2M4MA

Solution structure of the rrm domain of the hypothetical protein cagl0m09691g from candida glabrata
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MSLGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELSREGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Solution structure of the RRM domain of the hypothetical protein CAGL0M09691g from Candida glabrata
rcsb
source organism Candida glabrata
molecule tags Unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m4mA00
1N88A 1K73T 5DM6Q 1VBXA 3SXLA 1DHMA 2OTLS 2NZ4A 2VOOA 2HGMA 2MZ1A 2YH1A 5IQQA 5CXTA 2KVIA 1NU4A 4WFAQ 5LSLA 1WI6A 2DNRA 2I38A 5LSOA 1X4GA 3I55S 3G4SS 2KM8B 3CCES 3NNCA 3VAKA 2CPXA 1OIAA 2MMYA 2DGOA 2KYXA 1HD0A 4IO9Q 2CPFA 5GMKa 3IWNC 2M8DB 2LMIA 2XSFA 1S79A 1X5OA 4F25A 1M1KT 1WHYA 4QU7A 2LA4A 2MGZB 2MZRA 4ERDA 3EGZA 2LYVA 4YOEA 1YJNS 2MKHA 2CQ0A 1YHQS 3P6YC 2CQCA 1VC0A 4W90B 5DDQC 3G8TA 3CCUS 1X4AA 2DHSA 2G1DA 5MLCV 3FEYB 2AYGA 1P27B 3H2VE 2F9JA 2F3JA 1VQ4S 4FXWA 4C4WA 2MZJA 2LECA 1VBYA 1PGZA 2A3JA 1U1PA 1G2EA 2WBRA 2XS2A 2FPHX 2GO9A 3EGNA 1VQ9S 1M5KC 1R8PA 4V19X 3BEGB 1SJ3P 5EN1A 3PIOQ 1RKJA 4LMZA 3VAMA 3UCUP 2RUGA 2Q79A 1D8ZA 2D9OA 1YIJS 4YB1P 5HL7Q 2DNQA 2SXLA 3CC2S 1UFWA 3CCJS 3CC4S 2MSTA 1KD1T 2PEHA 2DK2A 2MKIA 2ZJPQ 2KRBA 5GAHU 2KRRA 2DNKA 1NO8A 3S6EA 3D2WA 4W92B 2MQQA 1Q86T 1Q7YT 2JVRA 1UAWA 2KFYA 2JVOA 2CQ4A 1JJ4A 3UCZP 3J7YU 4QU6A 4TU8A 1VQ6S 4U67Q 3CCMS 2DGQA 2DHXA 2DO0A 2D9PA 3N9UC 5LXYA 1KOHA 2G4BA 1X4EA 3H2UB 3CTRA 3ZZYA 3THPA 2RS8A 5DDPC 1KC8T 3NMRA 2X1BA 2CQ2A 2HGLA 1H2VZ 1M90T 2X1AA 2OSQA 2K3KA 3SDEB 2U1AA 3UE2A 2MPUA 2J0QD 2XS7A 2M0GB 3G96A 2XNRA 2M70A 2RVJA 1X5PA 3MD1A 1YTYA 4Y0FA 4UY8T 1AUDA 1HA1A 2DGVA 1OO0B 2MQMA 5GAGU 2FY1A 1U1LA 3UD3P 3VAGA 3NS5A 4WCEQ 1B7FA 1N54B 1WF0A 2KXFA 2AYEA 3P49B 2MSSA 2YKAA 1QM9A 3MI7X 2VONA 1DZ5A 3Q2TC 3OW2R 3G8SA 1X5TA 2QEXS 2GHPA 2HVZA 2LXIA 3MXHP 2L9WA 1SJFA 4WKRA 2RRBA 3MUVP 2DNZA 4QQBA 3S7RA 2DNOA 3MUMP 2KN4A 2L41A 1U6BA 1WEXA 2E5HA 3NNHA 2DNMA 2U2FA 1NJIT 1H2TZ 2ZJQQ 1R8HA 3S01A 5HO4A 2M4MA 3LQVA 1WG5A 1WWHA 3UCGA 3TP2A 4UQTA 1YJ9S 3LPYA 2DIUA 4FXVA 3VAFA 2AD9A 2DO4A 1JJHA 3PIPQ 2CQHA 4YUDA 3DLLQ 2KI2A 2DB1A 3FEXB 3J7ZT 3NS6A 1SJ4P 2EK1A 4WFNQ 2QA4S 2CPEA 2MKSA 2M52A 3HHNB 2CQIA 2O3DA 4LIRA 2CQ3A 2LEAA 2RU3A 1VBZA 3SDEA 3Q2SC 2LA6A 2DNLA 4OZ0A 2MZSA 1YITS 3S8SA 2OJ3A 2N7CA 1KQSR 4C0OC 3NNAA 1URNA 2ERRA 2MKKA 2M2BA 2B0GA 1DBDA 2J76E 4WIIA 3HI9A 5D77A 2YTCA 1Q81T 2DNGA 3CCVS 1N52B 1X4BA 3R1HA 2KHCA 5DM7Q 2MQLA 4Y00A 2J8AA 1KOOA 2CQ1A 1QVFR 3ULHA 5BJRA 2CPZA 4TU9A 3CULA 2DNHA 1VC5A 2RNEA 2KH9A 4WFBQ 1WEZA 2VOPA 2D3OR 2RT3A 3B4DA 5H1SV 1M5PC 2KG0A 2MB0B 2EVZA 3U1MA 2DGUA 1S72S 2MJUA 1WG1A 2E44A 2MKCA 3VALA 3CD6S 1FJEB 4TU7A 2LCWA 1FJCA 1D9AA 4P6QA 1O0PA 1U1OA 2E5JA 2CQDA 2MGZA 1K9MT 2CQPA 2G0CA 1ZH5A 1WHXA 1U2FA 3R27A 1XN9A 2OIHA 5JVGQ 2DGXA 2LXUA 2MJNA 2MKJA 3R1LA 3BS9A 2XS5A 1M5VC 2PE8A 1WHVA 3CF5Q 1FJ7A 1JJ2R 2MHNA 1QVGR 2M88A 2CJKA 4ZKAA 3VAHA 2MY8A 3K0JA 2DHGA 1HL6A 2DNYA 3CCSS 3P3DA 3JB9k 1OWXA 1VQMS 1FHTA 1H6KX 3G9CA 4OZ1A 1SXLA 1VQLS 4CH0S 2ADBA 5DDRC 4QPTA 3RW6A 4M5DB 1X5SA 3UD4P 4RU2A 2DHAA 2BZ2A 2YH0A 2MQNA 4C7QA 2YWKA 4BS2A 3CCRS 4PR6A 2KXHA 