2M4KA

Solution structure of the delta subunit of rna polymerase from bacillus subtilis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
b'GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title Structural Study of the Partially Disordered Full-Length delta Subunit of RNA Polymerase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4kA00
4NC7A 2M4KA 2KRCA 4NC8A
chains in the Genus database with same CATH superfamily
2ZMEA 4DBQA 3L2WA 2W7NA 4CGZA 3CJTB 1A36A 3ONQA 2IAIA 2ZB9A 3ZN0A 5C4JJ 2ZXIA 4NBQA 4V2FA 3S14J 2A69F 4EVIA 3PNVA 1HW5A 4MQ9F 1K83J 3AG2H 2VBZA 5LHIA 1Z7UA 5LBQA 1VQPI 1G3YA 1W36C 5IOYA 2E2JJ 5DV5A 1R1UA 2QBYA 1UMQA 2QENA 2FOWA 1I1GA 3DWLE 5J40A 4ESJA 2D1HA 2WB1A 3H9JA 4RM3A 1LDDA 2FXAA 4BJTA 4RB1A 1S5LC 2KRHA 5LFAA 4XR6A 1PDNC 2VXDA 2IA0A 4M72A 5EGOA 2BVMA 3HOVJ 2QUFA 1S9HA 2VBYA 4JK1X 1F43A 3JAMK 2Z1DA 3IWFA 2EFNA 2HWVA 1ZGAA 1B9MA 5EF6A 3KEYA 4CCNA 1JGGA 4L5EA 1XCVA 1QO0D 3PFYA 1LNWA 3Q9VA 2XKPA 1SANA 1A6QA 1I3QJ 2OCCH 2HPIA 3GTLJ 2FJ1A 1OQYA 2JUCA 2J5OA 2VT2A 1HKTA 2A6TA 2P7VB 4A3EJ 3LA7A 4JYKA 5KHDA 3WG7H 1Y1VJ 3BROA 2DYSH 4D1QA 2E1MC 1TBXA 4A6DA 2RREA 3E5XA 4HRIA 4OIPF 3S1MJ 1P7JA 5CPRB 3RKQA 2I5UA 2XPUA 2LC2A 1RETA 2DMNA 2V1NA 4S04A 1B9NA 5FLVA 1ETKA 3TGNA 4PUSA 2HVQA 2M0MA 4Q4ZF 4BS9A 4R79A 2COBA 3CO6C 2HYGD 3RKXA 2HXIA 3T8RA 1Y0NA 3DBRB 4I09A 2HDCA 3JR9A 1LFUP 4IEJA 3S1QJ 4U87A 4IX7A 4IKFA 1Z67A 5EEGA 3FWEA 4UHTA 1ZGJA 2MH9A 2X1CA 4AYBN 2M7BA 2DQLA 4DBRA 3L2UA 5AONA 1BR1A 2BE5F 2H6BA 4D7MA 2IVMA 2XAUA 3LNQA 2R7OA 1OR7C 4IHSA 2HFHA 3ZMUA 1SD7A 2XGEA 3ZXSA 2FQ3A 2HOSA 5LRSA 3GTKJ 2W84A 3I4PA 2CWEA 2F2EA 3E6MA 4OOIA 1J5YA 5GTHC 1B72B 2F4MB 1BJZA 4M3GA 2HS5A 3H3ZA 1OPCA 3BCBA 1VQ6I 2CUZA 1RRJA 4XONA 1R6RA 4XLHA 1A35A 1OCTC 2XC7A 4KT6A 3ZP5A 2LG4A 1WJCA 2FU4A 2OQRA 3M7GA 1YIJI 3JREA 2RN7A 3O8HA 1CGPA 4NHJA 2KP6A 3ZQFA 3F8CA 1QPMA 3FBNB 5EZHA 1SAXA 2ISZA 4B1RA 4U7BA 1B6AA 1USSA 1HW1A 2CG4A 2HI3A 5K1YA 1T2KA 3JSPA 3V8KA 3CDLA 2R7WA 2WAFA 3FKJA 2VQHA 1X58A 2W85A 4MFDA 2VB6A 3K9TA 2G0EA 2Y69H 3QP6A 3GF2A 1AOYA 2V6CA 3ZN1A 4M6YA 2NNNA 2XB0X 1FJLA 3BG9A 4IHYA 3HHHA 3P9CA 4LK0F 2Q1ZB 1P7IA 2F4OB 3F0CA 1QZYA 4J00A 4YEJA 2RGVA 2XB5A 4XKVA 4HEA2 2LNBA 3OS1A 1KA8A 1IO2A 3MD2A 2EIJH 3AAFA 4UNOA 2DBBA 1ETQA 1T8IA 4FQGA 3LFKA 4E7HA 1HBXG 2LF7A 2DMTA 4FX0A 4GDFA 2IGNA 3CMYA 4JX4A 1IDYA 2OAZA 3L2RA 1ERDA 4Z2YA 3LSKA 4KJZA 2DA3A 3RPQA 1X2NA 1G2HA 1YJWI 5E1XA 1OLTA 4MHGA 3HOSA 2STWA 2FA5A 2L5QA 4DW6A 1NG7A 3OYKA 2IXSA 1LFPA 5E3LA 1Z05A 2HYJA 2UUZA 3ABMH 3CUQB 5ICEA 1ZRCA 2VODA 4BL0B 4A12A 4AU7A 3OYIA 3I3LA 4OAYA 2IS2A 1UB9A 3QYEA 2FD5A 1S29A 2DTRA 4A3JJ 3L00A 3RKWA 2EILH 1J7KA 5BS6A 1HA8A 2PI0A 2KT0A 1MBGA 4G94A 1T95A 2XGDA 3QODA 4B48A 3ZMDA 3P7NA 3SJMA 3WTWC 1P4XA 3QU6A 4II2A 2R7RA 4JOMA 2YS9A 3Q3SA 4YIIA 2CV1A 1OYIA 3OOPA 3V42A 1SVOA 3S93A 3FXLA 3TDUC 3CF2A 1C0WA 1YW9A 5JHFA 3JTHA 2EQRA 1HF0A 1QHGA 1U5TB 1G3TA 1Y39A 3HSRA 1FBQA 3HUGB 3SYTA 1YQAA 4N4OB 4NB5A 4CXFA 1O3QA 2IW5A 1UJ8A 1PUFB 2TDXA 1D0XA 2HR3A 5J6XA 2LOOA 2K40A 2MA3A 4UVBA 3M4OJ 1SD6A 2H94A 3CP8A 3FMQA 2K5CA 1TWCJ 3OOUA 2O6GE 1KU2A 4MGRA 5D6FA 4ESBA 1RUOA 2R5ZA 5F1RA 1MMSA 3GFJA 3JRHA 2CQQA 2DODA 4O5VA 1B59A 2QQ9A 1V5FA 2BXYA 1XCBA 3VOEA 4X1EA 1E2XA 5J8CA 1K4TA 4XRFA 4B43A 3G73A 4XKWA 4X0GA 4UV8A 1GLNA 1GV5A 3I58A 4RB3C 1W36D 4XIDA 3P5JA 4KMUX 2KIQA 2VJIA 2BVLA 1DP7P 4XN3A 3H3UA 1Y1WJ 3I71A 2M5WA 1E3PA 5LHGA 2LDUA 3PO2J 4E6KG 2NS7A 1MSFC 1WJDA 2W48A 3RCOA 2NVQJ 3J80Z 2NNYA 4XRSA 2E1OA 3QYFA 5L3GA 1XN7A 1YX5A 3FK7A 2L02A 4RGRA 3K2ZA 1N75A 3VDXA 2FRHA 3EDPA 1F1ZA 2WAQN 4F52A 5E79C 3OR1C 5IP9J 3ECHA 2V9VA 4M6XA 4C9YA 1ZRDA 2R7UA 1LFBA 1O7FA 1YI2I 4P9UA 1DPUA 5E3MA 4BDZA 1U9OA 3PO3J 1JGSA 1XX5A 3I0TA 1WJAA 2GM4A 1GXPA 1V54H 2BY2A 2DPDA 1W5CC 5EZGA 3M1EA 1DDNA 3AL0B 1U2WA 4E7JA 3OYJA 4IHTA 3VYTB 2DW4A 3M1CA 1ZLKA 2DMQA 4EJOA 1R22A 2GXAA 4EGYA 2EFWA 1IN4A 2A68F 3TEDA 4ON0A 4L9VA 3LAPA 4BBRJ 2HKOA 2AXLA 2XF6A 3PSIA 4XLAA 3AG1H 3GXOA 4KIBA 1HQCA 5J47A 1HXDA 3QOPA 3QU3A 4BQNA 4KN4X 2GQQA 2VJ4A 3BPVA 1EV7A 2HOEA 5CJ9A 2OU2A 2XHKA 4IXAA 3I55I 3R6SA 2DTZA 1HC8A 3K69A 1MBHA 5H2FC 2GOXB 2NVUB 4G7HF 2WADA 3H1CA 5IPAA 3HBLA 3E0JB 2E5ZA 1D0YA 2X85A 4XLCA 2IS1A 2VONA 3BR5A 2ESNA 4B09A 1H89C 1QZEA 3F23A 4LFUA 3J80K 2KPMA 4YFKF 3GWZA 2FBKA 2GIVA 3FHNA 1IRZA 3HTSB 4HV6A 4WCGA 3F72A 3DBLB 3SZTA 2AHQA 1LE8B 2E1MB 3P9KA 5D5XB 2CU7A 2MFZA 2V9KA 2HOTA 2P6SA 3BTCA 1I50J 2WAQA 2LF8A 3F6VA 2O9LA 3OWTA 1VQMI 4BH9A 3GFMA 3W3CA 2W00A 4EJWA 1XGSA 5HOOA 2DOAA 3CTAA 4PCQA 2CUEA 3W2AA 4KYWA 4IOCF 2WA0A 3K1NA 2KJCA 3L9FA 3OR2C 4PJNA 3VSLA 4ZYDA 2OF7A 4KIFA 4I7HA 4FISA 5IOZA 2XAJA 3J81Z 2NXNB 1JKOC 4NC6A 1HSTA 3HHGA 3CCJI 1YYVA 3L2CA 2Y0SN 5KAIC 4XK4A 5JVTA 3H92A 3F8MA 3RPUD 1IG7A 4WXCA 4IPAA 2DPUA 1AHDP 1MNEA 1ONVA 3ZQLA 4RGXA 2Q2EB 2ZSIB 2UXXA 2EZLA 2UXNA 2E60A 1B1BA 1Q1VA 1UG0A 2MH2A 1HW2A 4P1WA 2O8XA 3VYSB 1GV2A 3HJEA 3AKZA 1FYKA 2ZO4A 3O8GA 3OS0A 4RAZA 4D5CA 2DJNA 1T0FA 3C2HA 3FF5A 4N0BA 3A01B 2RQQA 4ENNA 5ICGA 4ENJA 4Y33A 3E6DA 2P5LC 2O61A 5JI6A 1J75A 5LEKA 4EQQA 1ZHFA 4C2UA 2D45A 1FWZA 2VXZA 2W82A 5DM7F 3ZGKA 3I9V2 1JKRC 2JA7J 1GHCA 3CO7C 4BQOA 1JT6A 1RIOH 3OIOA 2F5FA 3HG9A 2QGUA 1WJEA 4G7ZF 4PGGA 4M3EA 1T6SA 5DCMB 3DV8A 5ICFA 5CLSA 1IXSB 1U5TA 4EGZA 2JPBA 1FOKA 3HUGA 3CCVI 1I1SA 2RAEA 2KZGA 3GVAA 4LLNA 1O7LA 5E3NA 2KRFA 2FE3A 5KAFC 1QZZA 4A3IJ 1R36A 4QIWN 1PUFA 2CW7A 5HLGA 4HOBA 3GCMA 3RIRA 3J81K 2MD0A 3MKLA 4PJMA 1VQ9I 2VBXA 2G9WA 2UZKA 5M5YJ 2X1DA 2JA5J 4XMYA 1IN6A 1ETXA 4ZZLA 4I2OA 1AA7A 4XKBA 4LGWA 4M9SA 4JX6A 4E7SA 5CQEA 1WKMA 1KU3A 2PMHA 3WHCA 3T1BA 4A5MA 5B5EC 1V3FA 3WODF 3IV5A 1LVKA 4HDUA 4CYCB 3MN2A 3QWLA 3EUHA 1LQ1A 1IC8A 3BG6A 1HLVA 1UFMA 2L2OA 4XKCA 1WPKA 3GLLA 4C3JJ 3GFIA 3I64A 3VFZA 5ED4A 3BLYA 1UCRA 3G3ZA 1EH6A 3CD6I 2PBIA 3KETA 2BY3A 1J09A 3K1MA 1LKXA 5K5QA 1IF1A 3OIPA 1ODDA 2STTA 3SEQA 3A02A 4CCJA 1R4NB 2HDWA 3OYHA 4A93J 5GTIC 5D5WB 3ZR8X 2K9LA 4NC7A 3JTGA 2VKVA 4YIRX 4YFNF 2DDBA 1EKEA 2ID6A 3WTTC 5ICCA 2PMZN 4LK1F 4XM3A 1T33A 3F8NA 1JTYA 5FD5A 3GZ6A 4CCLA 3FXOA 3CC2I 3CCMI 2I8DA 1QNTA 2BHZA 2LFBA 3Q0VA 3JSOA 1O4XA 1MD0A 4I76A 5DCFA 4MEYF 3ASOH 1QVUA 4ZDOA 5HNFA 2LKSA 1L3LA 5CVJA 2OA4A 1D3YA 5HNHA 1PVEA 4HSRA 4B3XA 2CSOA 2V1UA 4RAFA 3BTIA 3WE2A 3G71I 5K5RA 1I3AA 4GFBA 2IS4A 3RSNA 3RZDJ 1SAUA 4B3AA 3BQYA 1D0ZA 2A61A 4RDUA 4HSTA 4KT5C 1FYLA 1IN8A 1OCPA 2VKEA 4DZPA 2K27A 4C2MJ 4IHVA 2LMDA 2DI3A 4ZDLA 1H88C 2AXTC 1QBJA 4E7ZA 4RM2A 1XSXA 2IRFG 2K85A 3B6AA 1SFUA 1FMWA 5LRRA 1ZK8A 1ZREA 4BU2A 2WV1A 1FY7A 4PJLA 1QGPA 5JLWA 1VQKI 1JKQC 2R92J 5J4YA 2BOLA 2WY7Q 3K6GA 9ANTA 5F1JA 1R5ID 4ITVA 4Q48A 2ZC2A 2FUG2 3DKXA 2RNGA 4XOTA 1O3TA 4LOCA 1U8BA 1IW7F 3C3WA 4XNFA 1MBEA 3KLOA 4LIVA 1F36A 1LE8A 4PSWA 3L1PA 1MJAA 3PSFA 2X4HA 1OKRA 2P5VA 2IA2A 3K7AJ 4GYIA 4AC0A 4JX5A 3BP8A 2VC1A 3BOQA 5BPDA 1SEUA 2KIFA 2DMPA 2FMYA 4BQAA 1PYVA 2EA2A 3A03A 2CS3A 3DTEA 4L5IA 2V1DA 3P9IA 2QVOA 1MIJA 5CYVA 1QQIA 2NS8A 4IRHA 3WGGA 3I4MJ 4HNVA 1IJWC 3DQVC 1RR8C 2X51A 3NEUA 3T0YA 5GAEJ 4LB6B 2WTEA 1PP7U 3H5AA 2CJJA 2R7XA 1TL8A 2MGQA 1FNNA 1YO5C 1Z7LA 3AFHA 1MNDA 1ZLJA 1MKMA 1IN5A 1APLC 4I6ZA 4HF1A 1TNTA 4UUSA 1YRNB 1FSEA 4CZZA 3L7WA 3VODA 4BAYA 2JMWA 1ITYA 1VF9A 3ZQIA 2Q2EA 5DM6F 4OAZA 2KZVA 1O3SA 3JRCA 2DA4A 3IKTA 3LSMA 3A1YA 4RB2C 2ZMEC 2QF7A 4CUGA 2XASA 4P96A 4BUPA 4ZJZA 1W0UA 1O3RA 1BL0A 2V6EA 4G7OF 2FNPA 4LG3A 4B44A 1Z21A 2M30A 3A01A 4GYGA 2ESHA 1J2XA 