF A;  1LUJ B;  4NQW B;  2HOT A;  2JUG A;  3IUO A;  4EJV A;  1I50 J;  4OIO F;  3DPT A;  1IUF A;  5K7Z A;  1JT6 A;  2EIN H;  1MJB A;  1TWC J;  3FMQ A;  1HKT A;  1OCZ H;  3DFG A;  3SYT A;  3GO5 A;  3CD6 I;  1QA6 A;  5CVU A;  3QOP A;  4O6J A;  2A3S A;  3V8K A;  1H89 C;  1S3J A;  3RQI A;  1FTZ A;  1R4N B;  2ZME C;  1B6A A;  2HXO A;  3BZC A;  1B9N A;  1TNS A;  3KLN A;  1TTY A;  4NBQ A;  1YRN B;  2D1V A;  3I4M J;  5DUK A;  1V3F A;  3CME I;  3BG6 A;  1FNN A;  4DBR A;  4NB5 A;  2EWN A;  2XAF A;  1GV5 A;  1D1B A;  4ABZ A;  3B02 A;  4DZP A;  1ZRF A;  4OIP F;  1HDD C;  1FIP A;  1SD4 A;  3FF5 A;  3S3N A;  1Z77 A;  1SVM A;  2HR3 A;  2UWM A;  3SZP A;  1DGR M;  2ADU A;  2QVO A;  3CCM I;  2VOD A;  1QHH D;  3HOV J;  2K86 A;  2OUM A;  3H3U A;  2M1B A;  4QPO A;  3SFZ A;  5F64 A;  4B3A A;  3WU1 B;  5F0C A;  4I0B A;  4S04 A;  1R6R A;  4HLY A;  5H2F C;  3Q9S A;  4ESB A;  4G6D A;  2HFH A;  5B5E C;  3ZR8 X;  1IGN A;  4KT6 A;  5F08 A;  2ETH A;  1TW3 A;  3SZG A;  5FO5 A;  4BAY A;  2ZXJ A;  4EGZ A;  2OTJ I;  1BIB A;  1T39 A;  2DQL A;  2JVG A;  4IHV A;  1LEA A;  2DW4 A;  2YSR A;  3FXQ A;  3GUD A;  3FXL A;  2FXA A;  2R0Q C;  1V5E A;  1G3W A;  1Z3X A;  2DJN A;  1TT5 B;  4AVZ A;  4CA0 A;  3MEX A;  2IGO A;  2XF5 A;  2FBH A;  3CLQ A;  4NQW A;  2RRE A;  2PLY A;  3EUH A;  3OYH A;  2K3P A;  3CCE I;  1WJC A;  4BL0 B;  4XKC A;  5B3S H;  4KN4 X;  2XB0 X;  4M9S A;  4DIQ A;  2L0K A;  2ACJ A;  5DCM A;  4MFD A;  2G9W A;  1JGS A;  4D0P A;  3VWB A;  3BR2 A;  4QTR A;  2R7Z J;  3U2R A;  3T0Y A;  1R7J A;  3ZMZ A;  1MMN A;  1T33 A;  5HOD A;  4JQF A;  2LYC A;  5HVQ C;  1MBK A;  5IY5 H;  2AHQ A;  4FT8 A;  1J9I A;  3BTC A;  2E60 A;  2IW5 A;  1WJA A;  2H1K A;  1DPR A;  1IW7 F;  2IP2 A;  3HM5 A;  4MQV A;  1S72 I;  4I2O A;  5FGM A;  1FBS A;  2STW A;  4JX4 A;  3V8J A;  5IYC J;  3L9F A;  1S29 A;  2VOP A;  3E6D A;  1IRG A;  5LEK A;  1GDT A;  2ZBK A;  3FKI J;  2M3A A;  1YO5 C;  2E7X A;  2HOA A;  2DXI A;  4C2U A;  4XOR A;  1YI2 I;  2EFQ A;  4IKF A;  2HDW A;  5TRD A;  4L5J A;  1K4S A;  2YPR A;  4J19 A;  3FHN A;  3A01 A;  3GWZ A;  5HNF A;  1KU2 A;  2LKP A;  2X0L A;  2XRL A;  1UZC A;  1TP4 A;  1D5V A;  2KZV A;  3J81 K;  1I1S A;  5JLX A;  4A3I J;  5LRS A;  3HDD A;  2WV1 A;  4P55 A;  4ETS A;  2FA5 A;  4BJ5 C;  3E6C C;  3HOY J;  1DU6 A;  5FKN A;  3C2H A;  3CTA A;  3RZO J;  3V7S A;  1FYM A;  2F5V A;  4MHG A;  4C9Y A;  1JKP C;  3GME A;  4UVC A;  2ID6 A;  1F4K A;  2IT0 A;  4NHJ A;  1XG1 A;  1K79 A;  1MMD A;  5ICF A;  3BRO A;  1RIO H;  2EFN A;  2XAJ A;  1A35 A;  4Y17 A;  2R5Y B;  2LR8 A;  2L2O A;  2IGM A;  1OCO H;  1Q1H A;  1XGM A;  4YEL A;  4M6X A;  3KET A;  1QU3 A;  3D0S A;  3QYB A;  2P6S A;  2CU7 A;  2JA8 J;  4A3F J;  2R7Q A;  3S1N J;  2M34 A;  2Z33 A;  4PFP A;  1UHM A;  2O5R A;  2DMN A;  2M8G X;  3DQV C;  4DGW B;  3WE3 A;  2J5P A;  3DKY A;  3F0C A;  4Z6Y A;  5EGO B;  4A93 J;  3BG9 A;  2L4A A;  1ONV A;  4EM2 A;  3RJP A;  3WTS C;  2H6C A;  4WXD A;  3EUA A;  3FXM A;  4UUT A;  2XVC A;  2R7W A;  3CUO A;  2M9H A;  2LF7 A;  5E18 F;  1A04 A;  5ICG A;  1BR2 A;  1I5Z A;  3DKX A;  2PFB A;  4RB2 C;  5F1J A;  1K78 B;  4XK4 A;  5CVI A;  5KVR A;  1TQP A;  1XDS A;  4HQE A;  1YX5 A;  4XSX F;  5IOZ A;  1QGP A;  5B66 C;  3ABM H;  3HOX J;  2DMQ A;  2VKH A;  3TO7 A;  3CO7 C;  1YTY A;  1IN5 A;  1WH5 A;  3BR0 A;  5LD2 C;  1J0R A;  1AKH B;  1S7O A;  1Y0N A;  2X6X A;  2K9S A;  2IA1 A;  4V19 K;  1N25 A;  1RES A;  2KRH A;  5DV5 A;  1ETQ A;  1JTX A;  5F1R A;  3WHC A;  3PUB A;  4YII A;  2E1M C;  2NVT J;  4EEF G;  1UCR A;  1RC9 A;  4U88 A;  2HQA A;  4OAZ A;  3BG3 A;  3LAP A;  2HXI A;  4HX7 A;  3BOQ A;  3FK6 A;  4ENM A;  2H94 A;  2HOE A;  1D8K A;  2KZG A;  3ZQL A;  5EYR A;  3CCY A;  2WB1 A;  5JVT A;  5IOY A;  2E1N A;  4E6K G;  1LJ9 A;  1EKE A;  4LLG F;  4RGS A;  2LLK A;  3BY6 A;  2FJ1 A;  3CJQ B;  2PI0 A;  3GTQ J;  2M45 A;  4ZH4 F;  2COB A;  1MH3 A;  5H6R A;  5TJJ A;  1T8I A;  1IN7 A;  2MFZ A;  1X2N A;  3TOB A;  3S32 A;  3N4M A;  3CJT B;  4IXA A;  4ON0 A;  2CW0 F;  3GFI A;  1J75 A;  4Z2Y A;  2M0C A;  4Y4R A;  2JA7 J;  2IS2 A;  2V1D A;  3JRF A;  4B3X A;  4IZZ A;  3DXJ F;  1WGX A;  1XSD A;  3IAS 2;  1XMX A;  1ZRD A;  4IRG A;  4C30 A;  1YW7 A;  5E1Z B;  3R4K A;  2PJR A;  4CCL A;  1BW6 A;  1X4O A;  4BDZ A;  2FD5 A;  2PMZ N;  3RPQ A;  3SFI A;  3A2K A;  1B9M A;  3GLX A;  2WTE A;  3SQN A;  3C18 A;  4CCK A;  1G3Y A;  1AU7 A;  2E35 A;  2H6B A;  2AS5 F;  4DNC A;  2D1H A;  3FIS A;  5DUI A;  3RYR A;  4L9T A;  3DEW A;  1A6Q A;  2XRN A;  3CCR I;  4EJO A;  2GOX B;  5A2Q Z;  1VQP I;  1W36 D;  1XN7 A;  4E7I A;  1IRX A;  1T2K A;  2VQL A;  1Y6I A;  3K4B A;  2G7H A;  2DMT A;  2E1O A;  2GAU A;  2EIJ H;  2V6E A;  1RUO A;  1GXQ A;  5ICC A;  1JJ8 C;  1FOX A;  4ZYA A;  2GBY A;  2OZU A;  3B6C A;  1FY7 A;  3FMR A;  2F5E A;  3KEY A;  2EZL A;  3K2Z A;  2BYV E;  3T8R A;  1Z9C A;  1NK3 P;  1MSF C;  2TDX A;  3MVP A;  3PNY A;  4RLF A;  3HYI A;  2KPM A;  3HIF A;  5GTI C;  3QPL A;  1TQI A;  3A1Y A;  4A3L J;  4PUS A;  3QPS A;  3MFK A;  3O6B B;  1RRJ A;  3JRG A;  2EA2 A;  1W5T A;  5EJC A;  5C4J J;  5GAE J;  3DV8 A;  3OS0 A;  2CWE A;  3S2H J;  1FLI A;  2FBI A;  2LP0 A;  3OYN A;  3DLL F;  2RNJ A;  3QP6 A;  2HGC A;  2PN6 A;  2VBZ A;  1R71 A;  1WQ2 A;  1WJF A;  1ZH5 A;  2R7D A;  4B8X A;  4BEH A;  5J4Y A;  4LB5 A;  5EEG A;  3W6J B;  4CYC A;  2K9Q A;  1TL8 A;  3LNQ A;  2KT0 A;  4IHX A;  1SMT A;  4AWX B;  1TBX A;  4HX8 A;  3KP3 A;  3TBI A;  1T38 A;  3U21 A;  1GLN A;  2K5C A;  4A6D A;  1C0W A;  2M0M A;  1VQ4 I;  2XGX A;  2IS6 A;  2EPF A;  1MMA A;  3W2W A;  2YUS A;  3RZD J;  5DCM B;  5E3O A;  1Z6T A;  2NS8 A;  1TC3 C;  2JRT A;  2Y2Z A;  2IRF G;  1ZTR A;  3RKQ A;  3GZN B;  4PSW A;  3G2B A;  1RUN A;  4BJT A;  4HX4 A;  3S17 J;  3S3O A;  1YLF A;  1XDU A;  3SDB A;  3OYA A;  2HVQ A;  4MQ9 F;  2YS9 A;  1W4M A;  3BJO A;  4BNC A;  1FZP B;  2XAQ A;  3MZY A;  1H88 C;  5J1U A;  1R1U A;  5HLG A;  3MAJ A;  5E1X A;  3WOD F;  4XON A;  1Y0U A;  1S8N A;  4V2F A;  3R60 A;  3G1M A;  1VZ0 A;  3WTU C;  2BW3 A;  4XLF A;  1Z91 A;  1U5T C;  4MIM A;  2ZFU A;  1YW8 A;  2P4W A;  1HF0 A;  3AL0 C;  3W6V A;  1X1P A;  3DLA A;  1HW1 A;  4A0Y A;  3TED A;  3BPX A;  5EDN A;  4C3H J;  9ANT A;  5K5O A;  3K4M A;  2Y30 A;  4D9J A;  2VE9 A;  1JHH A;  2HZD A;  4U7D A;  1A36 A;  3IHU A;  5ILS A;  1JUS A;  3S8P A;  2DPU A;  3J80 K;  1UEL B;  4G7Z F;  5C4X J;  1YE9 A;  1T98 A;  2CQ7 A;  3LSK A;  2X85 A;  2JTV A;  5D5X B;  2PEX A;  4HBL A;  1F5T A;  2Z5U A;  4C2T A;  1ETW A;  2ZB9 A;  3OS1 A;  3JTH A;  4RMN A;  3IV5 A;  2ZJ2 A;  2VXZ A;  4UV9 A;  4F3Q A;  1FWZ A;  2LRD A;  5IP9 J;  1OCR H;  4KA4 A;  1D0X A;  2VT2 A;  3LFU A;  2VQG A;  4IHT A;  2MAB A;  4R1H A;  4XKV A;  4AID A;  2VC1 A;  5C3E J;  2B63 J;  1E0E A;  4M73 A;  2GIV A;  3BCB A;  3ZRG A;  1W7P D;  4BH9 A;  2A6H F;  2HU9 A;  3ASO H;  1ZRC A;  1QRY A;  1XMA A;  4RB0 A;  4EAT A;  4BBR J;  4CGZ A;  3GTM J;  1X4P A;  3BWG A;  1D5Y A;  1OIS A;  2V9K A;  3ULQ B;  4FCY A;  1I6X A;  2X48 A;  4MEY F;  3WG9 A;  2JMW A;  1W0T A;  2R5Z A;  1B59 A;  1N77 A;  1BM9 A;  2Y75 A;  1UG2 A;  5FLX Z;  4F55 A;  2EV6 A;  5F0F A;  4CO8 A;  3OIQ A;  4E7K A;  2M30 A;  4WX9 A;  1LB2 A;  1OYY A;  3OYE A;  2BY1 A;  3WE2 A;  1YFH A;  1FP1 D;  2GZW A;  1QVT A;  1EV7 A;  1BR1 A;  3BPV A;  2N8G A;  2XV4 S;  4ZDO A;  1YYV A;  2ZFW A;  1N78 A;  4IL6 C;  3I58 A;  5K5Q A;  4ZJZ A;  5EF6 A;  2JUC A;  1D1A A;  3ABK H;  4YIR X;  2R93 J;  2VON A;  2LG4 A;  5LHG A;  4WF2 A;  2QEN A;  5EGO A;  3IKT A;  3QRF F;  3SEQ A;  1K6O A;  3LFK A;  5LLQ A;  1WJ5 A;  4NC8 A;  4BUP A;  1JT0 A;  3MKY B;  1JKQ C;  1KU7 A;  3ZMD A;  1AHD P;  1WJE A;  6PAX A;  3G71 I;  1S7A A;  2JSC A;  4RM3 A;  2V7F A;  3I53 A;  3OYC A;  2LBF A;  2GA2 A;  2DN0 A;  3CMA I;  4WK8 F;  4LMY A;  5CVR A;  4HQM A;  1I39 A;  3AG3 H;  1QPM A;  2LFB A;  1IAW A;  3WTV C;  3JAM Z;  1BL0 A;  3I59 B;  3HOS A;  2QUF A;  2CQK A;  3AFH A;  2V9V A;  2QYO A;  4ANJ A;  2LSO A;  2P0W A;  4MTD A;  2DLL A;  3H36 A;  1R5I D;  1IF1 A;  1TQM A;  3H1C A;  1X1C A;  2GXA A;  2DO7 A;  2GXB A;  3OYB A;  3KLO A;  1SFX A;  3D1N I;  3L7W A;  1FC3 A;  4B4C A;  1WFX A;  2ESH A;  1O3Q A;  5E79 C;  2YR2 A;  3CCQ I;  2PMZ A;  1USS A;  2MGQ A;  1NHA A;  2E5Z A;  1UAA A;  1HCR A;  4UXN A;  1X2M A;  1KQ0 A;  1XTA A;  3HTU A;  1VQK I;  1RR8 C;  1FP2 A;  2NS7 A;  2RNG A;  4C2M J;  4XL9 A;  3WGI A;  2O61 A;  3TW7 A;  1TWF J;  4G6Q A;  1L0O C;  2M4K A;  1Y1W J;  3BTI A;  1EH7 A;  4BJ6 C;  5M5Y J;  2Y9Y A;  1P9Q C;  1J09 A;  2ZXH A;  5J1R A;  3VEP A;  2JA5 J;  1Y8R B;  3KP2 A;  1VQM I;  1B8I B;  5CQG