3CMAS 2DH8A 5ITHA 4WF9Q 2OSRA 2XB2D 4J5OA 3U1LA 1RK8A 2X1GA 2CQGA 3SMZA 1BY9A 2KU7A 4CIOA 4EGLA 2MYFA 2V94A 2AYMA 2MQOA 2X1FA 5D78A 2MQPA 3CUNA 4Z2XA 3VAIA 4A8XA 2JRSA 3VAJA 2MY7A 2MZTA 2CPDA 1H2UX 1OPIA 4CH1A 2KM8C 1Q82T 2ZJRQ 3MUTP 1YJWS 3BO2A 2QFJA 2CPYA 2RS2A 1VQPS 2ADCA 3MDFA 1U1NA 1WELA 2RRAA 1X4DA 5GAEU 2FC8A 4ED5A 1SJQA 1FO1A 2DNNA 3TO8A 2HGNA 1N8RT 3MOJB 2OTJS 2HYIB 2DITA 1U1MA 3RW7A 3CC7S 2BOPA 3CMES 4F26A 2E5IA 1VQOS 5LJ5Y 2UP1A 2DGWA 1U6FA 2MXYA 2DISA 5FJ4A 2RQ4A 5GADU 1WTBA 2FC9A 2M8HA 5IM0B 2DGSA 1U1RA 1VQ7S 1M5OC 1WEYA 3ZZZA 3US5A 5LXRA 2CPJA 2DH7A 2M7SA 1A7GE 1DRZA 4PRFA 2DIVA 2VODA 1ZZFA 3MURP 1VQKS 2JWNA 4LJMA 3G6ES 1K8AT 2KXNB 1U1KA 2N3LA 1P1TA 1SJRA 2M9KA 4F02A 3MD3A 4CQ1A 2NLWA 1ZZNA 1A9NB 3L3CA 4IUFA 1X4HA 1L3KA 1PO6A 1FT8A 5GVQA 5IFMA 2J0SD 2F9DA 3CXCR 3UWTA 3G71S 1FXLA 1FNXH 2L08A 5LJ3Y 2I2YA 1WI8A 5DETA 4TLQA 1JMTA 2KT5A 3CCLS 3DXBA 3EX7B 1WF1A 4IOCQ 1CVJA 2EK6A 1X0FA 1VQNS 3I56S 3BO3A 2FHOB 3B4MA 2HZCA 2RQCA 3CCQS 1YI2S 1X4FA 5JVHQ 3VF0B 1UP1A 2XNQA 2CQBA 3BO4A 3CPWR 2CPIA 3TYTA 1VQ5S 1HD1A 1UW4A 1WG4A 1F9FA 1IQTA 5DDOC 4IOAQ 2CPHA 2DH9A 5CYJA 1VC6A 2KG1A 5IM0A 2LQ5A 1W2BR 1VQ8S 2DGTA 1YWXA 2LKZA 3IRWP 1WF2A 2LEBA 2N3OA 2E5GA 2DNPA 2JX2A 3THTA 1X4CA 3P5TL 4PKDB 3V4MA 5CA5A 2N82B 1WHWA 2K8GA 1U1QA 2AYBA 2MZQA
chains in the Genus database with same CATH superfamily
3NG8A 1K73T 2ZBPA 2E29A 1VBXA 1XTZA 3QGPA 1RSCA 2HAFA 4BLGA 1NU4A 2ZE2A 2BANB 4N8NA 2I5JB 2FJXA 2J6UA 3EXCX 1KHVA 4KPYA 2B9XA 4I2PB 1NSKL 3RRKA 3PO4A 3JAMU 4HEA9 4U8YA 5ETVA 4GVLA 3ENAA 3DRYA 3GP9A 3I4HX 5DDQC 2JEFA 4JI2J 3DRXA 4NMLA 1LWXA 5D4NA 2AYGA 1HNZF 2XHCA 4I68A 2D1CA 1HQUB 1JLQB 2LECA 4OLOA 3M2VB 1NPKA 4QIEA 2VG6A 1RWWB 2UV8G 1RT4B 2QLFB 1FWLA 4CP5A 2VZ9A 3GU0A 2DNQA 1N36F 2BABA 3D68A 4DSJA 1DQAA 2ZDOA 4F0HA 1NK0A 2VFRA 3BGFA 2JVOA 1SKWA 2XTJP 2EEYA 4QU6A 4M5MA 4JI0J 5DDPC 2ZHOA 2VD3A 4OYPA 4ZHRB 3ENVA 5KFPA 3BJYA 3K89A 2R8GA 2RVJA 3JTNA 4A8OA 5I4MA 2H51B 5E33A 5GAGU 1LKZA 2GQ2A 1RT2A 3HCXA 2ZHBA 2KXFA 2AYEA 3CDUA 3MECA 4ZPWR 2JH3A 4JI8J 2VQEJ 4DLEA 3KDOA 2CYYA 3FGVA 3BGOP 2V2ZA 1UJ5A 3VWSA 1GTHA 2W25A 3BQ1A 3OL8A 4B3OB 3S01A 1SC4B 2WZ1A 2GJIA 3TVZA 2LQ8A 1S9EA 1MU2B 1IM6A 3EZUA 2CQIA 4AXJA 2DNLA 5K8OA 3Q0AA 5A8KB 4L75A 3S8SA 1V3ZA 2GX8A 4ECZA 1URNA 2D3ZA 2R7TA 4USIA 4IQMA 1DBDA 2JC1A 1X7VA 1Q81T 4OLPA 2W2PP 4NLGA 4NA2A 4FPRA 1SUQA 3M2RB 3OL7A 2D3OR 3UN5A 2AJQA 2MB0B 3C14B 3MM8A 2DGUA 3EYZA 4USMA 3R5CA 2Y1LB 1KN6A 2LCWA 3T5KA 1HBUA 1M1GA 3PX6A 3NGSA 2BACA 5HI7A 1OY6A 4IRKA 3PXGa 3PW0A 5FDLB 2GS8A 2XSJA 3MZIA 4ZA1A 1CJKB 2QFIA 3Q8RB 3G9CA 1U7LA 3KLHA 2GJFA 2R4FA 4QPTA 4M5DB 3UD4P 3M9MB 2K06A 2BZ2A 2E1PA 1EJ7L 2KXHA 4IYQA 4Q43A 2OO4A 4USUA 5C24A 3MPWA 1T05A 2X1GA 4X62F 3M30A 2ROPA 4CDIA 4WIQA 2R7RA 4ZJOA 2ZH5A 5DQGA 3VR1A 4C9DA 2E9RX 4JV1A 3SQGA 1S1WB 1S6UA 3I96A 5F0WA 3T6JA 3NAIA 2F4FA 4C3KA 2CPYA 4KPCA 2XMAA 1FKAF 2FC8A 2ZH7A 3VV2B 4KKOB 4TN2A 3IAM9 3CMES 2E5IA 4DJBA 4IG0A 1YK9A 5EWEA 1WJ9A 4ZN1A 3OR1B 3UVJA 2IY5B 1RU2A 4TQRA 3TZXA 1XMOF 4EFAC 2FC9A 3Q86A 2P9CA 2GO8A 2PMHA 1RBLA 1Y00A 1VGYA 3UDVA 3M8YA 1P8GA 2R7VA 3GILA 1HIYA 4X4RA 3CDAA 3MD3A 4J91A 4CQ1A 2NSBA 5DJBA 2Q66A 3MFIA 3D6TB 5F9NA 2VJUA 