4HBLA 1TW3A 4PFPA 2P81A 2EV0A 2Z2SB 3GTMJ 1P4AA 1VZ0A 4GRIA 4N4NB 4DGWB 1U3EM 2WY8Q 3IHUA 5BNGA 3F3XA 3PIPF 2ZJPF 4ENMA 1D1AA 3OYMA 2MC3A 2LBFB 2ZSHB 1BOAA 3SFIA 1XSVA 4HYEA 3CCQI 3LA3A 4H4KC 1BW5A 3FXRA 1MBJA 3JRGA 1PJRA 1WGXA 4G8XA 3MZ8A 4BXXJ 1WJ5A 1H9TA 4BHBA 1ACIA 2X1EA 3IH2A 2AQFA 3LSIA 2UV1A 2E1CA 1OJLA 2MC4A 3FKIJ 1HOMA 2A3SA 2L9VA 4XBFA 4XRSG 1F9NA 2L7MP 2JSCA 3R0JA 4P9FA 2Z9OA 4XICA 5FRMA 5DD8A 1QRYA 3F9KA 5ILVA 2MSYA 2E7WA 2JTVA 2X9DA 1LJ9A 2M3AA 1A5JA 2E1NA 3EYYA 5E1WA 3KP5A 1I39A 4U0YA 4U88A 2ZJRF 2HZDA 4IVNA 2E2IJ 2HU9A 3K10A 4LLLA 2CFOA 2MABA 2DYRH 3QAHA 1L0OC 3QQAA 4XSXF 4CYCA 5FJ8J 5D4RA 4M9ZA 3JCUC 2R7SA 2NS0A 4AIKA 1YS7A 3QRFF 1FX7A 2MYSA 2W57A 4OIRF 2VUMJ 2BV6A 2K4JA 2L01A 2DA2A 1DPRA 2O03A 1G6NA 1YS6A 1H8AC 2PG4A 2VT3A 5L3EA 4XLEA 1LEAA 1MMGA 5F64A 4N9IA 2F4IA 1DU0A 1ZKGA 1T98A 3KYDB 3MVPA 3S2HJ 1TT0A 1XTAA 3TO7A 3HGGA 2HYFA 4PZJA 3R0AA 5F04A 3WTUC 3IP4B 2HOAA 3QPLA 2EINH 2P7CB 3AG3H 3RZOJ 2X6XA 3F21A 2EV6A 2VE8A 1MBFA 3I56I 2VJJA 2Q8KA 3OYLA 5D8KB 3JRBA 2XVCA 3LAJA 2L9SA 2PFBA 2XKOA 3PJRA 4EV0A 4FETA 2OPTA 4AYBA 1BJAA 2PMUA 3UNGC 3TP0A 3WU2C 1QVTA 4OIQF 2E2HJ 2MLKA 2HXOA 2ACJA 2CQKA 2E7XA 2IGKA 3ISPA 4BNCA 3BWGA 2F5EA 2FQ4A 2EFPA 2IA1A 2ISYA 2YX7A 4IHWA 1W7PD 2R7QA 3K4MA 2XIGA 5CVRA 2DQRA 4RLQA 2TRTA 2WBMA 4BY1J 4FT8A 2EZHA 2KIUA 3AG4H 4UXNA 5DS9A 4AD9A 1XGOA 1F4KA 2BY0A 4KA4A 5TRDA 5D8LB 2DT6A 1YOVB 4EJVA 4F93B 2YU9J 1FSHA 1T08B 3UR3C 2ZCWA 2IEKA 2V1XA 1FPQA 2V9PA 1YX3A 3G2BA 1TT5B 2NVTJ 4EJTA 3F8BA 2HVSA 1HCRA 1EH7A 3E7LA 2CQXA 4BXUA 2G7HA 5K7ZA 1XPXA 1RKWA 4XLFA 2NVXJ 3F6OA 4OINF 5JHUA 2XRNA 4G6TB 4FE7A 4FTHA 3GTJJ 5FRNA 5LLQA 3TKYA 3S15J 3ZMSA 3E5QA 3GW2A 5LGUA 4BHCA 4RS8A 5JR3A 1JXSA 2ZXWH 2EJRA 3RDIA 2VKDA 1ZAOA 3FX3A 4PJJA 3KP3A 1YJNI 4LG0B 2DFHA 1R9TJ 1G59A 5EDNA 3W6JB 4FHTA 4XSZF 2LK2A 1X3ZB 2W25A 2EFOA 3QYBA 3WGIA 2AQEA 3FISA 4II3A 4ZH4F 3ZMZA 2HQRA 4F3QA 2M2EA 2QZ8A 2CO5A 4N9HA 2ZKZA 1YJ9I 4DZJA 3LOCA 5FROA 1D5YA 3DPTA 2VOOA 3BJAA 3HL2A 3KLNA 2CV2A 1K79A 1VQ4I 2DFIA 1LDKB 3OYGA 3BR1A 1ULYA 2JUGA 1WH5A 3ABLH 3TP3A 2F5CA 3MAJA 4F92B 3IH4A 5IT3A 2FSWA 4CYDA 3F8FA 1SVMA 5K7HA 2LSOA 1R4MB 1YRNA 2CYYA 3E5UA 4HV5A 1ETWA 1ON1A 2XGXA 1Y56A 2V79A 2CV0A 3U2RA 1P92A 3G1MA 1OISA 1K7AA 4FE4A 4LD5A 3TL4X 2L9NA 3H0GJ 5HS8A 3A4CA 2X48A 4CHUA 4HDVA 1IUYA 4PJ0C 4DIQA 3SFZA 2CW0F 2BHYA 2XV4S 4NQWB 3N97A 4MTDA 1ZTRA 3BQZA 4L5JA 2QSFX 2GWRA 3U1KA 4HX7A 1T39A 1FC3A 3B6CA 4HAMA 2H09A 1QA6A 3SZPA 1IDZA 1Z77A 3HGYA 3Q5FA 4DYCA 4OMZA 3K2AA 4F55A 4Q5SF 3EQLF 3TQNA 2BW3B 2LBFA 3OSGA 1NG6A 1Z6RA 1Y8RB 3GEZA 3G1OA 5A2QZ 2R0QC 1FTZA 2ZNYA 5ILSA 1WSUA 4A3CJ 4J19A 1RZ4A 3LFUA 2J5PA 3GBGA 1TP4A 3LSHA 5F08A 2R7DA 2LH9A 2FOKA 3EETA 1S6LA 4OU0A 1TWFJ 3GTOJ 3HZJA 1F5TA 4EATA 3QPSA 3L2QA 3VPRA 1Z1DA 1OCZH 2VQLA 3QPHA 1CQTA 1SD4A 5LGNA 2OZUA 2JT1A 2RV8A 4DQ2A 5FB2A 3NQOA 4HPQA 4CH7A 1UHWA 3BJOA 3CJNA 3ZQHA 1B72A 1WJFA 4HNTA 3FHZA 3BY6A 1GXQA 2DO7A 2F6CA 3VWBA 2H27A 1BW6A 4HZFA 1TWGJ 2DXIA 3WU0A 5B1AH 3HOUJ 1B4AA 1DGWY 2VC0A 4G6DA 4A0YA 4AVZA 4BE0A 1X4OA 2RQPA 2RKHA 3ZCOA 4NUBA 3PNYA 3MKYB 1X4PA 2YR2A 1XC5A 3HOWJ 2VE9A 2IGMA 3ECOA 3GTPJ 1K6YA 3WTYC 2FEZA 2CUJA 3KYCB 3J7ZI 1EF4A 4V19K 1KZHA 1XG1A 4BJ5C 5BPIA 4L0ZB 1ETOA 1W4MA 2ZXJA 4A3FJ 3HKZN 2ZMEB 3HM5A 1JUSA 5HS7A 2CH0A 3LSTA 3EPZA 3LMMA 3ZPLA 5TJJA 2MLGA 1AU7A 1S8NA 3X2QH 2DOFA 3HOZJ 4FCYA 3JRIA 4A2UA 3DLAA 1FP1D 3OYBA 1R71A 1YFHA 2L7ZA 1VQ5I 2RVCA 4CSWA 5A2QK 3HOTA 2WC2A 5JVGF 2ZNZA 2RNJA 2P0WA 4QPOA 4A5NA 5FKOA 2QBYB 3DTKA 2EPFA 1A04A 1JHFA 4HG2A 3CCSI 2M9HA 1VFCA 3MKZA 4KICA 5FFZA 3SZGA 1P6RA 3K0LA 3OV8A 3HTUA 3S8PA 4CICA 1ENHA 4E7KA 5KVRA 3ML6A 4AUXA 3BTLA 4M3BA 2JVGA 3GZNB 4HLYA 3TO9A 3LSPA 2O7OA 4RAYA 5LEJA 2HZTA 4A3GJ 1TLHB 4EM2A 5J8FA 3CUQA 3CMAI 3HRSA 3W2VA 4E7LA 4AWXB 4KFCA 1IXCA 3FDYA 2DA7A 1J59A 2H1LA 4D5FA 2DK8A 1UAAA 4FX4A 1WQ2A 1X1DA 2JPCA 3CLQA 3TW7A 4RMNA 4BACA 2PX9A 1IN7A 2X6WA 2VN2A 3OL4A 3V7CA 1IRGA 1ZG5A 2XAQA 2DT7B 3DU5A 1W0TA 3DKWA 2Y48A 2W1OA 2XAHA 4IZZA 1X2MA 3M8JA 3EYIA 5ERIA 3RYRA 4UV9A 2EIMH 5FKLA 2JVHA 1SC7A 2ELJA 4KIGA 1OCOH 2E35A 2Q0OA 1I5ZA 4NC8A 3HB9A 3V7RA 1O57A 2Z16A 4R8HA 4ESFA 3OYAA 1UHMA 4FASD 2M45A 1RKTA 3CCEI 4BE1A 1B8IB 1KU9A 2D2WA 3I4NJ 1JUPA 4HX4A 3IRRA 5IY5H 2DA5A 1WFXA 2LVSA 3NARA 2X0LA 2DN0A 1WRJA 3FIWA 3IRQA 3IUOA 1RESA 1QPIA 1PP8F 3DEWA 3FZVA 3LSJA 5L3CA 4ZYEA 1S7OA 2VQCA 1GUUA 2RDPA 3KP4A 1AKHB 3BCAA 2XRLA 1R00A 2Y0SA 3DBHB 1QHHD 3S1RJ 2E36A 3PQKA 4M74A 2CW8A 2DLLA 1XS9A 1T0FC 4BYYA 2MW8A 2P8TA 3BG7A 5DTDA 4RA2A 1ZH5A 5E3OA 2R4GA 4IL6C 1N77A 2HGCA 2KKOA 4XOPA 3TBIA 1JTXA 3HPGA 1N25A 2IBDA 4JBAA 3VYRB 4Y3OA 3CESA 3VSKA 3RQ4A 1VQ7I 4ZDPA 1IXRC 2YU3A 3V4GA 1P2FA 4XRMA 1FIAA 2N8GA 4U0VA 4EM0B 4HLXA 3WE3A 2K3PA 5H6RA 3S2WA 4MFEA 1XMXA 2VPRA 1TTYA 4LJZF 3NWTA 2HVRA 3CC7I 5KNLA 2WWYA 3ASNH 1ZGWA 1WJBA 2CUFA 4RGSA 3NWSA 3E6CC 4A3LJ 1YE9A 1PUEE 1U5TC 1GVDA 2L4MA 3CJRB 4ZC3A 4UB8C 5L3DA 4HNUA 1WWXA 3HC7A 1YG2A 3IL2A 1A31A 1E0EA 2ECCA 4CO8A 4E4HA 1X19A 4BQQA 2FBHA 1K61A 5D4SA 3OIQA 2BW3A 3J7YJ 1OYYA 4LITA 3K4CA 1JI8A 2XUBA 2YSRA 3LA2A 2QEXI 2FF4A 5IP6A 5J1RA 2KISA 1KQ8A 2ADUA 1IRXA 2K3FA 2JRMA 2DAOA 1GDTA 2WB1N 3MWMA 1ZYRF 4CZCA 5GAGJ 5TGTA 5LHHA 5ILUA 2QQAA 4AM3A 3EUHC 1ZARA 1TC3C 4IQJA 3DEEA 2PJPA 2Z99A 1R1TA 2DDAA 1XB4A 2MBFA 3W2WA 1D8JA 1U0JA 2G7UA 3JRFA 2QQBA 1XDSA 1WVRA 5C3EJ 3G4SI 2R7TA 2Y75A 3TOBA 4B47A 1JE8A 3S3NA 3RJPA 2R7VA 5IT9Z 2O3FA 5M5WJ 4UUVA 3BR6A 2KFDA 2PN6A 3T8TA 2XPVA 3KYLA 5J1UA 2QCOA 5LD2C 2EB7A 3H9GA 2IT0A 1DP3A 1R7JA 5HLHA 4B8XA 3BG5A 1BI2A 2M4GA 1RC9A 5FD6A 3RTRA 3ZOBA 2HQNA 4WX9A 4QTRA 3JRAA 2DK5A 1GVJA 2H6CA 1GT0C 5FKMA 3ZRGA 4GGGA 3FXJA 4WWCA 1DU6A 2JK3A 2OQGA 2QSHX 2JA8J 1KU7A 4C2TA 2HQAA 1JUMA 4L9JA 3GUDA 2PMZA 3FXUA 3Q0WA 4DJAA 2F5DA 4E70A 3CJQB 3AL0C 2K9MA 1KONA 3ABUA 4XN0A 2XAFA 4HF0A 3GX4X 3U21A 2DU9A 1YHQI 2A5WA 2GOMA 3K4BA 1G3WA 4Q47A 2UWMA 1FOYA 1KGSA 4Y4RA 3E3VA 4PK4A 3FM3A 1VQNI 2VBWA 2ID3A 4CDGA 4GCVA 1LUJB 2LD5A 4MEXF 2K9SA 4Y7NJ 1FYMA 1YTYA 2VLAA 2K9QA 4UUTA 1DUXC 3FMSA 5KCMA 3ZQGA 2R5ZB 4IQ4A 3CZ6A 1A6IA 2LTPA 3FBIB 1X1AA 2L3DA 5D5VB 3BR0A 1BR2A 3JRDA 1SFEA 5LGTA 4I02A 1OR7A 1TZLA 1IV8A 4BJ6C 5K7FA 5E18F 3OYDA 2QM3A 3COAC 2R5YB 3JW4A 1R49A 1R5GA 2O8KA 3H35A 3ULQB 2COMA 3V8LA 2JZYA 4EM1A 2CQ7A 4Y15A 2KQRA 2MG4A 5IT9K 1ETVA 5EG0B 2R7ZJ 3WGHA 3PNTA 3L09A 4WXHA 5EEHA 2GIZA 3BT9A 1X3WB 1UZCA 2P4WA 1MSEC 1P4WA 2NAZA 5J3LA 2IGOA 5E1ZB 3KPHA 3Q9SA 2QQ8A 3IC7A 1WI3A 1ZG3A 3HOYJ 1LEBA 2BY1A 3RKYA 1HKQA 1K78B 2JN6A 2HKXA 3M8FA 3K70C 3WTVC 1S7EA 1OCRH 1QU3A 4S05A 3KZIC 2MD5A 3WTSC 4QSHA 5HDNA 3S3OA 4NNJA 1WHUA 1MNMC 5DCMA 2NVYJ 3HRTA 2KRCA 2PLYA 1Z91A 1FT9A 2XPWA 3G1LA 3V7SA 4DYRA 1RNLA 3QP5A 4C3HJ 2M8GX 3OSFA 4XLPF 1B8IA 2EH3A 4O6JA 3O3KA 1EA3A 3K4NA 3R60A 5CKTA 3RPUA 2Y9ZA 3S16J 1R58A 3DPLC 3TDZC 3WTXC 1H0MA 2O0YA 3V8JA 3BTJA 2DOEA 1I6XA 3PIOF 4ENKA 3ESWB 2L4AA 2ECBA 2W24A 4H0EA 3IAM2 1S72I 5H20A 1IAWA 1AKHA 1Y0UA 2ZXHA 2VQGA 4CA0A 5DEQA 5HLTA 2EWNA 2EFQA 5GPCA 1ETYA 5FKNA 4I0AA 1R1VA 4ETSA 5F0HA 2L9RA 3C2GA 1S3JA 1SFKA 2BBYA 4ZYGA 1ZG1A 4F91B 2DMUA 2E34A 3HPHA 3NAUA 2M0CA 4G6QA 3CCYA 3MFKA 3CCRI 2JA6J 4MIMA 1VNDA 2XSJC 3KZZA 1BC7C 1NH3A 1BBYA 2ME6A 4X6AJ 5CQGA 2BXZA 1P9QC 2P6TA 1FOWA 1TQPA 2JRTA 4DOZA 5D5UB 1ZN2A 3MZHA 1OMIA 2NYXA 2JA2A 4R1HA 3GTGJ 1IZ1A 3H9QA 3LSRA 1Y8QB 5AIQA 3FMRA 2XSDC 2I10A 4Z6YA 1SFXA 3OYCA 5BOXA 1J0RA 2E71A 5HDGA 1X1CA 2PJRB 3DLLF 3OYFA 