A;  2OQR A;  2P7V B;  4XKW A;  1B72 B;  4HEA 2;  3PO2 J;  2CO5 A;  1Z0X A;  2RQQ A;  1WVR A;  4A3B J;  1QNT A;  4U87 A;  1PP8 F;  1V55 H;  4N4N B;  1FYK A;  1FOW A;  3OYF A;  3H5A A;  1RET A;  1ETV A;  3CDL A;  1HKQ A;  2JT1 A;  4F92 B;  3L2R A;  2IA2 A;  2R7O A;  1V54 H;  1U3E M;  2DA6 A;  2FSW A;  3IH4 A;  3KYL A;  2HQR A;  4EJW A;  2L54 A;  2OAZ A;  4LOC A;  3O2P E;  5H6Q A;  3GLL A;  4UY8 I;  4Y33 A;  3VSL A;  3OYM A;  3V7C A;  3AG1 H;  1ZGW A;  1FPQ A;  1LKX A;  2G0E A;  5E1W A;  4IQJ A;  4LGW A;  1VQN I;  2P5L C;  4EGY A;  4ZYH A;  5BS6 A;  2HVS A;  1ETX A;  2IBD A;  3FKJ A;  2G7U A;  1YW9 A;  3FM3 A;  2OCC H;  3FMS A;  4Y7N J;  1BI2 A;  3KX2 A;  1ULY A;  4IQ4 A;  2MD5 A;  4Q47 A;  2FNP A;  1JI8 A;  1ZR2 A;  3IAM 2;  1IV8 A;  1QQI A;  3RYP A;  5D6E A;  2LD5 A;  3CJR B;  2HTS A;  2BXZ A;  3K4C A;  2UXN A;  3PFI A;  4A0X A;  1D0Z A;  4CZC A;  3ISP A;  1O3S A;  1YJW I;  3A02 A;  1EJ9 A;  1VI0 A;  5DEQ A;  1NG7 A;  1XGS A;  2BHZ A;  1PJR A;  2LF8 A;  3LQQ A;  1U8B A;  2XPV A;  4I98 B;  3S1M J;  4I0A A;  2GQQ A;  2EZH A;  3K9T A;  5CJ9 A;  3IC7 A;  3KIO A;  2OTL I;  4QSH A;  2EV0 A;  1SAX A;  2V9P A;  4RAF A;  3ZQC A;  2BXY A;  3HGY A;  4MO7 A;  1HC8 A;  3EPZ A;  3RPU D;  1GVJ A;  5BMZ A;  2EIL H;  3UNG C;  3RQ4 A;  2Q1Z B;  5CYV A;  5DD8 A;  3M8E A;  1VQ5 I;  1HA8 A;  3LSG A;  3PSI A;  2BW3 B;  3P5J A;  4PJL A;  2R7T A;  3SHF A;  1XMK A;  2XUB A;  3IP4 B;  4M6V A;  2VJ5 A;  4EV0 A;  1PUE E;  3J7Z I;  3BTL A;  2OPT A;  2EV5 A;  2IXS A;  2R3S A;  5TIS C;  5GP9 A;  3ECH A;  2YU3 A;  1YS7 A;  1U5T A;  5D6F A;  1LFP A;  3FX3 A;  3KZY A;  1ITY A;  1R5G A;  5D4S A;  4PJM A;  2Q2E B;  1WZ2 A;  2NNY A;  4IO9 F;  4L0Z B;  2R4G A;  1FMW A;  2CQQ A;  3L00 A;  3AG2 H;  3GVA A;  4BXF A;  4BDY A;  3ECO A;  1ON2 A;  4RAG A;  1PP7 U;  3GCM A;  4KDP A;  1ETO A;  5EZH A;  3CF5 F;  3DTI A;  4F7Z A;  5L3D A;  4ZTJ A;  5LFA A;  1R5H A;  4L5I A;  4IOC F;  1LFB A;  5L3B A;  5EG0 B;  3H3Z A;  4IEJ A;  5CLS A;  4RB1 A;  2VPL A;  3HRS A;  3Q3S A;  3Q5F A;  4OIQ F;  1MIJ A;  2WA0 A;  1KYW A;  1MNE A;  4ZYE A;  4KIF A;  2DAO A;  1W0U A;  3ABT A;  4UUS A;  4BHC A;  3E6M A;  2IPQ X;  3COA C;  3H35 A;  3HRT A;  1D8J A;  2M7A A;  3H5N A;  2ECB A;  3BR5 A;  3J81 Z;  2Q2E A;  4KNY A;  4U0V A;  1NG6 A;  4FQG A;  4E7L A;  4UUV A;  3QYF A;  1KZH A;  2GOM A;  2QM3 A;  4XBF A;  3DU6 A;  1XX5 A;  5LBQ A;  2V79 A;  3CDH A;  1GHC A;  3HPG A;  1SD5 A;  3CC7 I;  3JRD A;  3LQR A;  3QU3 A;  5D4R A;  1H0M A;  2H8W A;  3FIW A;  4A0Z A;  3R0J A;  1MMG A;  1SFE A;  1CQT A;  2MG4 A;  3M8J A;  3VYR B;  1R00 A;  5ILV A;  3CC2 I;  2OQG A;  3I71 A;  4I76 A;  4CXF A;  1G4D A;  3DEE A;  1JTY A;  4GXO A;  2OBP A;  5GPC A;  2MSY A;  2VI6 A;  3ERE D;  1FJL A;  3QU6 A;  3UR3 C;  1QO0 D;  3FBI B;  4X6A J;  3C1D A;  3K70 C;  3LA2 A;  2RDP A;  1F1Z A;  3Q0V A;  3L2Q A;  4JX6 A;  1JKR C;  2HI3 A;  2VL8 A;  5HLH A;  1LE8 A;  3R6S A;  5HS8 A;  2A69 F;  3S15 J;  4DYQ A;  3WGH A;  5IP6 A;  1IC8 A;  4AUX A;  1FT9 A;  4Y3O A;  2VLA A;  2PMH A;  4FX0 A;  4KIT B;  5BOX A;  4K2E A;  2CFX A;  1IRZ A;  5FFZ A;  4FTH A;  1YIJ I;  2JN6 A;  3J7A O;  3BT9 A;  1HLV A;  4FAS D;  2EJR A;  3ESW B;  3IWZ A;  3GTJ J;  4CDG A;  4A3K J;  5DCF A;  2ZXI A;  1R23 A;  4AU7 A;  3OSG A;  5DYM A;  2P7C B;  4UB8 C;  3K7A J;  1X19 A;  2E7W A;  1J2X A;  2JWT A;  1XCB A;  2L7F P;  3E6B A;  1QZE A;  3LSH A;  2B0L A;  3QAH A;  1I27 A;  2O03 A;  4X0G A;  1NH3 A;  5KK1 A;  4IOA F;  3W6K B;  2KLO A;  3LA7 A;  2JRM A;  2NVU B;  2D45 A;  4L9N A;  2H8R A;  1XC5 A;  1VTN C;  2OZ6 A;  5ERI A;  5JLW A;  2WB1 N;  1VQ9 I;  1IV6 A;  5EEA A;  5KAF C;  3LOC A;  3K1M A;  3L2C A;  4BXX J;  1G2H A;  4XMY A;  3BQY A;  1STZ A;  4B44 A;  3HC7 A;  3HUG B;  1FBQ A;  2DA4 A;  4PK4 A;  3DPU A;  2W25 A;  1KU3 A;  2WY7 Q;  4MLO A;  2LBF B;  5DS9 A;  1JXS A;  3KEQ A;  5FD5 A;  4CSW A;  3HHH A;  1IXS B;  4XID A;  2JJ7 A;  3DTK A;  1T0F A;  3G1L A;  3I4P A;  2F5D A;  1JUP A;  1RKT A;  1H9T A;  2WBM A;  3MMY B;  1P6R A;  3TO9 A;  3VOE A;  4F93 B;  2DA5 A;  3FM5 A;  3K2A A;  4OU0 A;  2DMU A;  2KQR A;  4RA2 A;  5BQT A;  4A3D J;  4IHW A;  3JRE A;  1U2W A;  3L2U A;  3BQZ A;  5EEH A;  3FHZ A;  3JR9 A;  3X2Q H;  1ON1 A;  2W85 A;  2RV8 A;  1GUU A;  3GZ5 A;  3D5R C;  