3NRBA 1HMVB 1SL2A 4LRDA 4R8UB 3RAXA 2C2EA 3DLEB 1C1BB 3D7SB 3GJSB 2JLGA 2YX1A 3V5RA 1M5SA 1V3RA 1IKYB 1TFYA 2W7PA 4IOAQ 4DMZA 2E9ZA 1QTMA 4IRCA 1YWXA 3DM2B 4U95A 1XR7A 3THTA 3PTWA 2N82B 5F8GA 2AYBA 3QGGA 2FLOA 3VCDA 1Y0HA 2WB4A 1R0BG 4ZIWA 4DSFA 4JI2F 1T03B 2YPZA 1GFWB 3VGVA 5L1IA 2ALZA 2CVEA 2HHXA 2KM8B 1SI9A 3R5GA 4DU8A 2EWHA 3IWNC 2DRAA 4MFBB 4CO3A 4PYDA 2H5JB 1M1KT 4M63A 3T19A 4QIWD 2MZRA 1X8DA 1IXKA 2CQCA 3JQJA 4ZPTR 2HHVA 2R7XA 3HM9A 2H1YA 2AJ0A 2CNLB 3HMJG 2KVQE 2F3JA 4Q44A 1JQGA 2F8EX 4O4RA 2YKMB 1UWBB 1NSPA 4TLRA 2RAQA 1U0HB 3HSGA 5IS2A 3VAMA 4H4MA 3BYRA 4JI0F 4OYOA 1YIJS 3J7AN 2FVQA 1UFWA 5K20B 2JNJA 1IBMJ 4PQUA 4NLRA 2DK2A 1MN7A 2DNKA 3N4WA 5EX3A 1FJGJ 2ASJA 5KFRA 1YSJA 1HPZB 3H90A 3PEHA 4EBEA 1UPMB 2VU5A 3C6TB 2V8VA 2DO0A 2GHVC 2C3YA 4JI8F 1S1UA 2VQEF 2IVMA 4P9SA 2IJNA 3MOZA 4BCAA 2DEJA 3M2UB 1S57A 3CIZA 2MSSA 4I6WA 2UXBJ 3MM9A 1K0VA 2IDLA 2HQ3A 3B8HA 4F4AA 1JLAA 1SJFA 3LAMA 2G2OA 2MLZA 1XNRJ 2HNZB 2PI5A 4EU0A 2CZ4A 2KTQA 1IR0A 2OH2A 5BYSA 2BE2A 1DARA 1E6YA 1SC3B 4OI4A 3LWLA 2CIMA 1L3TA 4DUTA 1RTJA 3WZ0A 4A47A 2HFNA 1PC4A 2CQ3A 2HBQB 2KB2A 5KT7A 2RHQB 1F2GA 3JSYA 1AYEA 3ISND 3K5LA 2I1RA 2MZSA 1TFWA 3I5AA 3BZQA 5A8WB 3CCVS 1X4BA 3GCXP 2WSFC 2MQLA 3MCSA 3PHEA 4KRWA 1NK5A 1HNXJ 2V8HA 3FVYA 2JZ5A 2DXDA 1HNIA 1G7CB 3U1MA 2MKCA 3GWCA 4G1IA 4YR2A 4ZCIA 5L9NA 6FDRA 3MCOA 2ZM6J 2HFVA 3QATA 3I9V9 2CG4A 2ILZA 2J5AA 3POTB 3GQCA 3H4DA 1QSYA 1RTHB 4AL6A 3Q8QB 5D4LA 4Q0BB 2Z0GA 1FA0A 2AQ4A 2ACMA 3ZZPA 2A6OA 4CO1A 1YRTA 4N56A 5HQ8A 1TKXA 2PFFB 3PFOA 1AZSB 4P7VA 1P1LA 2UUCJ 4Z2XA 3W9JA 3CJ4A 2IYGA 5ADZA 4JI3J 3MEEA 3GV7B 4O3RA 1RT1A 1ZM2A 5GAEU 3ZO7A 3T5JA 1SCJB 4DR2J 4RR5A 3BDPA 1JLEB 2HYIB 2B56A 1SIZA 1X0PA 3AB4B 2C28A 2LFVA 4PWDA 4DL5A 5IM0B 4QIFA 1LW0A 1RQ0A 2ZOMA 5EGYA 2B6AA 3PDNA 3KHGA 4LJMA 2IVYA 3KYLA 2AJ4A 4F67A 3H7HB 2GCFA 3M6VA 4ANDA 3L3CA 2G0JA 4OYWA 2PMZD 1RWVB 4IO1A 4NRUA 3RBEA 2MEWA 1NPPA 4DCJB 4IOCQ 1VHIA 3R7SB 4USWA 4YDXA 3H5YA 1JLCA 1UP1A 2CQBA 2J6TA 2B3TB 4LFCJ 1CBKA 1UEKA 1QUVA 1VJQA 4JUZA 2FHJD 1VQ8S 1DTTA 2YWWA 1N34J 5DRKA 2LKZA 4H4KA 2LEBA 1LWCB 2K8GA 1N88A 1JKHA 2E1CA 4KH0B 2OI2A 4NZ7A 3DRSA 1FEHA 1JNZB 4ECTA 3I55S 1J5OA 1EZZB 3ZTPA 3HVWA 4K4TA 2Y8YA 4DFJA 4ZP7A 4Q45A 1X5OA 5B09A 3I6PA 1NHVA 3I82A 2V8DA 4YOEA 1HKAA 4DSLA 2FVPA 3A8JA 5I3UA 2FVSA 1VC0A 3CCUS 1VLYA 1IBMF 3QAEA 1VQ4S 1JNRB 3M8WA 4L74A 1FJGF 2L3MA 4C8NA 1RT7A 4CT9A 3FMBA 2WBRA 3T9NA 4F0MA 3ILLA 3KMSA 4RNMA 1R8PA 2DRDA 2HURA 4LF2A 5A0YB 1RADB 1WC1A 5HL7Q 3ONQA 2VF3A 1DLOA 2GVZB 2YKOA 2FJWA 2KRRA 4IRDA 3OSPA 2F5GA 2WW4A 1DJ0A 1KQGB 2VPWB 3MMBB 1RTDB 4DHVA 1JJ4A 1J2VA 1U45A 1VQ6S 3N79A 4I2QA 1AROP 2DGQA 2UXBF 1BHNA 1X4EA 3H2UB 3CTRA 1ZM4A 3D28A 3FRYA 1URRA 2F1FA 4ZVFA 2K3KA 1JLBA 2GNKA 2U1AA 3VVUA 2AZ3A 3CSKA 1XNRF 4OYZA 5DLFA 1LV5A 3R3TA 1RT3A 4PXCA 1EARA 5E3QA 2C2ZB 5KT4A 5GMDA 2VONA 5G0RB 1FX2A 2J0WA 2LEPA 2VQFJ 4AUKA 1ITPA 1R8CA 3D0IE 2DNMA 4WPAA 2ZJQQ 1RAOA 4ZVUB 4A8MP 4TY8A 1BQNB 2CQHA 2XGPA 1MMDA 1T3NA 3F44A 4U7CA 3UW1A 5D3GA 3W65A 1R0AB 1HI1A 1HNXF 2D3O1 5IXUA 3W2WB 4PG5A 4B3MJ 2OJ3A 3JSMB 4DPWA 4C0OC 2M2BA 4L3KA 4B08A 4MK9A 4E8UA 4DPTA 3MMAB 4Y00A 3Q8UA 2ZM6F 3OTOJ 3Q8YA 2HSEB 2BANA 3ADAC 2KH9A 2I5JA 