1W5TA 1MJ9A 1MZBA 4YIFA 1U6GA 3TO6A 5M3FJ 4KDPA 2PEXA 2WAEA 5EEAA 3BC8A 2B0LA 3PUBA 1KYZA 3MKWB 4KMFA 3FXKA 3KP7A 2E19A 1YLFA 2CFXA 1NTCA 2LKXA 2GAUA 3ABKH 1XD7A 3E1SA 4ZZDA 4D7NA 1LDJA 1K4SA 3KP6A 2DCEA 2RC4A 2L0KA 2BZTA 4Y13A 2NRAC 1D8KA 3HOXJ 1FTTA 4L0YB 3ELKA 5E8GA 4D9JA 3I59B 4V2GA 3LL7A 4MLOA 2QKLB 1CF7B 4E7IA 2DFFA 3W6KB 3H5RA 1HDPA 1UHSA 1V5GA 1W1WE 4DYQA 4A69C 2B63J 2X6OA 4LIUA 2Y0MA 4PSXA 3SQNA 5E8IA 5B1BH 4A3DJ 1FBUA 4BDYA 2YUSA 3FXMA 1FIPA 2LKPA 4UB6C 5J1YA 3D1NI 3C18A 5F27A 4G12A 4ANJA 1LB2A 2OCEA 4A0ZA 1TWHJ 1AWCA 4IHXA 2ZFUA 2ETHA 1R23A 1U78A 1X1PA 2Y9YA 3KIOA 1WZ2A 1EJ9A 2KDOA 4A6EA 4M71A 3ZMTA 2HNHA 3MMYB 1TQMA 3MQ0A 2GA2A 3B73A 3GTQJ 3MCZA 3E6BA 2BGCA 2M87A 1XGNA 3OL3A 1SVLA 1FBSA 3L2VA 4GXOA 4UY8I 1OFCX 2V7FA 3IWZA 2LREA 4OWRB 3WHBA 4ZTFA 1NK3P 2DA1A 1IRFA 3GLXA 3PL8A 3HSEA 3REOA 5M3MJ 4D0PA 1ZRFA 1Z3XA 6PAXA 4WXDA 1DQUA 2LY2A 2O5RA 4EEFG 2ELKA 1W7PB 3BZCA 1HDDC 1NHAA 2BYVE 2VL8A 3HRUA 5F0CA 4EMSA 1BI1A 1FEXA 3J7AO 4KNYA 1POGA 4M6VA 2HQ5A 5FLXZ 4KN7X 2WV0A 4YG2F 1USTA 2K9NA 4BHPA 2HDDA 1SMYF 1EH8A 5C4XJ 4I0BA 4BY7J 2ICWG 1WH7A 3SXYA 3HDDA 4P55A 4QPQA 3FK6A 1VTNC 3IH3A 1W5SA 2FMLA 3BR2A 2LYCA 2HPMA 1S7AA 2QYOA 2VKHA 2Y30A 2H8RA 3SDBA 4UVCA 2R5YA 3M07A 3GO5A 4BEHB 3CCLI 2JWTA 4DNCA 1E17A 3ERED 2D5VA 2GLOA 1FLIA 2Y2ZA 2OV7A 1JJ8C 3F22A 5CVIA 5FLMJ 5EG0A 1E3HA 1D5VA 2NOGA 4PGHA 4OMYA 3H36A 3MEXA 3TW6A 2HTSA 1VQLI 1BI3A 3A0HC 5E20A 2KHMA 3DXJF 3S3MA 1U8RA 5M5XJ 4AIJA 4M73A 3KE2A 2L7FP 2FBIA 4BXFA 3SHFA 3I5UA 2A05A 1REPC 1Z9CA 2QWWA 2XGCA 1K78A 3CMMA 4GO1A 1D1CA 2R93J 3G6EI 2HTJA 3WU1B 4MTEA 3MZYA 3BDDA 3DCFA 3S32A 1MMAA 2V4JC 5H6QA 3S2DJ 4IRGA 3QOEA 3KFWX 4I98B 1JKPC 4HQMA 2DJIA 1H9GA 3D0SA 2OTLI 2LP0A 4IRIA 2EIKH 3DFGA 4YFXF 1K6OA 4RLFA 4IO9F 1SFOJ 2CGPA 1TW2A 3ZMVA 1TNSA 5IP7J 4ABZA 1MDMB 5FLXK 3K70D 4M3FA 4LLGF 4JP0A 4AIHA 2H1KA 3Q0UA 3RI4A 1MGTA 2EA4A 5HODA 5IYCJ 5EJCA 3I53A 2L54A 3N05A 2XF5A 3D5SC 2CRGA 3O2PE 1ZR2A 2QKMB 4RBOA 2KLOA 5K5OA 1R5HA 3PFIA 2M8EA 4BBSJ 4B4CA 5GADJ 5B66C 4HQEA 2W4SA 4L18B 4ZTJA 4L9NA 2OUMA 2ME0A 3KEOA 3H5NA 1IV6A 3OY9A 1BR4A 2EZIA 4J01A 1BI0A 4RB0A 2R3SA 1UG2A 3BZ6A 2FX0A 1YW8A 2L7KA 3ABTA 4YRVA 2AO9A 1IGNA 4OIOF 4XLNF 1XGMA 3CF5F 4XORA 3BZKA 4TV7A 2M4KA 2F5VA 3LQRA 2V26A 3U1DA 2KIMA 1SMTA 1Z0XA 1FZPB 1RPWA 3ROUA 5F0FA 1JJ6C 1D1BA 1YIOA 1VQ8I 4CCOA 1T38A 2E5NA 3LSGA 5L3FA 2R7FA 4HX8A 3VYUB 2VJ5A 4LMYA 4U7DA 2ZJ2A 3OS2A 2PQ8A 4MQVA 5EYRA 2IPQX 3ZQ7A 3OYNA 2PJRA 3SEZA 1LVAA 4U0WA 1Q1HA 4AVPA 1SD5A 1U9NA 3CDIA 3IKVA 1KYWA 3OYEA 2C6YA 1HKSA 4S0HB 2XROA 3DF8A 4RAGA 1TQIA 4F7ZA 3VEPA 1FP2A 3WTZA 4KISA 2GXGA 4QLCU 3TOAA 3DU6A 5DUIA 1YITI 5EGOB 2VASA 2VOPA 2XDVA 1XMKA 1MMNA 1HSJA 5DDGA 4P5OA 2IP2A 3T5XA 3I59A 2KDZA 1RUNA 4KITB 4A0XA 2K4BA 1X3UA 2K7LA 3TMOA 3VB2A 1CF7A 2GA1A 2LRDA 3DPUA 3S17J 2XF7A 2H8WA 2GZWA 4UVAA 3HEFA 3CDHA 4L9TA 4UUSB 3KCCA 3CP2A 4A3BJ 2VPLA 2ZFWA 4PDKA 2IJLA 1G4DA 4WK8F 3B02A 4HF2A 3DTIA 1FMVA 1BA5A 3RQIA 1TWAJ 1YW7A 5HS9A 4W1UA 4LB5A 3D5LA 3EUAA 2K02A 4M3DA 5DYMA 2DT5A 1XSDA 1X1BA 1MH4A 2JSPA 1V55H 3M8EA 2M1BA 2EV5A 2X6YA 1Z3YA 3K4KA 2VIXA 3IAS2 2DFEA 1OYWA 5FO5A 1G8XA 3CUOA 2Z5UA 4BKXA 3UKGA 1I6HJ 2ZBKA 3HKZA 4A3MJ 2M34A 3DKYA 1MJBA 5J4VA 3R4KA 4EJUA 4Y52J 1M1EB 4XL9A 5L3BA 4I01A 3N4MA 1T56A 1JHHA 3BR3A 2OD5A 1XDUA 2ZJQF 2A07F 1BIBA 4LG0A 4CCMA 3CCUI 3KEQA 3K4LA 3I54A 1IUFA 3OMYA 3PM1A 5HDKA 1W7PA 2Y31A 2NOJB 2OJED 1J9IA 3HYIA 1ORKA 3W6VA 2P5KA 5DD4A 1ZR4A 1MH3A 3GZ5A 2K86A 4IJAA 1VI0A 3CUQC 4C30A 1MBKA 5FGMA 5JFRA 3ZQQA 3K1PA 4CCKA 3RYPA 1BOBA 2KL4A 2CQNA 1I27A 1BIAA 4MO7A 4AIDA 3HIFA 3A0BC 4O3MA 2OZ6A 2YX4A 5TISC 3ERMA 2A6HF 1UELB 5IYBJ 4W97A 2CMPA 2Z33A 3C1DA 1V4RA 2LR8A 5GP9A 1MW7A 2M7AA 3R61A 4BEHA 3EUKL 2TCTA 5BMZA 3U9GA 2F48A 5JLXA 1Y6IA 3H3VK 5IYDJ 2JJ7A 2B9SA 1ZQ3P 4NQWA 3M3YJ 4HA8A 2HEOA 2DA6A 4XQFA 4BE2A 2JQ7A 3FXQA 2IS6A 1FOXA 5F6FA 1KQ0A 2ELHA 5AIPA 3SDGA 3LWFA 1NK2P 3K4JA 3C7JA 2B7EA 2LLKA 1LPQA 4MNUA 3BJ6A 2OTJI 5E17F 2GBYA 2BEOA 3A2KA 2QLZA 2KMUA 2LY9A 4ZYAA 1RI7A 1WCMJ 5D6EA 2QSGX 4RGUA 4IOAF 4WF2A 3BPXA 2VI6A 3O6BB 2OBPA 3WG9A 1OCCH 1BC8C 1G3SA 3FM5A 3J7AY 2D1VA 3CMEI 2Z3YA 5BQTA 4JQFA 3QPTA 3C2BA 5CVVA 3GYHX 4IF4A 2LY1A 1BM9A 1XMAA 5DUKA 5GAHJ 1Z6TA 4BGDA 1E3OC 5HVQC 3BG3A 3HRMA 3PUFA 4Y17A 3LQQA 4PFOA 3KZYA 1KQ9A 5KK1A 2KJBA 5GPAA 3CC4I 4HW0A 1JT0A 2A5YB 4KUMA 4QWQA 1MDMA 3JAMZ 2EZKA 2YPRA 5C44J 2AS5F 1ZELA 3HXLA 3ZQCA 3HSFA 3DP7A 1BN5A 3DEUA 2XAGA 1DGRM 3GMEA 4ZYHA 3E97A 2FNAA 4NDLA 1MMDA 4YELA 5CVUA 3KP2A 1ON2A 2OC6A 4C3IJ 4K2EA 3CLOA 4G9YA 3D5RC 4M9XA 2GXBA 3S1NJ 3M9AA 1RR7A 1N78A 3GFLA 4I99C 2EK5A 2A6EF 3NRVA 2QA4I 4ASNA 3KX2A 3H0DA 4A3KJ 1WI9A 5HLIA 2EBIA 3PQJA 5FKKA 1VQOI 1V5EA 3CQZJ 1STZA 5B3SH 5FFXA
chains in the Genus database with same CATH topology
4DBQA 3L2WA 3OYCA 2VXZA 2W82A 2W7NA 1X1CA 2PJRB 3ZGKA 3OYFA 3I9V2 4BQOA 4F55A 3ONQA 2BW3B 2LBFA 2ZXIA 1NG6A 3HG9A 1WJEA 3PNVA 2WAEA 3BC8A 3PUBA 3MKWB 3LFUA 3GBGA 1W36C 3E1SA 3LSHA 2LH9A 3DWLE 2DCEA 2CW7A 2WB1A 3H9JA 2MD0A 4PJMA 4RM3A 4BJTA 4EATA 3L2QA 2VQLA 4D9JA 2X1DA 4XMYA 1AA7A 2KRHA 3LL7A 4MLOA 2QKLB 4XKBA 4XR6A 5LFAA 4E7IA 4E7SA 2VXDA 5CQEA 4HPQA 3H5RA 4CH7A 1V5GA 1WJFA 2BVMA 1S9HA 2Z1DA 4HNTA 4LIUA 1LVKA 4PSXA 2F6CA 3VWBA 3KEYA 4CCNA 3PFYA 4BDYA 2DXIA 2HPIA 1DGWY 4ANJA 3BG6A 4AVZA 2L2OA 4XKCA 4BE0A 2A6TA 1X4OA 3ZCOA 4NUBA 3PNYA 2ZFUA 5KHDA 3MKYB 1X4PA 3BLYA 4D1QA 2E1MC 2IGMA 2KDOA 1J09A 1K6YA 2RREA 1LKXA 4HRIA 2HNHA 3OIPA 2CUJA 3MMYB 3SEQA 5CPRB 4CCJA 2HDWA 3OYHA 2LC2A 4BJ5C 3ZR8X 2V1NA 2K9LA 3OL3A 4NC7A 3L2VA 4PUSA 2HVQA 2CH0A 2M0MA 3EPZA 3LMMA 4BS9A 2V7FA 4OWRB 2LREA 4ZTFA 4R79A 4XM3A 4CCLA 3PL8A 2I8DA 1Z3XA 3DLAA 3OYBA 4U87A 4IX7A 4IKFA 4CSWA 1DQUA 2LY2A 2O5RA 3HOTA 2P0WA 2X1CA 2M7BA 4QPOA 4ZDOA 5HNFA 4DBRA 3L2UA 2VL8A 1BR1A 5HNHA 3DTKA 4HSRA 4B3XA 2XAUA 4HG2A 2R7OA 1OR7C 3MKZA 3SZGA 3ZXSA 3S8PA 4E7KA 2IS4A 3RSNA 1SAUA 2JVGA 1D0ZA 4HSTA 4QPQA 3BCBA 2CUZA 2LYCA 4E7LA 4XONA 1R6RA 2HPMA 4ZDLA 3W2VA 4XLHA 2VKHA 3FDYA 4E7ZA 3SDBA 4RM2A 1UAAA 4BEHB 2XC7A 1FMWA 1X1DA 4KT6A 4BACA 4RMNA 2LG4A 4BU2A 1WJCA 2X6WA 3OL4A 2OV7A 4PJLA 2DT7B 3DU5A 2KP6A 2BOLA 2W1OA 2WY7Q 3K6GA 3FBNB 4IZZA 2KHMA 4U7BA 3M8JA 4ITVA 3S3MA 2FUG2 3DKXA 2RNGA 2JVHA 4XOTA 2ELJA 2R7WA 4XNFA 2WAFA 4NC8A 4BXFA 3FKJA 2VQHA 2Z16A 2VB6A 3OYAA 4LIVA 4PSWA 4FASD 3PSFA 3CMMA 4BE1A 1D1CA 2Q1ZB 3S32A 4J00A 1MMAA 2V4JC 4YEJA 4XKVA 1WFXA 4HEA2 3QOEA 3OS1A 3MD2A 1PYVA 2CS3A 3DTEA 2DJIA 3IUOA 4E7HA 4RLFA 3DQVC 2IGNA 2X51A 2VQCA 3K70D 3BCAA 1ERDA 3L2RA 2Y0SA 3H5AA 1QHHD 3LSKA 2R7XA 4KJZA 2CW8A 1OLTA 3N05A 1Z7LA 3AFHA 1MNDA 2XF5A 3D5SC 3HOSA 1T0FC 2QKMB 3BG7A 2KLOA 2L5QA 1NG7A 3OYKA 2IXSA 1LFPA 2UUZA 2R4GA 2W4SA 1N77A 4BL0B 4XOPA 3TBIA 4ZTJA 4AU7A 4OAZA 2OUMA 3OYIA 2KZVA 3HPGA 3I3LA 4OAYA 2IS2A 3H5NA 3VYRB 3LSMA 3QYEA 1BR4A 4Y3OA 3A1YA 3CESA 3VSKA 3OY9A 4J01A 3RQ4A 4CUGA 2V6EA 4BUPA 4ZDPA 4ZJZA 2L7KA 4YRVA 4LG3A 4B44A 1Z21A 4XORA 1HA8A 2K3PA 2M4KA 2F5VA 1T95A 2V26A 4PFPA 3QODA 2Z2SB 4B48A 1VZ0A 4GRIA 4N4NB 3NWTA 4DGWB 2HVRA 2WY8Q 5KNLA 4II2A 1D1BA 1WJBA 3NWSA 4CCOA 2R7RA 4JOMA 1YE9A 1D1AA 2E5NA 3LSGA 3OYMA 2CV1A 2LBFB 3VYUB 2VJ5A 2ZSHB 4ZC3A 3CJRB 3V42A 4HNUA 3OS2A 3S93A 3CF2A 5JHFA 3HC7A 3OYNA 2PJRA 1QHGA 3SEZA 1E0EA 4H4KC 4E4HA 1X19A 3HUGB 4BQQA 3SYTA 3OIQA 2BW3A 1PJRA 4LITA 3K4CA 4N4OB 1JI8A 3OYEA 1WJ5A 1D0XA 2X1EA 2LOOA 2AQFA 3LSIA 2UV1A 2MC4A 4KISA 1IRXA 3CP8A 2K5CA 3OOUA 3DU6A 4CZCA 