4FET A;  4E7H A;  2L9R A;  1WWX A;  2CV1 A;  4R79 A;  2XSD C;  5ILU A;  2NRA C;  1IN8 A;  2R7V A;  2DDB A;  3CMM A;  3S16 J;  2DCE A;  1ZLJ A;  2M4G A;  1HW5 A;  1LVA A;  1KON A;  1DU0 A;  4IRH A;  4PGH A;  1IN6 A;  3F8F A;  2BV6 A;  5HLI A;  2PBI A;  1X3W B;  4EQQ A;  2WV0 A;  1BJA A;  1F9N A;  2DU9 A;  2LVS A;  4F52 A;  1D0Y A;  5D8L B;  2VQC A;  4N9H A;  3F6V A;  1P4X A;  5H20 A;  1SFU A;  2K27 A;  1WPK A;  1XCV A;  3KP4 A;  5F0H A;  4HZF A;  1FYL A;  2C6Y A;  2RGV A;  3BR6 A;  4E70 A;  1OCC H;  4X1E A;  4Y13 A;  2DFI A;  3EUK L;  3JRA A;  1S9H A;  4RB3 C;  1TW2 A;  3BP8 A;  3P9C A;  2XIG A;  2HOS A;  4IF4 A;  1YJ9 I;  3IH2 A;  1R58 A;  1T6S A;  5LGT A;  1HDP A;  2ELJ A;  1OQY A;  1F43 A;  1S5L C;  3DBL B;  4KYW A;  4ZYG A;  4B43 A;  3JRH A;  4Q5S F;  1ODD A;  2R7F A;  2LKX A;  3VPR A;  3KPH A;  5CPR B;  4XN0 A;  2QSG X;  3PSF A;  5B1B H;  3ZQG A;  4ZYD A;  2NOG A;  4I01 A;  4G12 A;  2W48 A;  3ZQ7 A;  2KFD A;  3A03 A;  4L18 B;  3BZ6 A;  1JUM A;  2ESN A;  4PJJ A;  1MSE C;  5F6F A;  1SMY F;  3K4K A;  2ZSI B;  2F5F A;  5ICE A;  4KIG A;  2DOD A;  2QQA A;  4UNO A;  2PX9 A;  4BYY A;  4OMZ A;  2WAD A;  2LDU A;  5FB2 A;  3OIO A;  2ZXW H;  2DT5 A;  1UMQ A;  3R61 A;  4AYB N;  4BE1 A;  3LST A;  4OWR B;  2KIQ A;  3GTP J;  3C2G A;  3WTT C;  4MTE A;  1UHS A;  2QCO A;  3PNT A;  4WXH A;  3OR2 C;  2ZJR F;  4C3I J;  4BY7 J;  1G59 A;  2HQ5 A;  1U5T B;  4KJZ A;  3LMM A;  5C44 J;  3PFY A;  3OIP A;  2IJL A;  4XN3 A;  1BC8 C;  2X9D A;  4JOM A;  5L3C A;  4IX7 A;  2DT7 B;  2Z2S B;  3IWF A;  1OMI A;  4XOP A;  1WJD A;  4ESF A;  3HSR A;  1WJB A;  4AIK A;  1XGO A;  3K6G A;  3H5R A;  1BA5 A;  1WHU A;  2CH0 A;  5DD4 A;  1EH6 A;  2X51 A;  3T8T A;  2XAG A;  4KIC A;  2IVM A;  3GXO A;  2JSP A;  3CZ6 A;  1OCP A;  3FBN B;  1O57 A;  2HNH A;  3FWE A;  1P4A A;  2DOE A;  2QZ8 A;  4O5V A;  3G4S I;  1FIA A;  2L01 A;  1ZN2 A;  2ICW G;  3QPH A;  3NAU A;  2BE5 F;  2DI3 A;  5FLM J;  2ELK A;  3WTY C;  1DP3 A;  2LY1 A;  1BJZ A;  4YEJ A;  4BEH B;  5HS7 A;  1P7J A;  3EQL F;  2IEK A;  4RS8 A;  2DT6 A;  1I6H J;  1QPI A;  3QOE A;  2DK8 A;  1W36 C;  5FKO A;  1HKS A;  1MND A;  5HDG A;  2VBW A;  4P96 A;  5J8C A;  4GDF A;  4LIU A;  3ROU A;  3IRR A;  2VJI A;  1HBX G;  1MJ9 A;  3PM1 A;  4LJZ F;  4W97 A;  5CQE A;  1PVE A;  4CYD A;  2RN7 A;  3K70 D;  5FRN A;  1BI3 A;  2NS0 A;  2O3F A;  3OSF A;  1SFO J;  3DP7 A;  2UZK A;  3DTE A;  4RLQ A;  3A0H C;  4HNT A;  3DCF A;  3HSE A;  1SVO A;  5J4V A;  1YX3 A;  3RKY A;  3D5L A;  3VYU B;  1EA3 A;  2KJB A;  3EDP A;  3B6A A;  2HWV A;  5LGN A;  3N97 A;  2KRF A;  1VFC A;  5L3G A;  3ZQF A;  1ZKG A;  1TWH J;  5J6X A;  1OYI A;  3CQZ J;  1I3Q J;  3K4N A;  1HSJ A;  3OV8 A;  4DYR A;  1E3H A;  1W7P A;  3TOA A;  2HS5 A;  1DP7 P;  2DFH A;  1PYV A;  2M8E A;  2V6C A;  5JHU A;  4LK1 F;  2W00 A;  3FXJ A;  1HQC A;  1XD7 A;  3TP0 A;  1AKH A;  1UJ8 A;  1VQL I;  2NVQ J;  3A4C A;  4L9J A;  1MBG A;  4ZZL A;  2FE3 A;  4BE2 A;  4PJN A;  2E2I J;  2X6Y A;  2VC0 A;  1X1A A;  3NWS A;  4XRS G;  4MFE A;  1VND A;  3CP8 A;  3I3L A;  4OOI A;  2VKE A;  2GM4 A;  4L5E A;  5FLV A;  3O8G A;  2P6T A;  3P9I A;  4AVP A;  1OR7 A;  3CUQ C;  4CHU A;  2F5C A;  4HV5 A;  2ISZ A;  3ZQQ A;  3PIO F;  3O8H A;  2ELH A;  5L3F A;  2F6C A;  3DWL E;  5DM6 F;  3TQN A;  1Z7U A;  2FOW A;  3BC8 A;  1W5C C;  2FBK A;  1G3T A;  4BU2 A;  2R7X A;  2RC4 A;  3W3C A;  3H9G A;  4TV7 A;  1NTC A;  2K40 A;  3GX4 X;  4A3M J;  3FXO A;  1TWG J;  1Z1D A;  1YG2 A;  2YX7 A;  4HAM A;  1U0J A;  4CH7 A;  3M4O J;  3GYH X;  2L4M A;  1V5F A;  2K9L A;  3GF2 A;  1Z7L A;  3ZQI A;  4A3J J;  2R5Z B;  2KDO A;  2VB6 A;  1SD6 A;  3HOT A;  4ZDP A;  3BR1 A;  3VOD A;  2QQ9 A;  1LDJ A;  2XGD A;  3F8C A;  2R5Y A;  1WSU A;  4BQA A;  3TKY A;  2CUJ A;  1SD7 A;  2E71 A;  3OY9 A;  1HW2 A;  4LIV A;  4CUG A;  3ZCO A;  2QGU A;  4D1Q A;  1PDN C;  2DA3 A;  2ZME B;  1LPQ A;  4DYC A;  1XS9 A;  2L02 A;  3RTR A;  3JSO A;  1RI7 A;  2A5Y B;  2DYR H;  1LQ1 A;  3TMO A;  4DOZ A;  4LLL A;  5BPI A;  4LD5 A;  4L0Y B;  3HOZ J;  1O7F A;  1OKR A;  4A12 A;  3IRQ A;  3K10 A;  3SJM A;  2KL4 A;  2VN2 A;  2WAE A;  2XPW A;  2NVX J;  2Y31 A;  3L09 A;  2KMU A;  5JHF A;  2CGP A;  2EA4 A;  4DZJ A;  2HEO A;  2OD5 A;  4PCQ A;  3BCA A;  1WI3 A;  4XNF A;  2LY2 A;  2PG4 A;  3ZMT A;  