1T0TV 5H1SV 2EVZA 1PAUB 3HHLC 1NKBA 2E66A 3AFGA 3CD6S 1NNDA 2C2MB 1FJCA 1MSWD 4G1PA 2CNKB 1FRLA 1D9FA 2LU1A 3BH7B 3V6DB 4HL9A 1FRIA 2FJDB 3BGRB 1HQUA 1JLQA 4E98A 2UUCF 3M2VA 1VQLS 5DZ7A 2ROEA 2YQ3A 1D1UA 4LF1A 1TUGB 4JI3F 1R27B 3CVKA 2ZNZA 4PR6A 1RT4A 4N47A 2JFKA 4WF9Q 4KH1B 2EC2A 4DR2F 3V2UC 1BY9A 3NAHA 1N56A 2MQPA 4X84A 1WSVA 4X4UA 3AD8C 4WYLA 1IBCB 4RNFA 2V2KA 2ADCA 3MDFA 3MPDA 3CJ0A 4ZHRA 2VKRA 4P10A 3CC7S 3UD5A 3MM7B 2YNHB 4KC5A 2BEFA 4UZCA 5T41A 2DKOB 5FJ4A 3KG0A 2N4DA 2AV5A 2UVRA 2C2OB 4K4ZA 5F8NA 2WB1D 2VODA 2FQQB 3K7RA 1LXNA 5LM7E 4N7TA 5KFCA 4B3OA 1L3KA 1XEZA 2AP6A 4LFCF 2CRLA 2DRBA 1TMJA 2JEIA 1FXLA 2RHSB 1N34F 1WI8A 2RMLA 2XO7A 3EX7B 2W4PA 5FLXY 4N76A 2HZCA 2BBEA 1PJ7A 5A8KA 4JYAJ 3GLJA 2RDIA 1UW4A 3O5TB 2W4CA 2QMUB 5ETTA 1CC7A 1Q1KA 4ZLLA 1KWMA 3IRWP 4LQ9A 1EETA 2WTFA 1NKCA 3AJDA 2BRKA 4ATNA 3M2RA 1B99A 3ZNUA 3J7YI 1TKDA 1D8YA 2FTRA 2XWYA 4LSZB 3C14A 4P2MA 3BQ0A 1VQSA 3H5XA 2YY3A 2EFNA 1P9QC 2JC0A 1BMQB 3GJQB 2WCXA 4F36A 2EPIA 4J9OA 4K59A 2KYXA 5IT9Y 2HAIA 5FDLA 2M8DB 3J80U 4JV2A 4ZJQA 3GIJA 1R6YA 1CJKA 2AJ1A 1HBNA 3OVAA 5E2QA 5IT0A 3FEYB 4M5DA 2Z57B 1GMUA 4WXWA 3NCRA 4OYXA 1SV5B 1JLGB 5B0DA 2HQGA 3K5PA 3OFHA 3TANA 2GIFA 4DX5A 1MLAA 4DV5J 5EN1A 2CJQA 3OFFA 4LRFA 2RUGA 2NYIA 2PEBA 3ZZ0A 1QAJA 3LH2S 1S1WA 4YB1P 2Y1IA 4ZVOB 3D2WA 4U6PA 4KKOA 4RO0A 1KNZA 2G4BA 4L73A 5HATA 1W25A 1XIQA 3Q22A 4NCGA 3LTOA 2VQFF 1EP4B 2OFHX 3DC2A 1GEHA 2HHSA 3DMJB 4MMOA 4EK2A 1TUVA 4NLYA 4WYWA 2IBKA 4WCEQ 5K8PA 4WZQA 2W2OP 2Z2MA 2QEXS 5T7LB 2UZAA 1T9UA 4RU9A 1HMVA 2CJYB 4K0KJ 3RB0A 1NJIT 4UOHA 4B3MF 5KT5A 3DLEA 5C2CA 1C1BA 1GAOA 4JI7J 4NX9A 2BE7D 2KJWA 3VAFA 2OELA 2KI2A 8AT1B 2E9TA 2EK1A 4F3OA 3A4TA 1IKYA 1VBKA 4ECUA 3OTOF 4O3NA 2UUAJ 2R2RA 2GC8A 3DM2A 2QSWA 1VOMA 5KFXA 4X4PA 4KHRA 4UUXA 1NJXA 4WIIA 4O3OA 4ZS6A 5HVFA 2YX7A 1FDAA 2NUHA 4F4WA 2B5JB 3G8QA 1QVFR 1T03A 2QMWA 4TU9A 2YX4A 2RT3A 5C25B 4ZCKA 3ZZTA 2RRNA 5KFJA 1RWMB 3OFEA 5KFUA 3VALA 2NR0A 3FBBA 4NCBA 4MFBA 2XYPB 4C6AA 4ZLJA 1RAIB 2G0CA 1J27A 2A1BA 1OSDA 3R27A 1RHJB 1P6TA 3FSXA 4ZPAA 4I67A 3SSSA 4G1QB 2YKMA 1UWBA 3H20A 4O0IA 1SXLA 4RW6B 1U0HA 2VPZB 2HWTA 4XTTA 1VFJA 4BS2A 4X4QA 2BYCA 2C3OA 4C97A 1UA1A 4USKA 2ZH4A 5ITHA 2GMJA 3D6MB 4O23A 2NPFA 1C1CB 2V94A 2BMBA 3CGIA 4ZLNA 5K8NA 1K47A 1HPZA 1KHWA 4NLWA 3FSIA 2ZBCA 3C6TA 1LOUA 1Y3JA 2R42A 4FF2A 3HFZB 3GFHA 3M8PB 2HWIA 2DNNA 2ATLA 2QG9B 2W2MP 3M2UA 4F26A 4L3NA 2UP1A 4MTPA 3U1NA 1N0VC 3QZ7A 5HBMA 4NLXA 3UPFA 1UVKA 3PJWA 1F5AA 5H9EK 3WDOA 4D3HA 1F3VA 4LUBA 2PSZA 1VI7A 2IHR1 1A7GE 5E3PA 3BPDA 4LQ3A 1B0TA 2FD2A 1WC0A 4JYAF 4BWJA 1S0NA 1B4SA 2XO6A 1OY9A 2Q43A 3G71S 3CCLS 4M5HA 3TUJC 4DV3J 5KFNA 3KMQA 3QBCA 3VF0B 4YB5A 2DD8S 2R8IA 2Y9HA 1F9FA 3E01B 2Z2LA 1FKPB 5A8WA 1N5YB 5IC4B 3HX9A 1XQIA 1IWAA 2C3UA 3TEHB 3ILOA 1PJ5A 1WF2A 4ZITA 2AKWB 2K1RB 1JLFA 1NJYA 2G1DA 2IRXA 3OD2A 4OI1A 2OTLS 1BGXT 2HRUA 4ILLA 3PVXA 3CO9A 4B9TA 4F4XA 4MIAA 4DQPA 1VRQC 2MLYA 5A2QY 4FYYB 4NLPA 3EICA 1UCNA 1N5SA 1UEVA 2LMIA 2VBYA 4CO5A 3H25A 4DV5F 4Q5VA 2LA4A 3POTA 4NE9C 1TAQA 1RTHA 4WU3A 1YHQS 3FK4A 4NLTA 3KK2B 4ID8A 5CH7B 3D1QA 4DS4A 4AFFA 3QIPB 1P27B 4Q0BA 3H2VE 5JXSA 2XZWA 2DCUB 1VR6A 3V6KA 1RTIB 2I6WA 1HQEA 1K1SA 4KIAA 5B08A 