5TGTA 2VASA 5FRMA 2XDVA 3F9KA 1MMNA 3EUHC 4P5OA 4IQJA 1V5FA 2M3AA 3DEEA 4KITB 3W2WA 3TMOA 2LRDA 3DPUA 2XF7A 1U0JA 2HZDA 2R7TA 4B43A 4XKWA 3CP2A 4X0GA 4B47A 1GLNA 2VPLA 2HU9A 1W36D 3K10A 3S3NA 2R7VA 3DTIA 2VJIA 1FMVA 2BVLA 2CFOA 2MABA 4XN3A 2R7SA 3D5LA 3EUAA 3KYLA 2MYSA 1X1BA 2JSPA 5LD2C 4E6KG 3H9GA 1WJDA 2X6YA 1DP3A 1Z3YA 3RCOA 3K4KA 2M4GA 2VIXA 3RTRA 3IAS2 3QYFA 1MMGA 4XLEA 1YX5A 3ZRGA 2F4IA 1G8XA 3HKZA 1N75A 3DKYA 3VDXA 1TT0A 4F52A 3OR1C 4C2TA 2HQAA 3IP4B 2R7UA 2PMZA 4C9YA 4XL9A 4DJAA 2X6XA 3CJQB 3AL0C 4BDZA 2K9MA 1KONA 2VJJA 4XN0A 3OYLA 1WJAA 3U21A 4CCMA 2L9SA 2A5WA 2GOMA 3K4BA 3PJRA 3AL0B 4FETA 4AYBA 3K4LA 4E7JA 3UNGC 2UWMA 3OMYA 3OYJA 3VYTB 4Y4RA 3M1CA 4PK4A 2IGKA 2NOJB 2VLAA 2XF6A 3PSIA 5KCMA 4XLAA 4C30A 4IQ4A 3ZQQA 4CCKA 3CZ6A 3FBIB 1X1AA 1BR2A 1BOBA 2KL4A 4BQNA 1TZLA 2R7QA 3K4MA 4BJ6C 4RLQA 2VJ4A 3OYDA 2WBMA 3H35A 1UELB 2CMPA 2KQRA 2DT6A 4F93B 2GOXB 3UR3C 2WADA 1MW7A 2M7AA 3PNTA 4BEHA 3E0JB 2E5ZA 1D0YA 3EUKL 1YX3A 2X85A 3G2BA 4XLCA 2IS1A 1Y6IA 2HVSA 2KPMA 4XQFA 2IGOA 4BE2A 2IS6A 3FHNA 3K4JA 4XLFA 3K70C 2E1MB 4G6TB 3A2KA 2KMUA 2MFZA 2V9KA 4ZYAA 5FRNA 1QU3A 2WAQA 3OWTA 3W3CA 2W00A 5HOOA 3S3OA 2DOAA 4NNJA 2VKDA 2KRCA 3W2AA 4PJJA 3J7AY 4JQFA 2WA0A 1G59A 2LY1A 3OR2C 4PJNA 3VSLA 1EA3A 3K4NA 5CKTA 4BGDA 5HVQC 3QYBA 2AQEA 3DPLC 4II3A 4PFOA 4F3QA 5FROA 3IAM2 3DPTA 3RPUD 2ZXHA 2VQGA 4CA0A 5HLTA 3HL2A 2CV2A 1MNEA 1LDKB 3OYGA 1ZELA 3HXLA 2JUGA 4F92B 2Q2EB 2ZSIB 1DGRM 3C2GA 2E60A 1UG0A 1SFKA 4P1WA 3VYSB 3AKZA 4YELA 1MMDA 4F91B 3HPHA 3OS0A 2OC6A 1Y56A 3D5RC 3C2HA 2CV0A 2XSJC 2RQQA 1N78A 5CQGA 3TL4X 2L9NA 1P9QC 4Y33A 3A4CA 3KX2A 4DOZA 4DIQA 3H0DA 2JA2A 4NQWB 3H9QA 1V5EA 4C2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC7 A;  2M4K A;  2KRC A;  4NC8 A; 
#chains in the Genus database with same CATH topology
 2ZME A;  4DBQ A;  3L2W A;  2W7N A;  4CGZ A;  3CJT B;  1A36 A;  3ONQ A;  2IAI A;  2ZB9 A;  3ZN0 A;  5C4J J;  2ZXI A;  4NBQ A;  4V2F A;  3S14 J;  2A69 F;  4EVI A;  3PNV A;  1HW5 A;  4MQ9 F;  1K83 J;  3AG2 H;  2VBZ A;  5LHI A;  1Z7U A;  5LBQ A;  1VQP I;  1G3Y A;  1W36 C;  5IOY A;  2E2J J;  5DV5 A;  1R1U A;  2QBY A;  1UMQ A;  2QEN A;  2FOW A;  1I1G A;  3DWL E;  5J40 A;  4ESJ A;  2D1H A;  2WB1 A;  3H9J A;  4RM3 A;  1LDD A;  2FXA A;  4BJT A;  4RB1 A;  1S5L C;  2KRH A;  5LFA A;  4XR6 A;  1PDN C;  2VXD A;  2IA0 A;  4M72 A;  5EGO A;  2BVM A;  3HOV J;  2QUF A;  1S9H A;  2VBY A;  4JK1 X;  1F43 A;  3JAM K;  2Z1D A;  3IWF A;  2EFN A;  2HWV A;  1ZGA A;  1B9M A;  5EF6 A;  3KEY A;  4CCN A;  1JGG A;  4L5E A;  1XCV A;  1QO0 D;  3PFY A;  1LNW A;  3Q9V A;  2XKP A;  1SAN A;  1A6Q A;  1I3Q J;  2OCC H;  2HPI A;  3GTL J;  2FJ1 A;  1OQY A;  2JUC A;  2J5O A;  2VT2 A;  1HKT A;  2A6T A;  2P7V B;  4A3E J;  3LA7 A;  4JYK A;  5KHD A;  3WG7 H;  1Y1V J;  3BRO A;  2DYS H;  4D1Q A;  2E1M C;  1TBX A;  4A6D A;  2RRE A;  3E5X A;  4HRI A;  4OIP F;  3S1M J;  1P7J A;  5CPR B;  3RKQ A;  2I5U A;  2XPU A;  2LC2 A;  1RET A;  2DMN A;  2V1N A;  4S04 A;  1B9N A;  5FLV A;  1ETK A;  3TGN A;  4PUS A;  2HVQ A;  2M0M A;  4Q4Z F;  4BS9 A;  4R79 A;  2COB A;  3CO6 C;  2HYG D;  3RKX A;  2HXI A;  3T8R A;  1Y0N A;  3DBR B;  4I09 A;  2HDC A;  3JR9 A;  1LFU P;  4IEJ A;  3S1Q J;  4U87 A;  4IX7 A;  4IKF A;  1Z67 A;  5EEG A;  3FWE A;  4UHT A;  1ZGJ A;  2MH9 A;  2X1C A;  4AYB N;  2M7B A;  2DQL A;  4DBR A;  3L2U A;  5AON A;  1BR1 A;  2BE5 F;  2H6B A;  4D7M A;  2IVM A;  2XAU A;  3LNQ A;  2R7O A;  1OR7 C;  4IHS A;  2HFH A;  3ZMU A;  1SD7 A;  2XGE A;  3ZXS A;  2FQ3 A;  2HOS A;  5LRS A;  3GTK J;  2W84 A;  3I4P A;  2CWE A;  2F2E A;  3E6M A;  4OOI A;  1J5Y A;  5GTH C;  1B72 B;  2F4M B;  1BJZ A;  4M3G A;  2HS5 A;  3H3Z A;  1OPC A;  3BCB A;  1VQ6 I;  2CUZ A;  1RRJ A;  4XON A;  1R6R A;  4XLH A;  1A35 A;  1OCT C;  2XC7 A;  4KT6 A;  3ZP5 A;  2LG4 A;  1WJC A;  2FU4 A;  2OQR A;  3M7G A;  1YIJ I;  3JRE A;  2RN7 A;  3O8H A;  1CGP A;  4NHJ A;  2KP6 A;  3ZQF A;  3F8C A;  1QPM A;  3FBN B;  5EZH A;  1SAX A;  2ISZ A;  4B1R A;  4U7B A;  1B6A A;  1USS A;  1HW1 A;  2CG4 A;  2HI3 A;  5K1Y A;  1T2K A;  3JSP A;  3V8K A;  3CDL A;  2R7W A;  2WAF A;  3FKJ A;  2VQH A;  1X58 A;  2W85 A;  4MFD A;  2VB6 A;  3K9T A;  2G0E A;  2Y69 H;  3QP6 A;  3GF2 A;  1AOY A;  2V6C A;  3ZN1 A;  4M6Y A;  2NNN A;  2XB0 X;  1FJL A;  3BG9 A;  4IHY A;  3HHH A;  3P9C A;  4LK0 F;  2Q1Z B;  1P7I A;  2F4O B;  3F0C A;  1QZY A;  4J00 A;  4YEJ A;  2RGV A;  2XB5 A;  4XKV A;  4HEA 2;  2LNB A;  3OS1 A;  1KA8 A;  1IO2 A;  3MD2 A;  2EIJ H;  3AAF A;  4UNO A;  2DBB A;  1ETQ A;  1T8I A;  4FQG A;  3LFK A;  4E7H A;  1HBX G;  2LF7 A;  2DMT A;  4FX0 A;  4GDF A;  2IGN A;  3CMY A;  4JX4 A;  1IDY A;  2OAZ A;  3L2R A;  1ERD A;  4Z2Y A;  3LSK A;  4KJZ A;  2DA3 A;  3RPQ A;  1X2N A;  1G2H A;  1YJW I;  5E1X A;  1OLT A;  4MHG A;  3HOS A;  2STW A;  2FA5 A;  2L5Q A;  4DW6 A;  1NG7 A;  3OYK A;  2IXS A;  1LFP A;  5E3L A;  1Z05 A;  2HYJ A;  2UUZ A;  3ABM H;  3CUQ B;  5ICE A;  1ZRC A;  2VOD A;  4BL0 B;  4A12 A;  4AU7 A;  3OYI A;  3I3L A;  4OAY A;  2IS2 A;  1UB9 A;  3QYE A;  2FD5 A;  1S29 A;  2DTR A;  4A3J J;  3L00 A;  3RKW A;  2EIL H;  1J7K A;  5BS6 A;  1HA8 A;  2PI0 A;  2KT0 A;  1MBG A;  4G94 A;  1T95 A;  2XGD A;  3QOD A;  4B48 A;  3ZMD A;  3P7N A;  3SJM A;  3WTW C;  1P4X A;  3QU6 A;  4II2 A;  2R7R A;  4JOM A;  2YS9 A;  3Q3S A;  4YII A;  2CV1 A;  1OYI A;  3OOP A;  3V42 A;  1SVO A;  3S93 A;  3FXL A;  3TDU C;  3CF2 A;  1C0W A;  1YW9 A;  5JHF A;  3JTH A;  2EQR A;  1HF0 A;  1QHG A;  1U5T B;  1G3T A;  1Y39 A;  3HSR A;  1FBQ A;  3HUG B;  3SYT A;  1YQA A;  4N4O B;  4NB5 A;  4CXF A;  1O3Q A;  2IW5 A;  1UJ8 A;  1PUF B;  2TDX A;  1D0X A;  2HR3 A;  5J6X A;  2LOO A;  2K40 A;  2MA3 A;  4UVB A;  3M4O J;  1SD6 A;  2H94 A;  3CP8 A;  3FMQ A;  2K5C A;  1TWC J;  3OOU A;  2O6G E;  1KU2 A;  4MGR A;  5D6F A;  4ESB A;  1RUO A;  2R5Z A;  5F1R A;  1MMS A;  3GFJ A;  3JRH A;  2CQQ A;  2DOD A;  4O5V A;  1B59 A;  2QQ9 A;  1V5F A;  2BXY A;  1XCB A;  3VOE A;  4X1E A;  1E2X A;  5J8C A;  1K4T A;  4XRF A;  4B43 A;  3G73 A;  4XKW A;  4X0G A;  4UV8 A;  1GLN A;  1GV5 A;  3I58 A;  4RB3 C;  1W36 D;  4XID A;  3P5J A;  4KMU X;  2KIQ A;  2VJI A;  2BVL A;  1DP7 P;  4XN3 A;  3H3U A;  1Y1W J;  3I71 A;  2M5W A;  1E3P A;  5LHG A;  2LDU A;  3PO2 J;  4E6K G;  2NS7 A;  1MSF C;  1WJD A;  2W48 A;  3RCO A;  2NVQ J;  3J80 Z;  2NNY A;  4XRS A;  2E1O A;  3QYF A;  5L3G A;  1XN7 A;  1YX5 A;  3FK7 A;  2L02 A;  4RGR A;  3K2Z A;  1N75 A;  3VDX A;  2FRH A;  3EDP A;  1F1Z A;  2WAQ N;  4F52 A;  5E79 C;  3OR1 C;  5IP9 J;  3ECH A;  2V9V A;  4M6X A;  4C9Y A;  1ZRD A;  2R7U A;  1LFB A;  1O7F A;  1YI2 I;  4P9U A;  1DPU A;  5E3M A;  4BDZ A;  1U9O A;  3PO3 J;  1JGS A;  1XX5 A;  3I0T A;  1WJA A;  2GM4 A;  1GXP A;  1V54 H;  2BY2 A;  2DPD A;  1W5C C;  5EZG A;  3M1E A;  1DDN A;  3AL0 B;  1U2W A;  4E7J A;  3OYJ A;  4IHT A;  3VYT B;  2DW4 A;  3M1C A;  1ZLK A;  2DMQ A;  4EJO A;  1R22 A;  2GXA A;  4EGY A;  2EFW A;  1IN4 A;  2A68 F;  3TED A;  4ON0 A;  4L9V A;  3LAP A;  4BBR J;  2HKO A;  2AXL A;  2XF6 A;  3PSI A;  4XLA A;  3AG1 H;  3GXO A;  4KIB A;  1HQC A;  5J47 A;  1HXD A;  3QOP A;  3QU3 A;  4BQN A;  4KN4 X;  2GQQ A;  2VJ4 A;  3BPV A;  1EV7 A;  2HOE A;  5CJ9 A;  2OU2 A;  2XHK A;  4IXA A;  3I55 I;  3R6S A;  2DTZ A;  1HC8 A;  3K69 A;  1MBH A;  5H2F C;  2GOX B;  2NVU B;  4G7H F;  2WAD A;  3H1C A;  5IPA A;  