2DPD A;  3GEZ A;  3RIR A;  3HPH A;  2L7K A;  2VE8 A;  1DPU A;  1IXC A;  1X3U A;  2E2J J;  2W7N A;  2BZT A;  3NAR A;  5JR3 A;  1MDM A;  2P81 A;  4AIH A;  3KP5 A;  3REO A;  3CCS I;  3HOU J;  2KIF A;  2KKO A;  3M9A A;  5FKL A;  5M3M J;  2MA3 A;  1B72 A;  2O9L A;  3H0G J;  1YS6 A;  1VQ6 I;  1UHW A;  2Y48 A;  1K83 J;  1EH8 A;  4XM3 A;  3V8L A;  4BAC A;  1KQ9 A;  1U9N A;  2ZO4 A;  4HSR A;  4G8X A;  4YFX F;  3OYI A;  1B8I A;  2QBY A;  5K5R A;  3CES A;  1YIO A;  3BG5 A;  5DTD A;  1LE8 B;  1GXP A;  3BG7 A;  1ACI A;  2O8K A;  1PUF A;  2BY2 A;  4HNU A;  4ITV A;  1L3L A;  1M1E B;  4XRM A;  1MH4 A;  2ECC A;  3S93 A;  3BTJ A;  4V2G A;  3MKL A;  5M5X J;  1TZL A;  2MYS A;  1DGW Y;  2UV1 A;  3F6O A;  2X1D A;  4HG2 A;  2EFP A;  2LKS A;  2EIK H;  3EET A;  1HOM A;  1TLH B;  2BY3 A;  2KP6 A;  2VJ4 A;  2E34 A;  2TCT A;  2A05 A;  4XQF A;  5IYB J;  4AC0 A;  1D1C A;  1G3S A;  1QZZ A;  3F21 A;  1SFK A;  2QQB A;  2TRT A;  4Q48 A;  5HOO A;  1FTT A;  1T56 A;  4DW6 A;  4HPQ A;  4A6E A;  1BN5 A;  3EYI A;  1QZY A;  3E5X A;  2GLO A;  2HYJ A;  3HBL A;  4XR6 A;  3ASN H;  4EVI A;  5HLT A;  4BE0 A;  4G7H F;  2QBY B;  1ENH A;  2HDD A;  2CQN A;  5KAI C;  3LA3 A;  2E1C A;  2PJR B;  4WWC A;  4ENN A;  4ZTF A;  4ESJ A;  3OS2 A;  5J1Y A;  1TT0 A;  2MLK A;  1HST A;  2W57 A;  3D5S C;  2A6E F;  1O3R A;  3EUH C;  1Z21 A;  1GVD A;  2PQ8 A;  5E8G A;  2K4B A;  2WC2 A;  3DPL C;  3P9K A;  4UVB A;  2QKL B;  2ZSH B;  4WXC A;  4PDK A;  1X58 A;  2WAQ N;  2XKP A;  2Q8K A;  4E4H A;  1JKO C;  4ZZD A;  1W5S A;  2DTZ A;  3BLY A;  3OYD A;  2OF7 A;  3F23 A;  2LK2 A;  4M3D A;  2KRC A;  3NWT A;  2FF4 A;  1BR4 A;  4LFU A;  5HDK A;  4HV6 A;  4BS9 A;  1DUX C;  1RR7 A;  1ZGJ A;  2DBB A;  3SXY A;  2XF7 A;  3ZGK A;  4O3M A;  3J7Y J;  2JQ7 A;  2VIX A;  1AWC A;  4DJA A;  2X4H A;  3KCC A;  2W1O A;  2MLG A;  4J01 A;  1MMS A;  5D5V B;  2CG4 A;  1TWA J;  1A6I A;  1APL C;  3FZV A;  1ZG1 A;  5IT9 K;  3S2D J;  4D5C A;  4XOT A;  5D5U B;  5AIQ A;  4RM2 A;  1ZLK A;  2EIM H;  1IG7 A;  3CJN A;  2XAH A;  5GAH J;  3GW2 A;  1MBJ A;  3JCU C;  1ZG5 A;  3CDI A;  5J3L A;  2I8D A;  2JZY A;  2H1L A;  3WGG A;  2FML A;  5D5W B;  4B1R A;  1ETY A;  2R7S A;  5IT3 A;  2KIU A;  4CCM A;  2XAS A;  4NUB A;  5HS9 A;  4A2U A;  5LGU A;  2VKV A;  4DQ2 A;  4UHT A;  1BC7 C;  2R7U A;  2IGN A;  2HVR A;  3H9Q A;  5AON A;  3OMY A;  1TNT A;  3HGG A;  2NXN B;  3TP3 A;  4IJA A;  1H8A C;  3CF2 A;  3WHB A;  3H92 A;  3OL3 A;  3UKG A;  2L7Z A;  4IRI A;  1Z05 A;  3A0B C;  5HDN A;  1ZHF A;  2NNN A;  2GIZ A;  4ENK A;  4KN7 X;  4DBQ A;  4HF2 A;  4D5F A;  3TGN A;  1WCM J;  2D5V A;  3IKV A;  3U9G A;  3K0L A;  2CW8 A;  1WKM A;  2CUZ A;  5AIP A;  1SC7 A;  2LOO A;  3PJR A;  3KZI C;  3CMY A;  1FOK A;  2E36 A;  4BHB A;  5JI6 A;  2R7R A;  2FQ3 A;  2HDC A;  4M6Y A;  2XC7 A;  2Z3Y A;  2QWW A;  3CCU I;  5KCM A;  1ORK A;  1DQU A;  1B1B A;  4U0W A;  2KJC A;  3RKX A;  3JRI A;  3DEU A;  2HYF A;  1OPC A;  2Q0O A;  3DF8 A;  4HNV A;  2K4J A;  2MW8 A;  2XPU A;  4A5N A;  5ED4 A;  1T95 A;  3I55 I;  1K7A A;  5LHI A;  3T5X A;  4RAY A;  2Z9O A;  4CYC B;  4GGG A;  2CQX A;  3HOW J;  3KYC B;  2DFE A;  5HNH A;  3CLO A;  1UST A;  4BQO A;  5EG0 A;  2P5V A;  2VT3 A;  3I59 A;  1P92 A;  3OWT A;  1SVL A;  5M3F J;  2D2W A;  4M72 A;  1K4T A;  4CCO A;  3S3M A;  3GTO J;  2Z16 A;  4XLE A;  1BI0 A;  4RGU A;  1GT0 C;  5GAG J;  4EJU A;  3A01 B;  4AM3 A;  3QPT A;  4KIS A;  2MC3 A;  2DYS H;  2RAE A;  4E7S A;  3S1R J;  2P8T A;  4KIB A;  4I09 A;  3F3X A;  1LNW A;  4LG3 A;  4BHP A;  4UUS B;  2BVM A;  3GFL A;  2OJE D;  3VYS B;  2KDZ A;  4LB6 B;  1ZRE A;  4IHY A;  1I3A A;  3PNV A;  4M9Z A;  4G9Y A;  2BGC A;  3ZP5 A;  2O6G E;  4IHS A;  3WTZ A;  2MD0 A;  2MC4 A;  3AG4 H;  2JA2 A;  4PSX A;  4ASN A;  1ZR4 A;  3L2V A;  3WTX C;  4S05 A;  1IO2 A;  3WU0 A;  3AKZ A;  1R22 A;  5FKM A;  2O7O A;  2FUG 2;  3M07 A;  4I02 A;  3HSF A;  1EF4 A;  1J5Y A;  2K9N A;  2M7B A;  4B47 A;  1DDN A;  2R92 J;  2DOF A;  2WWY A;  2B7E A;  3ABU A;  3C2B A;  4OIR F;  1SAU A;  3KFW X;  3FXR A;  3O3K A;  4NNJ A;  4C3J J;  2NOJ B;  3FK7 A;  3WTW C;  3Q9V A;  1KYZ A;  3PO3 J;  4PJ0 C;  5KNL A;  1MBE A;  3HHG A;  4YFN F;  3L1P A;  3EYY A;  1VF9 A;  1KQ8 A;  2OCE A;  3WG7 H;  1UFM A;  1JGG A;  1MNM C;  4KT5 C;  1QHG A;  1UB9 A;  5CVV A;  