1AZSA 2DBBA 4KGKA 1D8ZA 1SQEA 4O4GB 4Y2CA 3BSAA 2L9DA 4KR0B 5KG2A 2DHHA 3I0RA 1J5EJ 3GYNA 3G6XA 1FI4A 3KHRA 3R2CJ 4QR2A 1JLEA 4USHA 2RDDA 1NCLA 3UCZP 4FS1A 1YZ6A 4U67Q 2DHXA 3X1LB 4YB6A 2QJ3A 2RU9A 3ZXWA 4CO2A 1HHSA 3FBFA 3CDBA 2HGLA 1CEZA 2UUBJ 4K0KF 1GX5A 4FF3A 1AUDA 5LMUJ 2EFQA 2LQ9A 1JXLA 4JI7F 2WHOA 1LWEB 4GO5X 4B3TJ 4HHHA 4ENOA 1S12A 3OW2R 2A6MA 2IFXA 1Q78A 4TNOA 2UUAF 2L41A 3KHLA 2E5HA 5DG9A 4DN0A 2QLBB 1OQ6A 4PG6A 3R5JB 4A8KA 2DO4A 2WVFA 4YUDA 4OX9J 3DLLQ 2GIRA 4C0HA 3IBFB 4TY9A 3HJVA 4CZCA 3Q2SC 9RUBA 2OUGA 1HNWJ 3MMJA 1NRKA 1RYRA 1IR1A 1LWCA 2MKKA 5KFVA 4ILRA 1D3WA 3ETOA 2BQ3A 3QAUA 3KLGB 5KG0A 4DF4A 3OHAA 1I5OB 3DOLB 2H5IB 2JHEA 2HWHA 4I69A 2H65B 3TAPA 4DX8H 2KG0A 3DRRB 4HT7A 3KUHA 4ICLB 5KFKA 3FQKA 1BC6A 4ZP9A 1SIWB 1U2FA 4J7CA 3QGHA 2XMKA 1XN9A 2OIHA 3R1LA 3CDWA 5AXMA 1VQMS 1FHTA 1T9WA 3WIVA 4MH8A 4CNYA 3G2XA 2HNDB 1IQZA 2CUYA 2GVZA 5L1JA 2OD4A 3M1VB 1S1TB 3OXFA 4DPXA 3MMBA 1RTDA 2ZJRQ 3MMCB 5KFBA 1U1NA 2IMOA 2RF2B 4A46A 1S9FA 3W64A 4RUAA 4H4OB 4NI2B 1ZM9A 4W4MA 4QIGA 2X7IA 1WTBA 3O8WA 4DR5J 4FF1A 3DFEA 3US5A 3HHDA 3W5XA 4MK8A 5G0RA 2V68A 4HLBA 2EFPA 4DV3F 1ZZFA 1VQKS 1ZYQA 2QTWA 2Y1JA 3RRHA 5ETMA 3BGLA 4J9RA 1UVIA 1LK7A 2XMJA 1BQNA 1TK8A 2EBEA 2IJRA 3UR3C 1FXDA 1TZ0A 4HI2A 5DETA 1R0AA 4QJVA 1W26A 4EBDA 2NUUG 2AGQA 3W5ZA 3QZ8A 5JVHQ 2D7SA 3R7BB 3W2WA 1RCOB 3KKFA 2CJXB 3CPWR 3JSMA 1ICEB 2HIYA 3IMQJ 5J2NB 5HP1B 3DHXA 3FKBA 3M8QB 2YWEA 3MMAA 5SUHA 2DNPA 2J8SA 3ICLA 2XULA 2MTLA 4IDKA 4NOHA 1DHMA 1V6HA 1T95A 1MROB 3CT9A 2DNRA 3G4SS 3CCES 3NCPA 3V6DA 4IO9Q 5AE2A 1YQHA 4LFAJ 4F25A 4QU7A 3BGRA 3GPAA 3OTDA 4ERDA 3G8TA 1TAUA 2DHSA 4U7UD 5L38A 4C4WA 1Y5LB 1HBMA 3G6YA 1J5EF 1TMMA 4YDDB 4KTQA 1NB7A 2XMTA 4ZCLA 2BX6A 3H59A 3MEKA 3CJSA 2PT0A 3PIOQ 2C1EB 4KHPJ 2AHOB 3AJ2A 1GQEA 4HACB 2UUBF 2MSTA 2FLPA 1GNKA 4USVA 3IRXB 3QRPA 5ETLA 1Q7YT 2VICA 5LMUF 3ET6B 3K17A 2EFVA 2ZBQA 3MFHA 4B3TF 3IR6B 3MM7A 1UWAA 2YNHA 2V67A 3N9UC 2MHEA 1H7XA 4R25A 2W9AA 2HG4A 1YX2A 1C4AA 3NMRA 2RILA 2HHHJ 1M90T 3SDEB 1FWPA 4F2SA 3O3LA 4OHYA 4M5IA 2W8KA 1S4EA 1L3UA 3H40A 3MEGB 5KFFA 1HBOB 4OX9F 1S9GB 4KV8A 4DSIA 3EVOA 1WORA 1EX8A 1TK5A 1PIEA 2EW9A 1Q8IA 1HNWF 1MMLA 4C2MA 4WWSA 1WC5A 1RI7A 3KLIB 3KHHA 3MAQA 3NS6A 4X2BA 3OPKA 3DOKB 1VBZA 2LA6A 3EZ5A 4WFXA 1NPRA 1YITS 2JSXA 2R7WA 2Z2ZA 3QWUA 2RQMA 2RDJA 1HI0P 5B0FA 2VB6A 3MCMA 2UV8A 2HLUA 4RJVA 1H98A 4OZ2A 4F4ZA 5D0GA 1DY3A 2AX0A 2RH3A 1PC5A 1MNEA 2CQ1A 2KT3A 3WX8A 3CULA 1ACMB 2FGCA 2WONB 3Q8VA 1HNVB 1TL3B 5AT1B 3PW5A 4FDFA 2XC9A 4FBUA 5A8RB 2E1RA 4CI0B 2OFGX 1I51B 2CQDA 5DO2A 1NAQA 3KTQA 4Y6IA 2QC3A 3AB2B 1JJ2R 3DLHA 2OP5A 3EE3A 3EGWB 1SV5A 3K0JA 5E41A 5AE3A 2QT7A 3QO9B 3P3DA 1CLFA 3BKUA 4OX8A 4P2SA 2KZMA 1O51A 3B82A 1YJUA 1VYAA 3TJAA 4EGLA 2MYFA 5FD1A 4K4XA 3LP1B 2X1FA 3T1YJ 2Y8WA 3JYTB 4DV6J 1GK8A 4DR5F 1Q82T 2CPDA 1AW0A 2RUSA 2QFJA 3Q24A 2AGPA 1LXJA 3DDKA 3HSDA 4FN5A 4CO0A 1ZAXA 3TO8A 3MOJB 1EP4A 3ISZA 2BQRA 3DMJA 3BH6B 3IM9A 5H9EJ 1RAEB 1GT8A 3C66A 2J7UA 5BXIA 1KTVA 4B17A 1H72C 4P71A 3MTKA 2HPUA 2IMWP 5T7LA 2ALYB 2HK2A 1P9YA 3W61A 2ZZTA 2KXNB 1F0XA 2IA0A 2FY8A 2DR9A 1NEEA 8RUCA 4K5SA 1FX4A 1X4HA 3FRZA 3SZ2A 2HVHA 2W9CB 2F9DA 3CDEA 4MKYA 3QSYB 1QSLA 3HJFA 2AZ1A 1F5BA 5HMYA 4A48A 1SKSA 4F7VA 1AXQA 1X4FA 2P6SA 4KHMA 2CPIA 1SVDA 1S97A 1S99A 4OX7A 4PPZA 3J81Y 2FJAB 1NKEA 3P5BP 4ZLPA 4K7QA 2B5JA 4LVNP 1GTEA 4DFPA 3IM8A 2E5GA 4QWBA 1WHWA 4LFAF 3ZTQA 1IN0A 4X4VA 5C25A 3QT8A 3KNAA 2HGMA 4FYVB 4P7TA 2YQ1A 5K9FA 3K5MA 2YH1A 5IQQA 3RRGA 1UVLA 5D0HA 3VAKA 3GSIA 4J9QA 1JB0C 3FCWA 4DV1J 4QYZJ 3ILJA 1HYSB 1K1QA 2HLTA 2VG7B 3OVSA 1Y10A 3FNNA 2JEGA 3NWGA 3QJLA 4KHPF 2GQCA 4G1QA 1R43A 4OV6A 3MAAB 4RW6A 2WSCC 5D4OA 2AU0A 3R5BA 2XY6A 1N5VA 3R5DA 2DR8A 5D4PA 3JQMA 4GRSA 2BDPA 4PUOB 1C1CA 1C4CA 3RU0A 4USTA 1U48A 4PAAA 2VBZA 2HHHF 2HQFA 5AXLA 5KAKA 2PEHA 1LQ9A 1HHTP 3L09A 2XG8A 4PWWA 3S6EA 2OAUA 2P5VA 3C3LA 1VK8A 5K14B 3J7YU 2DPJA 1KONA 3T1HJ 4DQSA 1FKOB 4FPIA 5IT4A 1KC8T 3OLAA 2XYHB 4V19J 2FZGB 3G96A 5G4DA 4URQU 2HQIA 4CCHA 3LGMA 4DV0J 4DZ6A 1EQMA 1L3SA 4Y28C 4NZ6A 3SI8A 2YWHA 2HVZA 4RUCA 2PI4A 4WZMA 4WKRA 3MUVP 2R3VA 4QQBA 2V69A 4F04B 5CCMA 4ETXA 3DI6B 3I32A 3LQVA 2CJBA 3UCGA 2DT9A 7FD1A 2DIUA 2H54B 4YHHJ 1Q16B 1SH0A 4DV2J 2O3DA 3E01A 1XWLA 2YXLA 1FKPA 1N5YA 3HHKA 9ATCB 1HWJA 3ZZRA 2HZVA 3CEDA 4O0NA 1GX6A 3MR2A 3VGUA 3OFGA 4K4SA 2RKIB 1QAYA 2YPYA 1S48A 3R1HA 4PG8A 3C2PA 3T5HA 1RA7A 1HWIA 4UF4A 3PEJA 2Y1RI 2GGPB 2CPZA 4EI2A 1I94J 5E0OA 2VOPA 1FDDA 1SQGA 1Z2LA 3G6VA 4P6QA 1U1OA 3HHLD 2OLWA 1YZ7A 2AT1B 4LF6J 2QLXA 4WFZA 5JVGQ 3KK2A 4DWIA 4EO6A 4AE5A 3QIPA 3GCWP 2CJKA 3EPIA 3QT6A 4XIUA 2MY8A 3T1YF 3C15B 1ZETA 3MR7A 4DV6F 3KLEB 1ULRA 1RTIA 3RW6A 3EZOA 3GIIA 3QRQA 4QWCA 4O4GA 2DH8A 1VIOA 3RAMA 4YFUA 5B0GA 4OFZA 4B9LA 1LWFB 2MQOA 4DF8A 1Z2ZA 3I31A 1HFEL 4HKQA 2MZTA 3U7JA 1CG2A 2F63A 1XC9A 3IG1B 3AA9A 3N6NA 1U6ZA 4PYAA 2ZWPA 4EBCA 2RRAA 5K5MA 5FLXU 1U1MA 5AXKA 3RR8A 4FVCA 3SCKE 2MXYA 5CYMB 3HSZA 3AJ1A 1LWEA 2R2TA 4OJ1A 1NJZA 1JXEA 1U1RA 5JUMA 3NP5A 4A8SA 4OHXA 4YP3A 4PRFA 3JTPA 3GB0A 4WBFA 4NYOA 3MURP 3T5LA 3MEDB 1RWKB 1IBKJ 1SQFA 2V63A 3C6UB 1NUEA 2C42A 4OZJA 4CWBA 1SPBP 2FHMA 4Z37A 3K2YA 2J0SD 3UN2A 1FESA 1XNQJ 3DXBA 5IT9U 4ED3A 4DR7J 3SEOA 1B0PA 2W2NP 3CD7A 1S6OA 3D66A 1VC6A 3D54A 3KLGA 2LDIA 4DV1F 1UTAA 1OY8A 2GAHC 3P5TL 3DOLA 1KLNA 2V9KA 3DLKB 5D15A 5KFMA 2CNNB 5EDWA 3DRRA 2NZ4A 3A12A 4ICLA 2KO1A 3LF0A 5E3CA 5LSOA 5RUBA 4OIXA 3VGSA 4P73A 3MGJA 5AE1A 2Q3PA 2W2QP 4ZVSB 1IWGA 3BSCA 4RW4B 2EG2A 2HQDA 5IWAJ 2CQ0A 2UXDJ 3U02A 2EBGA 5F3TA 2UUWA 4LBPA 1X4AA 2A0FB 2OMLA 2FUG9 2ZDPA 5HAOA 2NREA 1K0TA 3TZYA 3R8YA 4EUVA 2G9OA 1VBYA 1KP6A 4ZK7M 2BW7A 1REVB 2HNDA 1RP5A 3AOBA 5CQGA 1RDRA 3BEGB 3PX0A 3T1HF 4H4KC 2V2VA 3M1VA 1S1TA 5JMNA 2NXNA 3MMCA 2MKIA 1AFJA 4ER8A 5E7OB 2RF2A 2BE9B 4DV0F 1HWUA 4TU8A 4H4OA 5KFEA 4NI2A 1X9MA 3CIMA 1TV6B 2HFSA 3SFGA 3N28A 2J0QD 2ZH9A 2H9ZA 3JSBA 1NDKA 3H8YA 1HA1A 2NYHA 1N4LA 4RL1A 1Q5VA 3P49B 4YHHF 2D74B 2GHWA 3HD2A 4DV2F 5A6PA 1DZ5A 3N01A 3D3BJ 4WK1A 3MXHP 2GHPA 2E7WA 2QMXA 2F7VA 2J9DE 2VDIA 3D1HA 2DNOA 2JLFA 3DKDA 4CLWA 4LIWA 4DEZA 4I64A 3IWXA 2GFFA 5HO4A 2VHGA 4AL7A 1YRXA 3TP2A 5HQLA 1X9WA 3EDQB 3IXQA 2CAJA 3K8VA 1I3OB 5IQ6A 3MCNA 3O2IA 2GQQA 3DXSX 4G6VB 4GO7X 4P75A 3W2VB 5J2NA 2VIHA 5KFYA 4KB7A 1I94F 5L39A 1FEEA 2CG8A 1WDTA 3UNYA 2QL5B 3NNAA 3M32A 5D0RA 2YQ0A 2ERRA 4M95A 3GSDA 3TX0A 4XO0A 5DM7Q 4YMEA 1MROA 4LF6F 1RLDA 3IGNA 3EGVA 1U2RA 1T3OA 2RNEA 