3HBL A;  3E0J B;  2E5Z A;  1D0Y A;  2X85 A;  4XLC A;  2IS1 A;  2VON A;  3BR5 A;  2ESN A;  4B09 A;  1H89 C;  1QZE A;  3F23 A;  4LFU A;  3J80 K;  2KPM A;  4YFK F;  3GWZ A;  2FBK A;  2GIV A;  3FHN A;  1IRZ A;  3HTS B;  4HV6 A;  4WCG A;  3F72 A;  3DBL B;  3SZT A;  2AHQ A;  1LE8 B;  2E1M B;  3P9K A;  5D5X B;  2CU7 A;  2MFZ A;  2V9K A;  2HOT A;  2P6S A;  3BTC A;  1I50 J;  2WAQ A;  2LF8 A;  3F6V A;  2O9L A;  3OWT A;  1VQM I;  4BH9 A;  3GFM A;  3W3C A;  2W00 A;  4EJW A;  1XGS A;  5HOO A;  2DOA A;  3CTA A;  4PCQ A;  2CUE A;  3W2A A;  4KYW A;  4IOC F;  2WA0 A;  3K1N A;  2KJC A;  3L9F A;  3OR2 C;  4PJN A;  3VSL A;  4ZYD A;  2OF7 A;  4KIF A;  4I7H A;  4FIS A;  5IOZ A;  2XAJ A;  3J81 Z;  2NXN B;  1JKO C;  4NC6 A;  1HST A;  3HHG A;  3CCJ I;  1YYV A;  3L2C A;  2Y0S N;  5KAI C;  4XK4 A;  5JVT A;  3H92 A;  3F8M A;  3RPU D;  1IG7 A;  4WXC A;  4IPA A;  2DPU A;  1AHD P;  1MNE A;  1ONV A;  3ZQL A;  4RGX A;  2Q2E B;  2ZSI B;  2UXX A;  2EZL A;  2UXN A;  2E60 A;  1B1B A;  1Q1V A;  1UG0 A;  2MH2 A;  1HW2 A;  4P1W A;  2O8X A;  3VYS B;  1GV2 A;  3HJE A;  3AKZ A;  1FYK A;  2ZO4 A;  3O8G A;  3OS0 A;  4RAZ A;  4D5C A;  2DJN A;  1T0F A;  3C2H A;  3FF5 A;  4N0B A;  3A01 B;  2RQQ A;  4ENN A;  5ICG A;  4ENJ A;  4Y33 A;  3E6D A;  2P5L C;  2O61 A;  5JI6 A;  1J75 A;  5LEK A;  4EQQ A;  1ZHF A;  4C2U A;  2D45 A;  1FWZ A;  2VXZ A;  2W82 A;  5DM7 F;  3ZGK A;  3I9V 2;  1JKR C;  2JA7 J;  1GHC A;  3CO7 C;  4BQO A;  1JT6 A;  1RIO H;  3OIO A;  2F5F A;  3HG9 A;  2QGU A;  1WJE A;  4G7Z F;  4PGG A;  4M3E A;  1T6S A;  5DCM B;  3DV8 A;  5ICF A;  5CLS A;  1IXS B;  1U5T A;  4EGZ A;  2JPB A;  1FOK A;  3HUG A;  3CCV I;  1I1S A;  2RAE A;  2KZG A;  3GVA A;  4LLN A;  1O7L A;  5E3N A;  2KRF A;  2FE3 A;  5KAF C;  1QZZ A;  4A3I J;  1R36 A;  4QIW N;  1PUF A;  2CW7 A;  5HLG A;  4HOB A;  3GCM A;  3RIR A;  3J81 K;  2MD0 A;  3MKL A;  4PJM A;  1VQ9 I;  2VBX A;  2G9W A;  2UZK A;  5M5Y J;  2X1D A;  2JA5 J;  4XMY A;  1IN6 A;  1ETX A;  4ZZL A;  4I2O A;  1AA7 A;  4XKB A;  4LGW A;  4M9S A;  4JX6 A;  4E7S A;  5CQE A;  1WKM A;  1KU3 A;  2PMH A;  3WHC A;  3T1B A;  4A5M A;  5B5E C;  1V3F A;  3WOD F;  3IV5 A;  1LVK A;  4HDU A;  4CYC B;  3MN2 A;  3QWL A;  3EUH A;  1LQ1 A;  1IC8 A;  3BG6 A;  1HLV A;  1UFM A;  2L2O A;  4XKC A;  1WPK A;  3GLL A;  4C3J J;  3GFI A;  3I64 A;  3VFZ A;  5ED4 A;  3BLY A;  1UCR A;  3G3Z A;  1EH6 A;  3CD6 I;  2PBI A;  3KET A;  2BY3 A;  1J09 A;  3K1M A;  1LKX A;  5K5Q A;  1IF1 A;  3OIP A;  1ODD A;  2STT A;  3SEQ A;  3A02 A;  4CCJ A;  1R4N B;  2HDW A;  3OYH A;  4A93 J;  5GTI C;  5D5W B;  3ZR8 X;  2K9L A;  4NC7 A;  3JTG A;  2VKV A;  4YIR X;  4YFN F;  2DDB A;  1EKE A;  2ID6 A;  3WTT C;  5ICC A;  2PMZ N;  4LK1 F;  4XM3 A;  1T33 A;  3F8N A;  1JTY A;  5FD5 A;  3GZ6 A;  4CCL A;  3FXO A;  3CC2 I;  3CCM I;  2I8D A;  1QNT A;  2BHZ A;  2LFB A;  3Q0V A;  3JSO A;  1O4X A;  1MD0 A;  4I76 A;  5DCF A;  4MEY F;  3ASO H;  1QVU A;  4ZDO A;  5HNF A;  2LKS A;  1L3L A;  5CVJ A;  2OA4 A;  1D3Y A;  5HNH A;  1PVE A;  4HSR A;  4B3X A;  2CSO A;  2V1U A;  4RAF A;  3BTI A;  3WE2 A;  3G71 I;  5K5R A;  1I3A A;  4GFB A;  2IS4 A;  3RSN A;  3RZD J;  1SAU A;  4B3A A;  3BQY A;  1D0Z A;  2A61 A;  4RDU A;  4HST A;  4KT5 C;  1FYL A;  1IN8 A;  1OCP A;  2VKE A;  4DZP A;  2K27 A;  4C2M J;  4IHV A;  2LMD A;  2DI3 A;  4ZDL A;  1H88 C;  2AXT C;  1QBJ A;  4E7Z A;  4RM2 A;  1XSX A;  2IRF G;  2K85 A;  3B6A A;  1SFU A;  1FMW A;  5LRR A;  1ZK8 A;  1ZRE A;  4BU2 A;  2WV1 A;  1FY7 A;  4PJL A;  1QGP A;  5JLW A;  1VQK I;  1JKQ C;  2R92 J;  5J4Y A;  2BOL A;  2WY7 Q;  3K6G A;  9ANT A;  5F1J A;  1R5I D;  4ITV A;  4Q48 A;  2ZC2 A;  2FUG 2;  3DKX A;  2RNG A;  4XOT A;  1O3T A;  4LOC A;  1U8B A;  1IW7 F;  3C3W A;  4XNF A;  1MBE A;  3KLO A;  4LIV A;  1F36 A;  1LE8 A;  4PSW A;  3L1P A;  1MJA A;  3PSF A;  2X4H A;  1OKR A;  2P5V A;  2IA2 A;  3K7A J;  4GYI A;  4AC0 A;  4JX5 A;  3BP8 A;  2VC1 A;  3BOQ A;  5BPD A;  1SEU A;  2KIF A;  2DMP A;  2FMY A;  4BQA A;  1PYV A;  2EA2 A;  3A03 A;  2CS3 A;  3DTE A;  4L5I A;  2V1D A;  3P9I A;  2QVO A;  1MIJ A;  5CYV A;  1QQI A;  2NS8 A;  4IRH A;  3WGG A;  3I4M J;  4HNV A;  1IJW C;  3DQV C;  1RR8 C;  2X51 A;  3NEU A;  3T0Y A;  5GAE J;  4LB6 B;  2WTE A;  1PP7 U;  3H5A A;  2CJJ A;  2R7X A;  1TL8 A;  2MGQ A;  1FNN A;  1YO5 C;  1Z7L A;  3AFH A;  1MND A;  1ZLJ A;  1MKM A;  1IN5 A;  1APL C;  4I6Z A;  4HF1 A;  1TNT A;  4UUS A;  1YRN B;  1FSE A;  4CZZ A;  3L7W A;  3VOD A;  4BAY A;  2JMW A;  1ITY A;  1VF9 A;  3ZQI A;  2Q2E A;  5DM6 F;  4OAZ A;  2KZV A;  1O3S A;  3JRC A;  2DA4 A;  3IKT A;  3LSM A;  3A1Y A;  4RB2 C;  2ZME C;  2QF7 A;  4CUG A;  2XAS A;  4P96 A;  4BUP A;  4ZJZ A;  1W0U A;  1O3R A;  1BL0 A;  2V6E A;  4G7O F;  2FNP A;  4LG3 A;  4B44 A;  1Z21 A;  2M30 A;  3A01 A;  4GYG A;  2ESH A;  1J2X A;  4HBL A;  1TW3 A;  4PFP A;  2P81 A;  2EV0 A;  2Z2S B;  3GTM J;  1P4A A;  1VZ0 A;  4GRI A;  4N4N B;  4DGW B;  1U3E M;  2WY8 Q;  3IHU A;  5BNG A;  3F3X A;  3PIP F;  2ZJP F;  4ENM A;  1D1A A;  3OYM A;  2MC3 A;  2LBF B;  2ZSH B;  1BOA A;  3SFI A;  1XSV A;  4HYE A;  3CCQ I;  3LA3 A;  4H4K C;  1BW5 A;  3FXR A;  1MBJ A;  3JRG A;  1PJR A;  1WGX A;  4G8X A;  3MZ8 A;  4BXX J;  1WJ5 A;  1H9T A;  4BHB A;  1ACI A;  2X1E A;  3IH2 A;  2AQF A;  3LSI A;  2UV1 A;  2E1C A;  1OJL A;  2MC4 A;  3FKI J;  1HOM A;  2A3S A;  2L9V A;  4XBF A;  4XRS G;  1F9N A;  2L7M P;  2JSC A;  3R0J A;  4P9F A;  2Z9O A;  4XIC A;  5FRM A;  5DD8 A;  1QRY A;  3F9K A;  5ILV A;  2MSY A;  2E7W A;  2JTV A;  2X9D A;  1LJ9 A;  2M3A A;  1A5J A;  2E1N A;  3EYY A;  5E1W A;  3KP5 A;  1I39 A;  4U0Y A;  4U88 A;  2ZJR F;  2HZD A;  4IVN A;  2E2I J;  2HU9 A;  3K10 A;  4LLL A;  2CFO A;  2MAB A;  2DYR H;  3QAH A;  1L0O C;  3QQA A;  4XSX F;  4CYC A;  5FJ8 J;  5D4R A;  4M9Z A;  3JCU C;  2R7S A;  2NS0 A;  4AIK A;  1YS7 A;  3QRF F;  1FX7 A;  2MYS A;  2W57 A;  4OIR F;  2VUM J;  2BV6 A;  2K4J A;  2L01 A;  2DA2 A;  1DPR A;  2O03 A;  1G6N A;  1YS6 A;  1H8A C;  2PG4 A;  2VT3 A;  5L3E A;  4XLE A;  1LEA A;  1MMG A;  5F64 A;  4N9I A;  2F4I A;  1DU0 A;  1ZKG A;  1T98 A;  3KYD B;  3MVP A;  3S2H J;  1TT0 A;  1XTA A;  3TO7 A;  3HGG A;  2HYF A;  4PZJ A;  3R0A A;  5F04 A;  3WTU C;  3IP4 B;  2HOA A;  3QPL A;  2EIN H;  2P7C B;  3AG3 H;  3RZO J;  2X6X A;  3F21 A;  2EV6 A;  2VE8 A;  1MBF A;  3I56 I;  2VJJ A;  2Q8K A;  3OYL A;  5D8K B;  3JRB A;  2XVC A;  3LAJ A;  2L9S A;  2PFB A;  2XKO A;  3PJR A;  4EV0 A;  4FET A;  2OPT A;  4AYB A;  1BJA A;  2PMU A;  3UNG C;  3TP0 A;  3WU2 C;  1QVT A;  4OIQ F;  2E2H J;  2MLK A;  2HXO A;  2ACJ A;  2CQK A;  2E7X A;  2IGK A;  3ISP A;  4BNC A;  3BWG A;  2F5E A;  2FQ4 A;  2EFP A;  2IA1 A;  2ISY A;  2YX7 A;  4IHW A;  1W7P D;  2R7Q A;  3K4M A;  2XIG A;  5CVR A;  2DQR A;  4RLQ A;  2TRT A;  2WBM A;  4BY1 J;  4FT8 A;  2EZH A;  2KIU A;  3AG4 H;  4UXN A;  5DS9 A;  4AD9 A;  1XGO A;  1F4K A;  2BY0 A;  4KA4 A;  5TRD A;  5D8L B;  2DT6 A;  1YOV B;  4EJV A;  4F93 B;  2YU9 J;  1FSH A;  1T08 B;  3UR3 C;  2ZCW A;  2IEK A;  2V1X A;  1FPQ A;  2V9P A;  1YX3 A;  3G2B A;  1TT5 B;  2NVT J;  4EJT A;  3F8B A;  2HVS A;  1HCR A;  1EH7 A;  3E7L A;  2CQX A;  4BXU A;  2G7H A;  5K7Z A;  1XPX A;  1RKW A;  4XLF A;  2NVX J;  3F6O A;  4OIN F;  5JHU A;  2XRN A;  4G6T B;  4FE7 A;  4FTH A;  3GTJ J;  5FRN A;  5LLQ A;  3TKY A;  3S15 J;  3ZMS A;  3E5Q A;  3GW2 A;  5LGU