2CJJ A;  5IT9 Z;  4BQQ A;  1K78 A;  4MNU A;  1D3Y A;  3KE2 A;  2VUM J;  4A69 C;  1BIA A;  3JSP A;  2L7M P;  3H0D A;  4ZC3 A;  3OR1 C;  3OYJ A;  4GYI A;  5B1A H;  3VSK A;  2XGC A;  2W24 A;  3M7G A;  4HOB A;  2QKM B;  2DA1 A;  5FRO A;  4EM1 A;  2HPM A;  1K6Y A;  3S14 J;  4G6T B;  2A68 F;  4CZZ A;  1LDD A;  2A07 F;  2DK5 A;  4AD9 A;  4MEX F;  5D8K B;  2EFO A;  4PZJ A;  1Z67 A;  2DTR A;  2XAU A;  2V1N A;  2MBF A;  2QSH X;  2VKD A;  3ZMV A;  4RDU A;  1BW5 A;  1Y1V J;  2KHM A;  4RGR A;  3ZN1 A;  2K85 A;  2FQ4 A;  2I10 A;  2QSF X;  3E1S A;  3MD2 A;  3LAJ A;  3W2V A;  2DDA A;  4GRI A;  4XRS A;  3GTL J;  4FE7 A;  4I7H A;  2A5W A;  1RPW A;  4CCJ A;  5KHD A;  1QVU A;  5EZG A;  3RKW A;  3QQA A;  1H9G A;  3SEZ A;  1OFC X;  4XIC A;  1YHQ I;  2A61 A;  1P7I A;  3PIP F;  4EMS A;  2UUZ A;  4M3E A;  4XKB A;  3G6E I;  3OL4 A;  2Y69 H;  2QQ8 A;  2RVC A;  2QEX I;  1AOY A;  4UB6 C;  2RQP A;  2VBX A;  5GPA A;  2FRH A;  3OOU A;  4E7Z A;  3LWF A;  5IPA A;  2FEZ A;  2Z99 A;  2OA4 A;  2WY8 Q;  1FMV A;  2EZI A;  2K9M A;  3ONQ A;  4M3F A;  4N0B A;  1XB4 A;  3GBG A;  3I64 A;  4P1W A;  2AXT C;  3MQ0 A;  2X1E A;  4H4K C;  4F91 B;  4XRF A;  4EJT A;  4JYK A;  3DU5 A;  5K1Y A;  2I5U A;  4HLX A;  3LSJ A;  4D7M A;  1ERD A;  3E7L A;  1A5J A;  2CUF A;  4I6Z A;  4HRI A;  3GFM A;  1ZAO A;  3R0A A;  1FBU A;  1PUF B;  3MZH A;  2E1M B;  2Y0S A;  2DQR A;  5GTH C;  3H3V K;  3ML6 A;  3VB2 A;  1MJA A;  3WU2 C;  4KMU X;  2VXD A;  3M1E A;  3AL0 B;  4BKX A;  3CCV I;  1MD0 A;  5FLX K;  2O0Y A;  4XLA A;  4Q4Z F;  2ZCW A;  5FKK A;  4JK1 X;  5E20 A;  4B09 A;  5L3E A;  3FXU A;  4GYG A;  4QIW N;  3LSI A;  5J47 A;  4G94 A;  3F8N A;  5M5W J;  5JVG F;  3BDD A;  2M2E A;  4J00 A;  4LIT A;  1WRJ A;  3LSP A;  1BOA A;  3J80 Z;  1IDZ A;  1S7E A;  3S2W A;  3CUQ A;  4GFB A;  4NDL A;  4XLH A;  1MGT A;  2EFW A;  2FMY A;  2BBY A;  3E5U A;  2EBI A;  4HF1 A;  1ZEL A;  4HDV A;  1LFU P;  1G8X A;  3K69 A;  1W7P B;  2EZK A;  3HJE A;  3K4L A;  3NRV A;  1OR7 C;  3FDY A;  2F4M B;  1R9T J;  2KIM A;  1YQA A;  3ABL H;  3ERM A;  1ETK A;  2V4J C;  2DA7 A;  4HYE A;  2LTP A;  2LC2 A;  4B48 A;  2M5W A;  2IGK A;  4M9X A;  1YJN I;  3V42 A;  5JFR A;  2IAI A;  3ZMU A;  2BVL A;  2ZME A;  4HST A;  2Z1D A;  5DDG A;  1B4A A;  2VJJ A;  3HXL A;  2EK5 A;  5J40 A;  2BOL A;  3HG9 A;  1WI9 A;  3NQO A;  5E3L A;  2HYG D;  2JVH A;  1CGP A;  4R8H A;  3G1O A;  1Q1V A;  1P4W A;  3H9J A;  1RZ4 A;  3FXK A;  2ZJP F;  1I1G A;  3L2W A;  1F36 A;  3K1N A;  4U0Y A;  3CCL I;  1J59 A;  4IPA A;  1U8R A;  1O3T A;  2IS4 A;  2YX4 A;  4M71 A;  3M8F A;  4MGR A;  2DMP A;  1REP C;  1FEX A;  2K02 A;  1OJL A;  4QLC U;  3LSR A;  2F48 A;  4OMY A;  4XLN F;  4KFC A;  4CIC A;  1IRF A;  3RCO A;  3JTG A;  1IN4 A;  3BZK A;  4A3E J;  2BEO A;  2HKO A;  2F4I A;  1KGS A;  3KP7 A;  4BBS J;  3OYK A;  3GTK J;  1OLT A;  2ZNZ A;  4YRV A;  3ZMS A;  4A3G J;  4HF0 A;  1BI1 A;  4FX4 A;  2AXL A;  2XHK A;  4CCN A;  2ZC2 A;  3NEU A;  3T1B A;  3TO6 A;  3HKZ A;  3MKZ A;  4YG2 F;  1Z3Y A;  1U6G A;  1LEB A;  3K1P A;  2AQE A;  4HA8 A;  3IL2 A;  3MZ8 A;  2FOK A;  3HL2 A;  4H0E A;  3Q0W A;  2CV0 A;  2X1C A;  1XGN A;  3LSM A;  5E17 F;  1IUY A;  2KIS A;  3M3Y J;  2GXG A;  2LRE A;  1A31 A;  3HEF A;  4Y15 A;  2L3D A;  2MH9 A;  4BXU A;  3M1C A;  2M87 A;  3ZXS A;  3ZN0 A;  1POG A;  1MZB A;  4AYB A;  4AIJ A;  2L9N A;  1YOV B;  1U78 A;  2NVY J;  3E3V A;  4II2 A;  3OYL A;  1ZAR A;  1LVK A;  3MKW B;  4RGX A;  3C3W A;  4JBA A;  1GV2 A;  2Y0S N;  5BNG A;  1E2X A;  5GAD J;  4NC7 A;  2F2E A;  1VQO I;  1N75 A;  1R49 A;  3DKW A;  1E3P A;  3HB9 A;  3VDX A;  2IS1 A;  2WAQ A;  3JAM K;  2VOO A;  2JA6 J;  3W2A A;  4ZDL A;  2ZKZ A;  3BJA A;  3E5Q A;  2STT A;  2HTJ A;  2PMU A;  1Y56 A;  2YU9 J;  2HKX A;  2FX0 A;  2VQH A;  3CO6 C;  2DA2 A;  4FE4 A;  1O7L A;  3HUG A;  2CS3 A;  3I9V 2;  4W1U A;  2ZNY A;  2XRO A;  4KMF A;  1J7K A;  3LL7 A;  2RKH A;  3RI4 A;  2H27 A;  3B73 A;  3DBH B;  1SAN A;  4XSZ F;  1ZGA A;  3BR3 A;  3JW4 A;  3K4J A;  4BGD A;  2F4O B;  5F27 A;  2FNA A;  2ZJQ F;  4UVA A;  1R36 A;  1VQ7 I;  2ME0 A;  2NAZ A;  2P5K A;  3G73 A;  3RSN A;  2VPR A;  2EB7 A;  3HRM A;  4I99 C;  2X6O A;  1ZK8 A;  2GWR A;  3G3Z A;  5CVJ A;  2CSO A;  1W1W E;  1JHF A;  4WCG A;  1FSH A;  1V5G A;  2GA1 A;  2K3F A;  3I5U A;  4QPQ A;  4N9I A;  4OIN F;  3CC4 I;  3QP5 A;  4S0H B;  3KP6 A;  4BY1 J;  4HDU A;  1OCT C;  2PJP A;  2QF7 A;  5LEJ A;  1KA8 A;  1FX7 A;  4IVN A;  5F04 A;  4JX5 A;  2XKO A;  3PQJ A;  3VYT B;  2V1U A;  3N05 A;  2H09 A;  3ELK A;  1CF7 A;  4M3B A;  4LG0 B;  4II3 A;  2JPB A;  4FHT A;  1Y8Q B;  2B9S A;  3GTG J;  5K7H A;  2HZT A;  2ISY A;  4KUM A;  3F8M A;  1V4R A;  4PGG A;  2Y0M A;  2ID3 A;  2LMD A;  2L9S A;  2XSJ C;  3MWM A;  5FFX A;  4M3G A;  4RBO A;  1IXR C;  2EQR A;  3RPU A;  1FSE A;  3F9K A;  1ZQ3 P;  1E17 A;  1X1D A;  1Z6R A;  1HXD A;  1Y39 A;  3F8B A;  2V1X A;  4RAZ A;  3TW6 A;  1E3O C;  1BOB A;  4M74 A;  4A5M A;  4YFK F;  4G7O F;  2L9V A;  2OU2 A;  1JJ6 C;  5FRM A;  1U9O A;  2LNB A;  3DBR B;  1XSV A;  3HRU A;  2E2H J;  1K61 A;  3CCJ I;  3HKZ N;  2HQN A;  5TGT A;  1VQ8 I;  3ZPL A;  1S6L A;  1P2F A;  5BPD A;  2E19 A;  1X1B A;  1RKW A;  2WAF A;  4OAY A;  3I56 I;  3KEO A;  3JRB A;  3AAF A;  4XLC A;  5IYD J;  3KZZ A;  2K7L A;  2UXX A;  2JK3 A;  4GO1 A;  3QWL A;  1LDK B;  1T08 B;  1IJW C;  4ENJ A;  4A3C J;  4UV8 A;  3IH3 A;  2BHY A;  3PUF A;  2COM A;  2XDV A;  2DJI A;  1MW7 A;  3U1D A;  5IP7 J;  2L5Q A;  3VFZ A;  1UG0 A;  1QBJ A;  3HTS B;  4P9F A;  3JRC A;  2EH3 A;  5E3N A;  1X3Z B;  3ZOB A;  3ZQH A;  2OC6 A;  1JE8 A;  2QLZ A;  2AO9 A;  4JP0 A;  5LHH A;  1MBF A;  2W4S A;  5FD6 A;  3QYE A;  2Y9Z A;  1YIT I;  3GZ6 A;  4E7J A;  1WH7 A;  1IZ1 A;  3P7N A;  4LK0 F;  3V7R A;  1ZG3 A;  3CP2 A;  3Q0U A;  3J7A Y;  3QOD A;  3HZJ A;  2CW7 A;  1CF7 B;  1YRN A;  3MN2 A;  1MDM B;  2E5N A;  4HW0 A;  2IA0 A;  4PFO A;  3I54 A;  4U7B A;  4QWQ A;  2A6T A;  4XLP F;  1R4M B;  3V4G A;  4FIS A;  4P9U A;  5K7F A;  1BBY A;  4LG0 A;  3RDI A;  3SZT A;  4L9V A;  2QA4 I;  2MH2 A;  3E97 A;  4YIF A;  1MBH A;  2VBY A;  2BY0 A;  3I0T A;  2LH9 A;  3TDZ C;  3C7J A;  2W82 A;  3TL4 X;  2OV7 A;  3BJ6 A;  4P5O A;  4EM0 B;  4NC6 A;  1RNL A;  2V26 A;  3F72 A;  1FOY A;  3TDU C;  2LY9 A;  2W84 A;  4BQN A;  5FJ8 J;  3KYD B;  3F22 A;  5E8I A;  2XGE A;  1ZYR F;  1R1V A;  2NYX A;  3CUQ B;  5A2Q K;  5LRR A; 
#chains in the Genus database with same CATH homology
 4C2T A;  3EUK L;  1AA7 A;  1S9H A;  3OS1 A;  4RMN A;  5CKT A;  2X6W A;  5HNH A;  1T0F C;  2VXZ A;  4BQO A;  2HPI A;  4F3Q A;  2LRD A;  3OWT A;  1D0X A;  3LFU A;  2VQG A;  3E0J B;  2ELJ A;  2XF6 A;  2MAB A;  4CCO A;  2AQF A;  4B43 A;  4XKV A;  3S3M A;  2Z16 A;  3OYG A;  1E0E A;  4XLE A;  2CMP A;  2DOA A;  3BCB A;  3PL8 A;  2CFO A;  5CPR B;  3ZRG A;  4XN0 A;  4KIS A;  2HU9 A;  4E7S A;  3PSF A;  2VAS A;  2CV2 A;  4EAT A;  4LG3 A;  4N4O B;  1X4P A;  2BVM A;  4NQW B;  2JUG A;  3IUO A;  3VYS B;  3DPT A;  2V9K A;  3PNV A;  4PJJ A;  3K4K A;  2ZSI B;  2MD0 A;  1N77 A;  2MC4 A;  3SYT A;  4PSX A;  2JA2 A;  4F55 A;  3L2V A;  3OIQ A;  4E7K A;  2WAD A;  3AKZ A;  2FUG 2;  3OYE A;  4BE1 A;  4OWR B;  1BR1 A;  2M7B A;  4B47 A;  4ZDO A;  3C2G A;  1N78 A;  1SAU A;  3PNT A;  3OR2 C;  1G59 A;  3BG6 A;  4KJZ A;  4NNJ A;  4ZJZ A;  1D1A A;  3LMM A;  2NOJ B;  4DBR A;  3PFY A;  2LG4 A;  1D1B A;  3OIP A;  5KNL A;  4XN3 A;  3SEQ A;  4JOM A;  1WJ5 A;  4IX7 A;  4NC8 A;  2DT7 B;  2Z2S B;  4BUP A;  3MKY B;  3S3N A;  4XOP A;  1WJD A;  1WJB A;  1WJE A;  2UWM A;  4RM3 A;  1QHG A;  1DGR M;  2V7F A;  3OYC A;  4BQQ A;  2LBF A;  1QHH D;  3K6G A;  3H0D A;  3H5R A;  2OUM A;  4QPO A;  4ZC3 A;  3OR1 C;  1R6R A;  2CH0 A;  3OYJ A;  3VSK A;  2X51 A;  3ZR8 X;  2QKM B;  5FRO A;  3HOS A;  4KT6 A;  3SZG A;  2HPM A;  1K6Y A;  3AFH A;  4G6T B;  2JSP A;  3CZ6 A;  4ANJ A;  3FBN B;  2JVG A;  2P0W A;  2HNH A;  2XAU A;  2V1N A;  1V5E A;  2VKD A;  1X1C A;  1Z3X A;  3OYB A;  4AVZ A;  4CA0 A;  2IGO A;  2XF5 A;  1DP3 A;  2KHM A;  2LY1 A;  4YEJ A;  4BEH B;  3E1S A;  3MD2 A;  2RRE A;  3W2V A;  1WFX A;  4GRI A;  2K3P A;  3OYH A;  1WJC A;  2DT6 A;  2A5W A;  4BL0 B;  4CCJ A;  3QOE A;  5KHD A;  4XKC A;  3SEZ A;  1W36 C;  4DIQ A;  2PMZ A;  1MND A;  1UAA A;  2E5Z A;  3VWB A;  4LIU A;  2VJI A;  2RNG A;  2UUZ A;  4XL9 A;  4XKB A;  5CQE A;  3K70 D;  3OL4 A;  5FRN A;  2M4K A;  1MMN A;  4BJ6 C;  4JQF A;  2LYC A;  5HVQ C;  1P9Q C;  3OOU A;  1J09 A;  2E60 A;  4E7Z A;  1WJA A;  2ZXH A;  5CQG A;  4XKW A;  3DTE A;  4RLQ A;  2WY8 Q;  1FMV A;  3ONQ A;  2K9M A;  4HEA 2;  4HNT A;  3GBG A;  4P1W A;  4F91 B;  2X1E