4NPOA 5EX0A 3W63A 4DSKA 2AF6A 4DX7A 4ED2A 1GH8A 1S4FA 2NPIA 4ECWA 4TU7A 3M6XA 2CJ9A 3TA1A 2RB7A 4K8RA 4X4NA 2F8MA 3ELHA 4NYPA 1ZBTA 4KAIA 2MKJA 3KUEA 3CJQA 4DQQA 1GMVA 3A3NB 3AHPA 2M88A 2ZH1A 3D1OA 3FEZA 4CH0S 2HFUA 2IAJB 5DDRC 3EJMA 4ZCMA 4RU2A 1BWVA 2CADA 3KG1A 2VKZG 2V8GA 2P9EA 1RUSA 4HACA 2GMLA 1TTHB 3RBDA 5KFOA 3IRXA 5D78A 5AXNA 3KJQB 2V34A 1Q8KA 3ET6A 3IN5A 2QA2A 3H5SA 3E3XA 2BJEA 3MF5A 3V6HA 4C8MA 1X4DA 2HGNA 2WOMB 1NK4A 2BOPA 3Q89A 1WACA 3PX4A 1R7IA 1IBKF 3GZ7A 1T8EA 3OJSA 2B4UA 2XGQA 3LAKA 3TQEA 2DVIA 4ZJLA 2P9GA 3MEGA 1HBOA 1S9GA 2EKNA 1KFSA 1XNQF 2HW3A 3C16B 5JJBA 2B9YA 2R8KA 2XY5A 3AA8A 1Z4UA 2BKOA 2ZUAA 2NXEA 1U1KA 4DR7F 1CS4B 1SJRA 2KJVA 3TQ1A 1EB0A 5KFGA 3KLIA 3NGKA 5HVGA 3ZFVA 4C8LA 1UVMA 1T9VA 4QZVB 5A2QU 2G0IA 3L95X 3OR2B 1ZAVA 1NDCA 3DOKA 4J9LA 4AL5A 3UFCX 3CJ8A 3PYGA 3EWGA 1C0TB 5HLFB 2HQCA 4ES3A 1IQTA 3KK1B 2VFVA 3BF4A 4CTAB 2CPHA 3V6JA 3I0SB 2B9WA 2JX2A 4D3GA 2RE1A 3BGUA 3VHQA 2WONA 5DM6Q 1HNVA 4H4MB 1ZPWX 2VFTA 1TL3A 5IWAF 1L3VA 2EKYA 2UXDF 5F3ZA 3AOCA 3PKYA 5A8RA 5DG7A 1IKVB 4K2XA 3NNCA 4DI6A 1S6PB 5GMKa 4DPOA 4EYIB 2Y0SD 3RGIA 2HFZA 5DGBA 4HTJA 4DCPB 1TU0B 4DUZJ 1YJNS 3QO9A 3P6YC 5EUHA 1S1UB 4WFYA 4I6AA 4BBYA 1CJVB 4ED4A 2BVZA 3EGNA 1HR0J 4F3MA 3BDEA 1Q0NA 3LP1A 4AQYJ 2F4VJ 2QRRA 3UCUP 2EFOA 2BJ9A 3DGPB 3FFIB 4CLFA 3PR5B 3CC2S 3K57A 2V4JB 3SFUA 4FYDA 1SH2A 1WKLA 3CD0A 1NO8A 2GAGC 1UAWA 2KFYA 2QSFA 1RXOB 3QPIA 1HI8A 3CJTA 3HO1A 4ED7A 1HARA 3ZZYA 1BUXA 4URGA 5HMXA 3T1AA 3FSYA 4X4SA 2C2KB 2MPUA 4DV7J 3CCWA 3RZAA 3V81B 2DY9A 3RB6A 1RAFB 1VHFA 5HJXA 1KS2A 3PZPA 3NEKA 1FCAA 2MLXA 1WF0A 2YNGB 2NXJA 3GG0A 3QIDA 5CYQB 1NXIA 3M8RA 4PG7A 3K5NA 2L9WA 4EWTA 2DNZA 2AEMA 3S7RA 4ELUA 2UU9J 3OV7A 2W9CA 2KN4A 2BA9A 1U6BA 4K50A 1FWKA 1CC8A 2ZUGA 3NNHA 2GZOA 1NLKL 4KBIA 5HK4A 4MJKA 2A2CA 1DQ8A 4ZVPB 1YJ9S 3PIPQ 4YR3A 4FZVA 2L9NA 2M52A 3BQ2A 2FLLA 3IS9A 1FFWB 1U02A 3AQPA 2AMCB 1Q8LA 1Y3KA 1NHUA 2OPQB 1N33J 1BD6A 3LANA 1TUWA 4ZVTB 1SBRA 3HVRA 1SJ1A 1U8WA 2N4CA 4NRTA 4WFBQ 4ZPCA 3HP6A 4A8YA 1HYSA 2KDOA 1TELA 4MKVA 2VG7A 2XMUA 3VZHA 1T02A 4B9NA 4Q8FA 1WKKA 1UETA 2DGXA 3MAAA 4YQWA 3OT9A 1M5VC 4FVMA 3CF5Q 1NDLA 2FYXA 1QVGR 3KWMA 1ZOTA 1S1VB 1PBUA 4PUOA 5DQHA 2XMMA 2ADBA 2HS3A 1TL1B 3UDCA 4ECRA 3O1LA 1RYSA 5I42B 2YWFA 2DR6A 1IJEB 5KT6A 3BV8A 2G2YA 2X51A 4NA3A 2E1AA 3QLHB 5K14A 2V50A 2KM8C 3BO2A 1FKOA 1QE1B 2FHJA 3QSIA 3K8WA 1N8RT 1JWWA 1AFIA 2DITA 5KFHA 2JL9A 2JJ4D 2R7QA 4LBIA 4C8OA 1N5QA 2DGWA 2WVEA 4C8ZA 1N6QB 4LF5J 5IC6B 4BHQA 2M7SA 3BB5A 4R5PA 4DCOB 4RBTA 2UVUA 3LALA 4MKBA 3DI6A 2NLWA 3KJFB 1S6QB 3TRGA 2GA7A 4OZ3A 1YGYA 1TL4A 3DOMB 1OMSA 4DL0C 3P8BB 4IFYA 2WSEC 3AAWB 2RQCA 1NB2A 4WTYA 3BO4A 5I3UB 1HD1A 3UI3A 4DL7A 5DDOC 2RKIA 4YEAA 2B7BB 4RUHA 4PABA 2LQBA 4PCQA 1YJTA 2OD6A 2GGPA 1Y4ZB 2MZQA 5KOXA 4ZIVA 1FF2A 1X31C 5LT5A 1RT6B 3IFEA 2YNIB 3HZGA 4BC9A 4DUZF 4J9VA 4WFAQ 3PFEA 2AEJA 1MW7A 3C19A 4V1Ak 2R2UA 1BQXA 1Q95G 2DGOA 3AH6A 5CABA 4EMDA 3L4BC 2XSFA 1NHKL 1RWOB 3DHWC 1BQMB 1HR0F 3IGVA 2BR0A 3V4IB 2F4VF 4AQYF 1HW9A 3C15A 4TKTA 2YVSA 3RTVA 3C8YA 1BE4A 2V5HG 3KXDA 5L9XA 5L1KA 3KLEA 2E7XA 5J2PB 3NY0A 1KVKA 1IKXA 1WTFA 1PGZA 4NASA 4HHUA 3O44A 3PCOB 1M5KC 1IM4A 1HWLA 3UO0A 4FYWB 1RKJA 1KLMB 