A;  4BHC A;  4RS8 A;  5JR3 A;  1JXS A;  2ZXW H;  2EJR A;  3RDI A;  2VKD A;  1ZAO A;  3FX3 A;  4PJJ A;  3KP3 A;  1YJN I;  4LG0 B;  2DFH A;  1R9T J;  1G59 A;  5EDN A;  3W6J B;  4FHT A;  4XSZ F;  2LK2 A;  1X3Z B;  2W25 A;  2EFO A;  3QYB A;  3WGI A;  2AQE A;  3FIS A;  4II3 A;  4ZH4 F;  3ZMZ A;  2HQR A;  4F3Q A;  2M2E A;  2QZ8 A;  2CO5 A;  4N9H A;  2ZKZ A;  1YJ9 I;  4DZJ A;  3LOC A;  5FRO A;  1D5Y A;  3DPT A;  2VOO A;  3BJA A;  3HL2 A;  3KLN A;  2CV2 A;  1K79 A;  1VQ4 I;  2DFI A;  1LDK B;  3OYG A;  3BR1 A;  1ULY A;  2JUG A;  1WH5 A;  3ABL H;  3TP3 A;  2F5C A;  3MAJ A;  4F92 B;  3IH4 A;  5IT3 A;  2FSW A;  4CYD A;  3F8F A;  1SVM A;  5K7H A;  2LSO A;  1R4M B;  1YRN A;  2CYY A;  3E5U A;  4HV5 A;  1ETW A;  1ON1 A;  2XGX A;  1Y56 A;  2V79 A;  2CV0 A;  3U2R A;  1P92 A;  3G1M A;  1OIS A;  1K7A A;  4FE4 A;  4LD5 A;  3TL4 X;  2L9N A;  3H0G J;  5HS8 A;  3A4C A;  2X48 A;  4CHU A;  4HDV A;  1IUY A;  4PJ0 C;  4DIQ A;  3SFZ A;  2CW0 F;  2BHY A;  2XV4 S;  4NQW B;  3N97 A;  4MTD A;  1ZTR A;  3BQZ A;  4L5J A;  2QSF X;  2GWR A;  3U1K A;  4HX7 A;  1T39 A;  1FC3 A;  3B6C A;  4HAM A;  2H09 A;  1QA6 A;  3SZP A;  1IDZ A;  1Z77 A;  3HGY A;  3Q5F A;  4DYC A;  4OMZ A;  3K2A A;  4F55 A;  4Q5S F;  3EQL F;  3TQN A;  2BW3 B;  2LBF A;  3OSG A;  1NG6 A;  1Z6R A;  1Y8R B;  3GEZ A;  3G1O A;  5A2Q Z;  2R0Q C;  1FTZ A;  2ZNY A;  5ILS A;  1WSU A;  4A3C J;  4J19 A;  1RZ4 A;  3LFU A;  2J5P A;  3GBG A;  1TP4 A;  3LSH A;  5F08 A;  2R7D A;  2LH9 A;  2FOK A;  3EET A;  1S6L A;  4OU0 A;  1TWF J;  3GTO J;  3HZJ A;  1F5T A;  4EAT A;  3QPS A;  3L2Q A;  3VPR A;  1Z1D A;  1OCZ H;  2VQL A;  3QPH A;  1CQT A;  1SD4 A;  5LGN A;  2OZU A;  2JT1 A;  2RV8 A;  4DQ2 A;  5FB2 A;  3NQO A;  4HPQ A;  4CH7 A;  1UHW A;  3BJO A;  3CJN A;  3ZQH A;  1B72 A;  1WJF A;  4HNT A;  3FHZ A;  3BY6 A;  1GXQ A;  2DO7 A;  2F6C A;  3VWB A;  2H27 A;  1BW6 A;  4HZF A;  1TWG J;  2DXI A;  3WU0 A;  5B1A H;  3HOU J;  1B4A A;  1DGW Y;  2VC0 A;  4G6D A;  4A0Y A;  4AVZ A;  4BE0 A;  1X4O A;  2RQP A;  2RKH A;  3ZCO A;  4NUB A;  3PNY A;  3MKY B;  1X4P A;  2YR2 A;  1XC5 A;  3HOW J;  2VE9 A;  2IGM A;  3ECO A;  3GTP J;  1K6Y A;  3WTY C;  2FEZ A;  2CUJ A;  3KYC B;  3J7Z I;  1EF4 A;  4V19 K;  1KZH A;  1XG1 A;  4BJ5 C;  5BPI A;  4L0Z B;  1ETO A;  1W4M A;  2ZXJ A;  4A3F J;  3HKZ N;  2ZME B;  3HM5 A;  1JUS A;  5HS7 A;  2CH0 A;  3LST A;  3EPZ A;  3LMM A;  3ZPL A;  5TJJ A;  2MLG A;  1AU7 A;  1S8N A;  3X2Q H;  2DOF A;  3HOZ J;  4FCY A;  3JRI A;  4A2U A;  3DLA A;  1FP1 D;  3OYB A;  1R71 A;  1YFH A;  2L7Z A;  1VQ5 I;  2RVC A;  4CSW A;  5A2Q K;  3HOT A;  2WC2 A;  5JVG F;  2ZNZ A;  2RNJ A;  2P0W A;  4QPO A;  4A5N A;  5FKO A;  2QBY B;  3DTK A;  2EPF A;  1A04 A;  1JHF A;  4HG2 A;  3CCS I;  2M9H A;  1VFC A;  3MKZ A;  4KIC A;  5FFZ A;  3SZG A;  1P6R A;  3K0L A;  3OV8 A;  3HTU A;  3S8P A;  4CIC A;  1ENH A;  4E7K A;  5KVR A;  3ML6 A;  4AUX A;  3BTL A;  4M3B A;  2JVG A;  3GZN B;  4HLY A;  3TO9 A;  3LSP A;  2O7O A;  4RAY A;  5LEJ A;  2HZT A;  4A3G J;  1TLH B;  4EM2 A;  5J8F A;  3CUQ A;  3CMA I;  3HRS A;  3W2V A;  4E7L A;  4AWX B;  4KFC A;  1IXC A;  3FDY A;  2DA7 A;  1J59 A;  2H1L A;  4D5F A;  2DK8 A;  1UAA A;  4FX4 A;  1WQ2 A;  1X1D A;  2JPC A;  3CLQ A;  3TW7 A;  4RMN A;  4BAC A;  2PX9 A;  1IN7 A;  2X6W A;  2VN2 A;  3OL4 A;  3V7C A;  1IRG A;  1ZG5 A;  2XAQ A;  2DT7 B;  3DU5 A;  1W0T A;  3DKW A;  2Y48 A;  2W1O A;  2XAH A;  4IZZ A;  1X2M A;  3M8J A;  3EYI A;  5ERI A;  3RYR A;  4UV9 A;  2EIM H;  5FKL A;  2JVH A;  1SC7 A;  2ELJ A;  4KIG A;  1OCO H;  2E35 A;  2Q0O A;  1I5Z A;  4NC8 A;  3HB9 A;  3V7R A;  1O57 A;  2Z16 A;  4R8H A;  4ESF A;  3OYA A;  1UHM A;  4FAS D;  2M45 A;  1RKT A;  3CCE I;  4BE1 A;  1B8I B;  1KU9 A;  2D2W A;  3I4N J;  1JUP A;  4HX4 A;  3IRR A;  5IY5 H;  2DA5 A;  1WFX A;  2LVS A;  3NAR A;  2X0L A;  2DN0 A;  1WRJ A;  3FIW A;  3IRQ A;  3IUO A;  1RES A;  1QPI A;  1PP8 F;  3DEW A;  3FZV A;  3LSJ A;  5L3C A;  4ZYE A;  1S7O A;  2VQC A;  1GUU A;  2RDP A;  3KP4 A;  1AKH B;  3BCA A;  2XRL A;  1R00 A;  2Y0S A;  3DBH B;  1QHH D;  3S1R J;  2E36 A;  3PQK A;  4M74 A;  2CW8 A;  2DLL A;  1XS9 A;  1T0F C;  4BYY A;  2MW8 A;  2P8T A;  3BG7 A;  5DTD A;  4RA2 A;  1ZH5 A;  5E3O A;  2R4G A;  4IL6 C;  1N77 A;  2HGC A;  2KKO A;  4XOP A;  3TBI A;  1JTX A;  3HPG A;  1N25 A;  2IBD A;  4JBA A;  3VYR B;  4Y3O A;  3CES A;  3VSK A;  3RQ4 A;  1VQ7 I;  4ZDP A;  1IXR C;  2YU3 A;  3V4G A;  1P2F A;  4XRM A;  1FIA A;  2N8G A;  4U0V A;  4EM0 B;  4HLX A;  3WE3 A;  2K3P A;  5H6R A;  3S2W A;  4MFE A;  1XMX A;  2VPR A;  1TTY A;  4LJZ F;  3NWT A;  2HVR A;  3CC7 I;  5KNL A;  2WWY A;  3ASN H;  1ZGW A;  1WJB A;  2CUF A;  4RGS A;  3NWS A;  3E6C C;  4A3L J;  1YE9 A;  1PUE E;  1U5T C;  1GVD A;  2L4M A;  3CJR B;  4ZC3 A;  4UB8 C;  5L3D A;  4HNU A;  1WWX A;  3HC7 A;  1YG2 A;  3IL2 A;  1A31 A;  1E0E A;  2ECC A;  4CO8 A;  4E4H A;  1X19 A;  4BQQ A;  2FBH A;  1K61 A;  5D4S A;  3OIQ A;  2BW3 A;  3J7Y J;  1OYY A;  4LIT A;  3K4C A;  1JI8 A;  2XUB A;  2YSR A;  3LA2 A;  2QEX I;  2FF4 A;  5IP6 A;  5J1R A;  2KIS A;  1KQ8 A;  2ADU A;  1IRX A;  2K3F A;  2JRM A;  2DAO A;  1GDT A;  2WB1 N;  3MWM A;  1ZYR F;  4CZC A;  5GAG J;  5TGT A;  5LHH A;  5ILU A;  2QQA A;  4AM3 A;  3EUH C;  1ZAR A;  1TC3 C;  4IQJ A;  3DEE A;  2PJP A;  2Z99 A;  1R1T A;  2DDA A;  1XB4 A;  2MBF A;  3W2W A;  1D8J A;  1U0J A;  2G7U A;  3JRF A;  2QQB A;  1XDS A;  1WVR A;  5C3E J;  3G4S I;  2R7T A;  2Y75 A;  3TOB A;  4B47 A;  1JE8 A;  3S3N A;  3RJP A;  2R7V A;  5IT9 Z;  2O3F A;  5M5W J;  4UUV A;  3BR6 A;  2KFD A;  2PN6 A;  3T8T A;  2XPV A;  3KYL A;  5J1U A;  2QCO A;  5LD2 C;  2EB7 A;  3H9G A;  2IT0 A;  1DP3 A;  1R7J A;  5HLH A;  4B8X A;  3BG5 A;  1BI2 A;  2M4G A;  1RC9 A;  5FD6 A;  3RTR A;  3ZOB A;  2HQN A;  4WX9 A;  4QTR A;  3JRA A;  2DK5 A;  1GVJ A;  2H6C A;  1GT0 C;  5FKM A;  3ZRG A;  4GGG A;  3FXJ A;  4WWC A;  1DU6 A;  2JK3 A;  2OQG A;  2QSH X;  2JA8 J;  1KU7 A;  4C2T A;  2HQA A;  1JUM A;  4L9J A;  3GUD A;  2PMZ A;  3FXU A;  3Q0W A;  4DJA A;  2F5D A;  4E70 A;  3CJQ B;  3AL0 C;  2K9M A;  1KON A;  3ABU A;  4XN0 A;  2XAF A;  4HF0 A;  3GX4 X;  3U21 A;  2DU9 A;  1YHQ I;  2A5W A;  2GOM A;  3K4B A;  1G3W A;  4Q47 A;  2UWM A;  1FOY A;  1KGS A;  4Y4R A;  3E3V A;  4PK4 A;  3FM3 A;  1VQN I;  2VBW A;  2ID3 A;  4CDG A;  4GCV A;  1LUJ B;  2LD5 A;  4MEX F;  2K9S A;  4Y7N J;  1FYM A;  1YTY A;  2VLA A;  2K9Q A;  4UUT A;  1DUX C;  3FMS A;  5KCM A;  3ZQG A;  2R5Z B;  4IQ4 A;  3CZ6 A;  1A6I A;  2LTP A;  3FBI B;  1X1A A;  2L3D A;  5D5V B;  3BR0 A;  1BR2 A;  3JRD A;  1SFE A;  5LGT A;  4I02 A;  1OR7 A;  1TZL A;  1IV8 A;  4BJ6 C;  5K7F A;  5E18 F;  3OYD A;  2QM3 A;  3COA C;  2R5Y B;  3JW4 A;  1R49 A;  1R5G A;  2O8K A;  3H35 A;  3ULQ B;  2COM A;  3V8L A;  2JZY A;  4EM1 A;  2CQ7 A;  4Y15 A;  2KQR A;  2MG4 A;  5IT9 K;  1ETV A;  5EG0 B;  2R7Z J;  3WGH A;  3PNT A;  3L09 A;  4WXH A;  5EEH A;  2GIZ A;  3BT9 A;  1X3W B;  1UZC A;  2P4W A;  1MSE C;  1P4W A;  2NAZ A;  5J3L A;  2IGO A;  5E1Z B;  3KPH A;  3Q9S A;  2QQ8 A;  3IC7 A;  1WI3 A;  1ZG3 A;  3HOY J;  1LEB A;  2BY1 A;  3RKY A;  1HKQ A;  1K78 B;  2JN6 A;  2HKX A;  3M8F A;  3K70 C;  3WTV C;  1S7E A;  1OCR H;  1QU3 A;  4S05 A;  3KZI C;  2MD5 A;  3WTS C;  4QSH A;  5HDN A;  3S3O A;  4NNJ A;  1WHU A;  1MNM C;  5DCM A;  2NVY J;  3HRT A;  2KRC A;  2PLY A;  1Z91 A;  1FT9 