A;  4H4K C;  2RQQ A;  1YX3 A;  4U87 A;  3D5L A;  3DU5 A;  3VYU B;  4N4N B;  1EA3 A;  3OYF A;  3H5A A;  1ERD A;  2M3A A;  4C2U A;  2DXI A;  4XOR A;  4F92 B;  4HRI A;  3L2R A;  4IKF A;  2HDW A;  2R7O A;  3K4N A;  3FHN A;  2E1M B;  2Y0S A;  5HNF A;  3KYL A;  2VXD A;  1PYV A;  3AL0 B;  2KZV A;  2W00 A;  3A4C A;  4XLA A;  4Y33 A;  3VSL A;  4BJ5 C;  3OYM A;  3C2H A;  1LKX A;  3LSI A;  4BE2 A;  4PJN A;  2F5V A;  4J00 A;  4IQJ A;  2X6Y A;  4LIT A;  4C9Y A;  3NWS A;  1X1A A;  2HVS A;  4XLH A;  3FKJ A;  3CP8 A;  3I3L A;  3KX2 A;  4IQ4 A;  1MMD A;  1JI8 A;  1ZEL A;  3IAM 2;  1G8X A;  3CJR B;  3K4C A;  3ZQQ A;  4CZC A;  1D0Z A;  2L2O A;  2IGM A;  3K4L A;  1OR7 C;  3FDY A;  2F6C A;  4YEL A;  3DWL E;  1NG7 A;  1QU3 A;  1PJR A;  3QYB A;  2V4J C;  3BC8 A;  2LC2 A;  4B48 A;  4BU2 A;  2R7X A;  3W3C A;  2IGK A;  3H9G A;  3V42 A;  2R7Q A;  2BVL A;  4PFP A;  2O5R A;  4HST A;  3DQV C;  4DGW B;  2Z1D A;  3HXL A;  1U0J A;  2VJJ A;  4CH7 A;  3DKY A;  2BOL A;  3HG9 A;  1V5F A;  3EPZ A;  2K9L A;  2JVH A;  1Z7L A;  3RPU D;  3UNG C;  3RQ4 A;  2Q1Z B;  2KDO A;  3EUA A;  2VB6 A;  3H9J A;  2R7W A;  3HOT A;  3L2W A;  1HA8 A;  1BR2 A;  3DKX A;  3LSG A;  3PSI A;  4ZDP A;  2BW3 B;  4PJL A;  2R7T A;  2IS4 A;  2CUJ A;  3IP4 B;  1YX5 A;  2VJ5 A;  3OY9 A;  4LIV A;  2VKH A;  4CUG A;  3ZCO A;  4D1Q A;  3RCO A;  5LD2 C;  2IXS A;  2X6X A;  3RTR A;  2F4I A;  1LFP A;  2KRH A;  3OYK A;  1OLT A;  4YRV A;  4PJM A;  2Q2E B;  3TMO A;  4DOZ A;  3PUB A;  2E1M C;  4CCN A;  2R4G A;  1FMW A;  3K10 A;  2KL4 A;  2WAE A;  2HQA A;  3HKZ A;  3MKZ A;  2KMU A;  4OAZ A;  4BXF A;  5JHF A;  1Z3Y A;  4BDY A;  2AQE A;  3HL2 A;  2CV0 A;  2X1C A;  3LSM A;  3BCA A;  3DTI A;  4XNF A;  4ZTJ A;  2LY2 A;  5LFA A;  2LRE A;  2WB1 A;  4E6K G;  3M1C A;  3HPH A;  3ZXS A;  2L7K A;  2VPL A;  4AYB A;  2L9N A;  2WA0 A;  3CJQ B;  2W7N A;  1MNE A;  4II2 A;  3OYL A;  1LVK A;  3MKW B;  2MFZ A;  4NC7 A;  1N75 A;  3S32 A;  3H35 A;  2M7A A;  3H5N A;  3VDX A;  4XM3 A;  2WAQ A;  2IS1 A;  4Y4R A;  2IS2 A;  3W2A A;  1NG6 A;  4ZDL A;  4BAC A;  4E7L A;  4B3X A;  4IZZ A;  3QYF A;  4HSR A;  3IAS 2;  1Y56 A;  2GOM A;  3OYI A;  4C30 A;  2VQH A;  3CES A;  3DU6 A;  2PJR A;  4CCL A;  1X4O A;  2CS3 A;  3BG7 A;  3HPG A;  4BDZ A;  3I9V 2;  3A2K A;  3LL7 A;  4HNU A;  4CCK A;  4ITV A;  1MMG A;  3S93 A;  3M8J A;  3K4J A;  3VYR B;  4BGD A;  1TZL A;  2MYS A;  1DGW Y;  2UV1 A;  2X1D A;  3DEE A;  4HG2 A;  1W36 D;  2GOX B;  2KP6 A;  3RSN A;  2VJ4 A;  4XQF A;  4E7I A;  1IRX A;  3UR3 C;  1D1C A;  2VQL A;  1Y6I A;  3FBI B;  3K4B A;  1SFK A;  5HOO A;  3K70 C;  4HPQ A;  3L2Q A;  2V6E A;  2VL8 A;  1V5G A;  4ZYA A;  4QPQ A;  4XR6 A;  5HLT A;  3KEY A;  4BE0 A;  4RLF A;  3PNY A;  2KPM A;  2PJR B;  4ZTF A;  3OS2 A;  4Y3O A;  2VLA A;  1TT0 A;  4KIT B;  3A1Y A;  4PUS A;  3VYT B;  3N05 A;  3D5S C;  3EUH C;  1Z21 A;  4II3 A;  3DPL C;  4FAS D;  3OS0 A;  2QKL B;  2ZSH B;  4E4H A;  2ZXI A;  3OYN A;  4AU7 A;  3BLY A;  2XSJ C;  2L9S A;  3OYD A;  1X19 A;  3LSH A;  1WJF A;  2KRC A;  3NWT A;  1BR4 A;  3F9K A;  4BS9 A;  4BEH A;  1X1D A;  4X0G A;  2XF7 A;  3ZGK A;  2KLO A;  1BOB A;  2VIX A;  4DJA A;  5FRM A;  2W1O A;  4J01 A;  3TBI A;  3U21 A;  1GLN A;  2K5C A;  5TGT A;  4XMY A;  2M0M A;  4B44 A;  4XOT A;  2IS6 A;  3HC7 A;  4RM2 A;  3HUG B;  1MMA A;  4PK4 A;  1X1B A;  2WAF A;  3DPU A;  4OAY A;  3W2W A;  2WY7 Q;  4MLO A;  2LBF B;  4XLC A;  4CSW A;  1LDK B;  4PSW A;  3G2B A;  3DTK A;  2I8D A;  4BJT A;  3S3O A;  2WBM A;  3MMY B;  3SDB A;  2R7S A;  3OYA A;  4F93 B;  4CCM A;  2HVQ A;  4NUB A;  2KQR A;  2DJI A;  1MW7 A;  2XDV A;  2L5Q A;  1UG0 A;  2R7U A;  2IGN A;  2HVR A;  3L2U A;  3H9Q A;  2OC6 A;  3OMY A;  3CF2 A;  4FET A;  3D5R C;  4XON A;  2W4S A;  3QYE A;  3OL3 A;  4E7H A;  1VZ0 A;  4E7J A;  2BW3 A;  2CV1 A;  4R79 A;  3CP2 A;  3J7A Y;  3QOD A;  4XLF A;  2CW7 A;  4DBQ A;  2R7V A;  2E5N A;  3CMM A;  2ZFU A;  4PFO A;  4U7B A;  2A6T A;  2DCE A;  2CW8 A;  2M4G A;  3AL0 C;  3PJR A;  2CUZ A;  1KON A;  2LOO A;  3DLA A;  2R7R A;  2XC7 A;  3K4M A;  4D9J A;  5KCM A;  1DQU A;  2HZD A;  2LH9 A;  2W82 A;  3TL4 X;  1D0Y A;  4F52 A;  2VQC A;  2OV7 A;  3S8P A;  1UEL B;  4P5O A;  1YE9 A;  2V26 A;  4BQN A;  1T95 A;  3LSK A;  2X85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...