A;  2XPW A;  3G1L A;  3V7S A;  4DYR A;  1RNL A;  3QP5 A;  4C3H J;  2M8G X;  3OSF A;  4XLP F;  1B8I A;  2EH3 A;  4O6J A;  3O3K A;  1EA3 A;  3K4N A;  3R60 A;  5CKT A;  3RPU A;  2Y9Z A;  3S16 J;  1R58 A;  3DPL C;  3TDZ C;  3WTX C;  1H0M A;  2O0Y A;  3V8J A;  3BTJ A;  2DOE A;  1I6X A;  3PIO F;  4ENK A;  3ESW B;  2L4A A;  2ECB A;  2W24 A;  4H0E A;  3IAM 2;  1S72 I;  5H20 A;  1IAW A;  1AKH A;  1Y0U A;  2ZXH A;  2VQG A;  4CA0 A;  5DEQ A;  5HLT A;  2EWN A;  2EFQ A;  5GPC A;  1ETY A;  5FKN A;  4I0A A;  1R1V A;  4ETS A;  5F0H A;  2L9R A;  3C2G A;  1S3J A;  1SFK A;  2BBY A;  4ZYG A;  1ZG1 A;  4F91 B;  2DMU A;  2E34 A;  3HPH A;  3NAU A;  2M0C A;  4G6Q A;  3CCY A;  3MFK A;  3CCR I;  2JA6 J;  4MIM A;  1VND A;  2XSJ C;  3KZZ A;  1BC7 C;  1NH3 A;  1BBY A;  2ME6 A;  4X6A J;  5CQG A;  2BXZ A;  1P9Q C;  2P6T A;  1FOW A;  1TQP A;  2JRT A;  4DOZ A;  5D5U B;  1ZN2 A;  3MZH A;  1OMI A;  2NYX A;  2JA2 A;  4R1H A;  3GTG J;  1IZ1 A;  3H9Q A;  3LSR A;  1Y8Q B;  5AIQ A;  3FMR A;  2XSD C;  2I10 A;  4Z6Y A;  1SFX A;  3OYC A;  5BOX A;  1J0R A;  2E71 A;  5HDG A;  1X1C A;  2PJR B;  3DLL F;  3OYF A;  1W5T A;  1MJ9 A;  1MZB A;  4YIF A;  1U6G A;  3TO6 A;  5M3F J;  4KDP A;  2PEX A;  2WAE A;  5EEA A;  3BC8 A;  2B0L A;  3PUB A;  1KYZ A;  3MKW B;  4KMF A;  3FXK A;  3KP7 A;  2E19 A;  1YLF A;  2CFX A;  1NTC A;  2LKX A;  2GAU A;  3ABK H;  1XD7 A;  3E1S A;  4ZZD A;  4D7N A;  1LDJ A;  1K4S A;  3KP6 A;  2DCE A;  2RC4 A;  2L0K A;  2BZT A;  4Y13 A;  2NRA C;  1D8K A;  3HOX J;  1FTT A;  4L0Y B;  3ELK A;  5E8G A;  4D9J A;  3I59 B;  4V2G A;  3LL7 A;  4MLO A;  2QKL B;  1CF7 B;  4E7I A;  2DFF A;  3W6K B;  3H5R A;  1HDP A;  1UHS A;  1V5G A;  1W1W E;  4DYQ A;  4A69 C;  2B63 J;  2X6O A;  4LIU A;  2Y0M A;  4PSX A;  3SQN A;  5E8I A;  5B1B H;  4A3D J;  1FBU A;  4BDY A;  2YUS A;  3FXM A;  1FIP A;  2LKP A;  4UB6 C;  5J1Y A;  3D1N I;  3C18 A;  5F27 A;  4G12 A;  4ANJ A;  1LB2 A;  2OCE A;  4A0Z A;  1TWH J;  1AWC A;  4IHX A;  2ZFU A;  2ETH A;  1R23 A;  1U78 A;  1X1P A;  2Y9Y A;  3KIO A;  1WZ2 A;  1EJ9 A;  2KDO A;  4A6E A;  4M71 A;  3ZMT A;  2HNH A;  3MMY B;  1TQM A;  3MQ0 A;  2GA2 A;  3B73 A;  3GTQ J;  3MCZ A;  3E6B A;  2BGC A;  2M87 A;  1XGN A;  3OL3 A;  1SVL A;  1FBS A;  3L2V A;  4GXO A;  4UY8 I;  1OFC X;  2V7F A;  3IWZ A;  2LRE A;  4OWR B;  3WHB A;  4ZTF A;  1NK3 P;  2DA1 A;  1IRF A;  3GLX A;  3PL8 A;  3HSE A;  3REO A;  5M3M J;  4D0P A;  1ZRF A;  1Z3X A;  6PAX A;  4WXD A;  1DQU A;  2LY2 A;  2O5R A;  4EEF G;  2ELK A;  1W7P B;  3BZC A;  1HDD C;  1NHA A;  2BYV E;  2VL8 A;  3HRU A;  5F0C A;  4EMS A;  1BI1 A;  1FEX A;  3J7A O;  4KNY A;  1POG A;  4M6V A;  2HQ5 A;  5FLX Z;  4KN7 X;  2WV0 A;  4YG2 F;  1UST A;  2K9N A;  4BHP A;  2HDD A;  1SMY F;  1EH8 A;  5C4X J;  4I0B A;  4BY7 J;  2ICW G;  1WH7 A;  3SXY A;  3HDD A;  4P55 A;  4QPQ A;  3FK6 A;  1VTN C;  3IH3 A;  1W5S A;  2FML A;  3BR2 A;  2LYC A;  2HPM A;  1S7A A;  2QYO A;  2VKH A;  2Y30 A;  2H8R A;  3SDB A;  4UVC A;  2R5Y A;  3M07 A;  3GO5 A;  4BEH B;  3CCL I;  2JWT A;  4DNC A;  1E17 A;  3ERE D;  2D5V A;  2GLO A;  1FLI A;  2Y2Z A;  2OV7 A;  1JJ8 C;  3F22 A;  5CVI A;  5FLM J;  5EG0 A;  1E3H A;  1D5V A;  2NOG A;  4PGH A;  4OMY A;  3H36 A;  3MEX A;  3TW6 A;  2HTS A;  1VQL I;  1BI3 A;  3A0H C;  5E20 A;  2KHM A;  3DXJ F;  3S3M A;  1U8R A;  5M5X J;  4AIJ A;  4M73 A;  3KE2 A;  2L7F P;  2FBI A;  4BXF A;  3SHF A;  3I5U A;  2A05 A;  1REP C;  1Z9C A;  2QWW A;  2XGC A;  1K78 A;  3CMM A;  4GO1 A;  1D1C A;  2R93 J;  3G6E I;  2HTJ A;  3WU1 B;  4MTE A;  3MZY A;  3BDD A;  3DCF A;  3S32 A;  1MMA A;  2V4J C;  5H6Q A;  3S2D J;  4IRG A;  3QOE A;  3KFW X;  4I98 B;  1JKP C;  4HQM A;  2DJI A;  1H9G A;  3D0S A;  2OTL I;  2LP0 A;  4IRI A;  2EIK H;  3DFG A;  4YFX F;  1K6O A;  4RLF A;  4IO9 F;  1SFO J;  2CGP A;  1TW2 A;  3ZMV A;  1TNS A;  5IP7 J;  4ABZ A;  1MDM B;  5FLX K;  3K70 D;  4M3F A;  4LLG F;  4JP0 A;  4AIH A;  2H1K A;  3Q0U A;  3RI4 A;  1MGT A;  2EA4 A;  5HOD A;  5IYC J;  5EJC A;  3I53 A;  2L54 A;  3N05 A;  2XF5 A;  3D5S C;  2CRG A;  3O2P E;  1ZR2 A;  2QKM B;  4RBO A;  2KLO A;  5K5O A;  1R5H A;  3PFI A;  2M8E A;  4BBS J;  4B4C A;  5GAD J;  5B66 C;  4HQE A;  2W4S A;  4L18 B;  4ZTJ A;  4L9N A;  2OUM A;  2ME0 A;  3KEO A;  3H5N A;  1IV6 A;  3OY9 A;  1BR4 A;  2EZI A;  4J01 A;  1BI0 A;  4RB0 A;  2R3S A;  1UG2 A;  3BZ6 A;  2FX0 A;  1YW8 A;  2L7K A;  3ABT A;  4YRV A;  2AO9 A;  1IGN A;  4OIO F;  4XLN F;  1XGM A;  3CF5 F;  4XOR A;  3BZK A;  4TV7 A;  2M4K A;  2F5V A;  3LQR A;  2V26 A;  3U1D A;  2KIM A;  1SMT A;  1Z0X A;  1FZP B;  1RPW A;  3ROU A;  5F0F A;  1JJ6 C;  1D1B A;  1YIO A;  1VQ8 I;  4CCO A;  1T38 A;  2E5N A;  3LSG A;  5L3F A;  2R7F A;  4HX8 A;  3VYU B;  2VJ5 A;  4LMY A;  4U7D A;  2ZJ2 A;  3OS2 A;  2PQ8 A;  4MQV A;  5EYR A;  2IPQ X;  3ZQ7 A;  3OYN A;  2PJR A;  3SEZ A;  1LVA A;  4U0W A;  1Q1H A;  4AVP A;  1SD5 A;  1U9N A;  3CDI A;  3IKV A;  1KYW A;  3OYE A;  2C6Y A;  1HKS A;  4S0H B;  2XRO A;  3DF8 A;  4RAG A;  1TQI A;  4F7Z A;  3VEP A;  1FP2 A;  3WTZ A;  4KIS A;  2GXG A;  4QLC U;  3TOA A;  3DU6 A;  5DUI A;  1YIT I;  5EGO B;  2VAS A;  2VOP A;  2XDV A;  1XMK A;  1MMN A;  1HSJ A;  5DDG A;  4P5O A;  2IP2 A;  3T5X A;  3I59 A;  2KDZ A;  1RUN A;  4KIT B;  4A0X A;  2K4B A;  1X3U A;  2K7L A;  3TMO A;  3VB2 A;  1CF7 A;  2GA1 A;  2LRD A;  3DPU A;  3S17 J;  2XF7 A;  2H8W A;  2GZW A;  4UVA A;  3HEF A;  3CDH A;  4L9T A;  4UUS B;  3KCC A;  3CP2 A;  4A3B J;  2VPL A;  2ZFW A;  4PDK A;  2IJL A;  1G4D A;  4WK8 F;  3B02 A;  4HF2 A;  3DTI A;  1FMV A;  1BA5 A;  3RQI A;  1TWA J;  1YW7 A;  5HS9 A;  4W1U A;  4LB5 A;  3D5L A;  3EUA A;  2K02 A;  4M3D A;  5DYM A;  2DT5 A;  1XSD A;  1X1B A;  1MH4 A;  2JSP A;  1V55 H;  3M8E A;  2M1B A;  2EV5 A;  2X6Y A;  1Z3Y A;  3K4K A;  2VIX A;  3IAS 2;  2DFE A;  1OYW A;  5FO5 A;  1G8X A;  3CUO A;  2Z5U A;  4BKX A;  3UKG A;  1I6H J;  2ZBK A;  3HKZ A;  4A3M J;  2M34 A;  3DKY A;  1MJB A;  5J4V A;  3R4K A;  4EJU A;  4Y52 J;  1M1E B;  4XL9 A;  5L3B A;  4I01 A;  3N4M A;  1T56 A;  1JHH A;  3BR3 A;  2OD5 A;  1XDU A;  2ZJQ F;  2A07 F;  1BIB A;  4LG0 A;  4CCM A;  3CCU I;  3KEQ A;  3K4L A;  3I54 A;  1IUF A;  3OMY A;  3PM1 A;  5HDK A;  1W7P A;  2Y31 A;  2NOJ B;  2OJE D;  1J9I A;  3HYI A;  1ORK A;  3W6V A;  2P5K A;  5DD4 A;  1ZR4 A;  1MH3 A;  3GZ5 A;  2K86 A;  4IJA A;  1VI0 A;  3CUQ C;  4C30 A;  1MBK A;  5FGM A;  5JFR A;  3ZQQ A;  3K1P A;  4CCK A;  3RYP A;  1BOB A;  2KL4 A;  2CQN A;  1I27 A;  1BIA A;  4MO7 A;  4AID A;  3HIF A;  3A0B C;  4O3M A;  2OZ6 A;  2YX4 A;  5TIS C;  3ERM A;  2A6H F;  1UEL B;  5IYB J;  4W97 A;  2CMP A;  2Z33 A;  3C1D A;  1V4R A;  2LR8 A;  5GP9 A;  1MW7 A;  2M7A A;  3R61 A;  4BEH A;  3EUK L;  2TCT A;  5BMZ A;  3U9G A;  2F48 A;  5JLX A;  1Y6I A;  3H3V K;  5IYD J;  2JJ7 A;  2B9S A;  1ZQ3 P;  4NQW A;  3M3Y J;  4HA8 A;  2HEO A;  2DA6 A;  4XQF A;  4BE2 A;  2JQ7 A;  3FXQ A;  2IS6 A;  1FOX A;  5F6F A;  1KQ0 A;  2ELH A;  5AIP A;  3SDG A;  3LWF A;  1NK2 P;  3K4J A;  3C7J A;  2B7E A;  2LLK A;  1LPQ A;  4MNU A;  3BJ6 A;  2OTJ I;  5E17 F;  2GBY A;  2BEO A;  3A2K A;  2QLZ A;  2KMU A;  2LY9 A;  4ZYA A;  1RI7 A;  1WCM J;  5D6E A;  2QSG X;  4RGU A;  4IOA F;  4WF2 A;  3BPX A;  2VI6 A;  3O6B B;  2OBP A;  3WG9 A;  1OCC H;  1BC8 C;  1G3S A;  3FM5 A;  3J7A Y;  2D1V A;  3CME I;  2Z3Y A;  5BQT A;  4JQF A;  3QPT A;  3C2B A;  5CVV A;  3GYH X;  4IF4 A;  2LY1 A;  1BM9 A;  1XMA A;  5DUK A;  5GAH J;  1Z6T A;  4BGD A;  1E3O C;  5HVQ C;  3BG3 A;  3HRM A;  3PUF A;  4Y17 A;  3LQQ A;  4PFO A;  3KZY A;  1KQ9 A;  5KK1 A;  2KJB A;  5GPA A;  3CC4 I;  4HW0 A;  1JT0 A;  2A5Y B;  4KUM A;  4QWQ A;  1MDM A;  3JAM Z;  2EZK A;  2YPR A;  5C44 J;  2AS5 F;  1ZEL A;  3HXL A;  3ZQC A;  3HSF A;  3DP7 A;  1BN5 A;  3DEU A;  2XAG A;  1DGR M;  3GME A;  4ZYH A;  3E97 A;  2FNA A;  4NDL A;  1MMD A;  4YEL A;  5CVU A;  3KP2 A;  1ON2 A;  2OC6 A;  4C3I J;  4K2E A;  3CLO A;  4G9Y A;  3D5R C;  4M9X A;  2GXB A;  3S1N J;  3M9A A;  1RR7 A;  1N78 A;  3GFL A;  4I99 C;  2EK5 A;  2A6E F;  3NRV A;  2QA4 I;  4ASN A;  3KX2 A;  3H0D A;  4A3K J;  1WI9 A;  5HLI A;  2EBI A;  3PQJ A;  5FKK A;  1VQO I;  1V5E A;  3CQZ J;  1STZ A;  5B3S H;  5FFX A; 
#chains in the Genus database with same CATH homology
 4DBQ A;  3L2W A;  3OYC A;  2VXZ A;  2W82 A;  2W7N A;  1X1C A;  2PJR B;  3ZGK A;  3OYF A;  3I9V 2;  4BQO A;  4F55 A;  3ONQ A;  2BW3 B;  2LBF A;  2ZXI A;  1NG6 A;  3HG9 A;  1WJE A;  3PNV A;  2WAE A;  3BC8 A;  3PUB A;  3MKW B;  3LFU A;  3GBG A;  1W36 C;  3E1S A;  3LSH A;  2LH9 A;  3DWL E;  2DCE A;  2CW7 A;  2WB1 A;  3H9J A;  2MD0 A;  4PJM A;  4RM3 A;  4BJT A;  4EAT A;  3L2Q A;  2VQL A;  4D9J A;  2X1D A;  4XMY A;  1AA7 A;  2KRH A;  3LL7 A;  4MLO A;  2QKL B;  4XKB A;  4XR6 A;  5LFA A;  4E7I A;  4E7S A;  2VXD A;  5CQE A;  4HPQ A;  3H5R A;  4CH7 A;  1V5G A;  1WJF A;  2BVM A;  1S9H A;  2Z1D A;  4HNT A;  4LIU A;  1LVK A;  4PSX A;  2F6C A;  3VWB A;  3KEY A;  4CCN A;  3PFY A;  4BDY A;  2DXI A;  2HPI A;  1DGW Y;  4ANJ A;  3BG6 A;  4AVZ A;  2L2O A;  4XKC A;  4BE0 A;  2A6T A;  1X4O A;  3ZCO A;  4NUB A;  3PNY A;  2ZFU A;  5KHD A;  3MKY B;  1X4P A;  3BLY A;  4D1Q A;  2E1M C;  2IGM A;  2KDO A;  1J09 A;  1K6Y A;  2RRE A;  1LKX A;  4HRI A;  2HNH A;  3OIP A;  2CUJ A;  3MMY B;  3SEQ A;  5CPR B;  4CCJ A;  2HDW A;  3OYH A;  2LC2 A;  4BJ5 C;  3ZR8 X;  2V1N A;  2K9L A;  3OL3 A;  4NC7 A;  3L2V A;  4PUS A;  2HVQ A;  2CH0 A;  2M0M A;  3EPZ A;  3LMM A;  4BS9 A;  2V7F A;  4OWR B;  2LRE A;  4ZTF A;  4R79 A;  4XM3 A;  4CCL A;  3PL8 A;  2I8D A;  1Z3X A;  3DLA A;  3OYB A;  4U87 A;  4IX7 A;  4IKF A;  4CSW A;  1DQU A;  2LY2 A;  2O5R A;  3HOT A;  2P0W A;  2X1C A;  2M7B A;  4QPO A;  4ZDO A;  5HNF A;  4DBR A;  3L2U A;  2VL8 A;  1BR1 A;  5HNH A;  3DTK A;  4HSR A;  4B3X A;  2XAU A;  4HG2 A;  2R7O A;  1OR7 C;  3MKZ A;  3SZG A;  3ZXS A;  3S8P A;  4E7K A;  2IS4 A;  3RSN A;  1SAU A;  2JVG A;  1D0Z A;  4HST A;  4QPQ A;  3BCB A;  2CUZ A;  2LYC A;  4E7L A;  4XON A;  1R6R A;  2HPM A;  4ZDL A;  3W2V A;  4XLH A;  2VKH A;  3FDY A;  4E7Z A;  3SDB A;  4RM2 A;  1UAA A;  4BEH B;  2XC7 A;  1FMW A;  1X1D A;  4KT6 A;  4BAC A;  4RMN A;  2LG4 A;  4BU2 A;  1WJC A;  2X6W A;  3OL4 A;  2OV7 A;  4PJL A;  2DT7 B;  3DU5 A;  2KP6 A;  2BOL A;  2W1O A;  2WY7 Q;  3K6G A;  3FBN B;  4IZZ A;  2KHM A;  4U7B A;  3M8J A;  4ITV A;  3S3M A;  2FUG 2;  3DKX A;  2RNG A;  2JVH A;  4XOT A;  2ELJ A;  2R7W A;  4XNF A;  2WAF A;  4NC8 A;  4BXF A;  3FKJ A;  2VQH A;  2Z16 A;  2VB6 A;  3OYA A;  4LIV A;  4PSW A;  4FAS D;  3PSF A;  3CMM A;  4BE1 A;  1D1C A;  2Q1Z B;  3S32 A;  4J00 A;  1MMA A;  2V4J C;  4YEJ A;  4XKV A;  1WFX A;  4HEA 2;  3QOE A;  3OS1 A;  3MD2 A;  1PYV A;  2CS3 A;  3DTE A;  2DJI A;  3IUO A;  4E7H A;  4RLF A;  3DQV C;  2IGN A;  2X51 A;  2VQC A;  3K70 D;  3BCA A;  1ERD A;  3L2R A;  2Y0S A;  3H5A A;  1QHH D;  3LSK A;  2R7X A;  4KJZ A;  2CW8 A;  1OLT A;  3N05 A;  1Z7L A;  3AFH A;  1MND A;  2XF5 A;  3D5S C;  3HOS A;  1T0F C;  2QKM B;  3BG7 A;  2KLO A;  2L5Q A;  1NG7 A;  3OYK A;  2IXS A;  1LFP A;  2UUZ A;  2R4G A;  2W4S A;  1N77 A;  4BL0 B;  4XOP A;  3TBI A;  4ZTJ A;  4AU7 A;  4OAZ A;  2OUM A;  3OYI A;  2KZV A;  3HPG A;  3I3L A;  4OAY A;  2IS2 A;  3H5N A;  3VYR B;  3LSM A;  3QYE A;  1BR4 A;  4Y3O A;  3A1Y A;  3CES A;  3VSK A;  3OY9 A;  4J01 A;  3RQ4 A;  4CUG A;  2V6E A;  4BUP A;  4ZDP A;  4ZJZ A;  2L7K A;  4YRV A;  4LG3 A;  4B44 A;  1Z21 A;  4XOR A;  1HA8 A;  2K3P A;  2M4K A;  2F5V A;  1T95 A;  2V26 A;  4PFP A;  3QOD A;  2Z2S B;  4B48 A;  1VZ0 A;  4GRI A;  4N4N B;  3NWT A;  4DGW B;  2HVR A;  2WY8 Q;  5KNL A;  4II2 A;  1D1B A;  1WJB A;  3NWS A;  4CCO A;  2R7R A;  4JOM A;  1YE9 A;  1D1A A;  2E5N A;  3LSG A;  3OYM A;  2CV1 A;  2LBF B;  3VYU B;  2VJ5 A;  2ZSH B;  4ZC3 A;  3CJR B;  3V42 A;  4HNU A;  3OS2 A;  3S93 A;  3CF2 A;  5JHF A;  3HC7 A;  3OYN A;  2PJR A;  1QHG A;  3SEZ A;  1E0E A;  4H4K C;  4E4H A;  1X19 A;  3HUG B;  4BQQ A;  3SYT A;  3OIQ A;  2BW3 A;  1PJR A;  4LIT A;  3K4C A;  4N4O B;  1JI8 A;  3OYE A;  1WJ5 A;  1D0X A;  2X1E A;  2LOO A;  2AQF A;  3LSI A;  2UV1 A;  2MC4 A;  4KIS A;  1IRX A;  3CP8 A;  2K5C A;  3OOU A;  3DU6 A;  4CZC A;  5TGT A;  2VAS A;  5FRM A;  2XDV A;  3F9K A;  1MMN A;  3EUH C;  4P5O A;  4IQJ A;  1V5F A;  2M3A A;  3DEE A;  4KIT B;  3W2W A;  3TMO A;  2LRD A;  3DPU A;  2XF7 A;  1U0J A;  2HZD A;  2R7T A;  4B43 A;  4XKW A;  3CP2 A;  4X0G A;  4B47 A;  1GLN A;  2VPL A;  2HU9 A;  1W36 D;  3K10 A;  3S3N A;  2R7V A;  3DTI A;  2VJI A;  1FMV A;  2BVL A;  2CFO A;  2MAB A;  4XN3 A;  2R7S A;  3D5L A;  3EUA A;  3KYL A;  2MYS A;  1X1B A;  2JSP A;  5LD2 C;  4E6K G;  3H9G A;  1WJD A;  2X6Y A;  1DP3 A;  1Z3Y A;  3RCO A;  3K4K A;  2M4G A;  2VIX A;  3RTR A;  3IAS 2;  3QYF A;  1MMG A;  4XLE A;  1YX5 A;  3ZRG A;  2F4I A;  1G8X A;  3HKZ A;  1N75 A;  3DKY A;  3VDX A;  1TT0 A;  4F52 A;  3OR1 C;  4C2T A;  2HQA A;  3IP4 B;  2R7U A;  2PMZ A;  4C9Y A;  4XL9 A;  4DJA A;  2X6X A;  3CJQ B;  3AL0 C;  4BDZ A;  2K9M A;  1KON A;  2VJJ A;  4XN0 A;  3OYL A;  1WJA A;  3U21 A;  4CCM A;  2L9S A;  2A5W A;  2GOM A;  3K4B A;  3PJR A;  3AL0 B;  4FET A;  4AYB A;  3K4L A;  4E7J A;  3UNG C;  2UWM A;  3OMY A;  3OYJ A;  3VYT B;  4Y4R A;  3M1C A;  4PK4 A;  2IGK A;  2NOJ B;  2VLA A;  2XF6 A;  3PSI A;  5KCM A;  4XLA A;  4C30 A;  4IQ4 A;  3ZQQ A;  4CCK A;  3CZ6 A;  3FBI B;  1X1A A;  1BR2 A;  1BOB A;  2KL4 A;  4BQN A;  1TZL A;  2R7Q A;  3K4M A;  4BJ6 C;  4RLQ A;  2VJ4 A;  3OYD A;  2WBM A;  3H35 A;  1UEL B;  2CMP A;  2KQR A;  2DT6 A;  4F93 B;  2GOX B;  3UR3 C;  2WAD A;  1MW7 A;  2M7A A;  3PNT A;  4BEH A;  3E0J B;  2E5Z A;  1D0Y A;  3EUK L;  1YX3 A;  2X85 A;  3G2B A;  4XLC A;  2IS1 A;  1Y6I A;  2HVS A;  2KPM A;  4XQF A;  2IGO A;  4BE2 A;  2IS6 A;  3FHN A;  3K4J A;  4XLF A;  3K70 C;  2E1M B;  4G6T B;  3A2K A;  2KMU A;  2MFZ A;  2V9K A;  4ZYA A;  5FRN A;  1QU3 A;  2WAQ A;  3OWT A;  3W3C A;  2W00 A;  5HOO A;  3S3O A;  2DOA A;  4NNJ A;  2VKD A;  2KRC A;  3W2A A;  4PJJ A;  3J7A Y;  4JQF A;  2WA0 A;  1G59 A;  2LY1 A;  3OR2 C;  4PJN A;  3VSL A;  1EA3 A;  3K4N A;  5CKT A;  4BGD A;  5HVQ C;  3QYB A;  2AQE A;  3DPL C;  4II3 A;  4PFO A;  4F3Q A;  5FRO A;  3IAM 2;  3DPT A;  3RPU D;  2ZXH A;  2VQG A;  4CA0 A;  5HLT A;  3HL2 A;  2CV2 A;  1MNE A;  1LDK B;  3OYG A;  1ZEL A;  3HXL A;  2JUG A;  4F92 B;  2Q2E B;  2ZSI B;  1DGR M;  3C2G A;  2E60 A;  1UG0 A;  1SFK A;  4P1W A;  3VYS B;  3AKZ A;  4YEL A;  1MMD A;  4F91 B;  3HPH A;  3OS0 A;  2OC6 A;  1Y56 A;  3D5R C;  3C2H A;  2CV0 A;  2XSJ C;  2RQQ A;  1N78 A;  5CQG A;  3TL4 X;  2L9N A;  1P9Q C;  4Y33 A;  3A4C A;  3KX2 A;  4DOZ A;  4DIQ A;  3H0D A;  2JA2 A;  4NQW B;  3H9Q A;  1V5E A;  4C2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...