3RYLA 4ECVA 4ZVHA 3CCJS 4DV7F 3LP0B 2XLIA 4KFBB 4WP3A 1H38A 3GYXB 4J9MA 1XJWB 1G1XA 4QBUA 4TY8B 1S0VA 4I2PA 3U27A 2CQ4A 2QV6A 5L46A 5LXYA 2D9PA 4GKKJ 2CJAA 2RS8A 3TI0A 2X1BA 1H2VZ 5CYMA 4Y3CA 2UU9F 1R8AA 3JSRA 2M70A 4ID5B 1YTYA 3WHIA 2DGVA 3MTJA 1YVFA 1F5CA 1GMWA 3CCZA 1CJUB 3M4XA 2PDAA 3NS5A 3MEDA 1QM9A 3N0VA 1U26A 3NMAA 3C6UA 2WRMA 1KSPA 2UXCJ 5HROB 4B02A 2QYGA 3W9IA 1NMEB 5D6GA 2BJ1A 1T7PA 2LU2A 1NJWA 4DR6J 1N33F 2PN6A 1RKIA 2KFZA 1DFDA 1RHMB 1R6VA 3P96A 2V8PA 1R31A 2PIIA 2CPEA 4LIRA 2ZH2A 2CWXA 2XCAA 3KFWX 4CLSA 1RBAA 5BYRA 4DL3A 3DCAA 2FVCA 4ED8A 3RAQA 3DLKA 1K44A 2YNFB 1RAJA 4DL4A 1NK7A 4CM2A 2HBRB 1FVSA 4Y2KA 1OQ3A 2C3PA 2W1BA 4WE1B 1VC5A 1RAHB 2ZC3A 4P52A 2J7WA 3RBXA 1RTZA 3A3PB 3KJVB 3FUYA 4RBVA 4RW4A 4DR4J 4OYBA 1MU2A 2Y3YA 4IG3B 2OGUA 3UNGC 2ZHAA 3TEGA 2CQPA 2F8HA 1A6LA 4RW7B 1AT1B 4OJHA 1N48A 1RACB 4QPXA 1UFLA 2D69A 4ETZA 3VAHA 2DHGA 3BN4A 3E8OA 3A13A 1REVA 1DURA 4RW8B 4ZMMA 3DNCA 4J9UE 1X5SA 1WDDA 3LOUA 3QT7A 2OSRA 4LSNB 3U1LA 4FKXA 2NZCA 2AYMA 3W5YA 5ETSA 1FRHA 3DLGB 4QIVA 4K5RA 1FRKA 4LF5F 1YJWS 1YG0A 1TV6A 4DX6A 2AX1A 2O67A 4ED5A 3FCHA 1YJ7A 4HH0A 5K8MA 2F65A 1WOPA 3FZ2A 2HHQA 1IR2A 4MKAA 3PR4A 3BM7A 1FFSB 2M8HA 3I4PA 3RBZA 3J81U 3HVAA 2QN6B 2EC0A 3QFHA 4I1TA 2DH7A 1EETB 2FLNA 1N5TA 3CJ5A 5KFAA 4E2FB 2V0NA 2B9EA 7AT1B 4C11B 3OSNA 3DU6A 4B9UA 4IUFA 2W24A 4O3SA 1B0VA 4ZP6A 1H7WA 4FF4A 1OYEA 2L08A 2DCLA 4O3QA 3ZTRA 2LQJA 4ZVGA 4CLUA 3W2VA 4DR1J 4ZDNA 3BREA 3ILIA 3JXOA 3BKFA 3RUBL 3OTCA 2KL8A 4RWWA 3ZZUA 1HBNB 4IFVB 2ZNYA 3OR1A 4F0KA 2V6AA 2M3DA 1HLWA 3DLBA 3W62A 2DGTA 2PA8D 5J1NA 3G82B 3DLJA 2AW0A 4NLOA 2JEJA 4YN3B 3V4MA 2QIFA 4J9NA 3UDLA 2D41A 2QYCA 1G3OA 4IQXA 2W9BB 2AGOA 3B54A 3NOGA 1UEUA 1WI6A 2XI2A 3OL6A 4XK8C 3DYAB 4R8UA 2B4PA 1XR6A 1OIAA 2GIQA 1S77D 3IR5B 1L5UA 1SKUB 3PY8A 3BBCA 1Q5YA 2XYGB 4KGZB 2LVWA 1YLXA 2XQCA 3HPOA 3R6LB 4NCGB 4K4VA 4MYTA 5MLCV 2IAJA 1S5ZA 3MPUB 5F0UA 5BYQA 4HDHA 2XY7A 4OYMA 1QAIA 4ECSA 4OI0A 4JB8B 4HYKA 4GKKF 3I87A 1NM2A 2J9CA 4WKYA 3IBCB 2IM3A 4R0JA 3L7UA 4CLKA 2C2DA 4Y65A 4W92B 2WOMA 2R7UA 4LSLB 2OPSB 2XZTB 2UXCF 2HNYB 4OL8A 4N41A 3TAQA 2CQ2A 3LA0A 1NZAA 3C16A 4DR6F 3M7VA 2FY1A 4QOTA 3UD3P 3ZTOA 2JOQA 2YKAA 1CS4A 4RBUA 2D3UA 1F1BB 3ZC4A 2RRBA 4CLLA 1YBTA 5KT2A 2QO3A 2BJDA 4RWXA 2HBYB 2ZEJA 3OR2A 2I0XA 4UQTA 1JK9B 1H3DA 3AD9C 4A8WA 3MR6A 3N5BA 2DB1A 3WX4A 1C0TA 4TVAB 4CLPA 5HLFA 1WC6A 3SSQA 2LEAA 3KK1A 1PBAA 4CTAA 5KTQA 5KG1A 1G4CA 1IVZA 3I0SA 4FBTA 2CWKA 2HVIA 3GYGA 1IJFB 3C46A 4Q2LA 3D9BA 4I0WA 4DR4F 4LRCA 4OX6A 3RG6A 3GJRB 4X4OA 3GIMA 5IZHA 1KOOA 4GC6A 3UDEA 5BJRA 1IKVA 3PYDA 3H4BA 2HNZA 2OEKA 1MWQA 2CZVC 1S6PA 3W8GA 2MJUA 2HMIB 1CSJA 3HF5A 4DU7A 4GVBB 2NCKL 4LF9J 1D9AA 5F9LA 4NLSA 5I3QA 4DV4J 3GG1A 4PG4A 3HULA 4LF8J 5KFWA 2LXUA 2COLA 2UVWA 1YJRA 2P8IA 4C8YA 2KHDA 1HL6A 3TVYA 5ETOA 3OXGA 1CJVA 3CCSS 3PW4A 5HBMB 4OZ1A 2PC6A 4RX6A 3SYZA 1MMNA 4DS5A 3DGPA 3FFIA 4UUWA 4URSA 4LBHA 5EWGA 1UFKA 3UN3A 4JI1J 2OEJA 1RK8A 3NGDA 3PKMA 2ZH6A 3PYEA 2V4JA 1NK8A 3IO1A 4WTOB 3VAIA 4M5GA 1UW9A 2LLZA 3TUZC 5CD4H 1C0UB 4ZVQB 1UVJA 2IDEA 1RHQB 3M05A 4JI4J 5CHCB 4O44B 4DSEA 3V81A 3PRVA 4QYZK 2DISA 2KKHA 4UY85 3BBFA 2YNGA 5CYQA 3ZZZA 3CNQP 2QL9B 1JLFB 1PYOB 3OHBA 2C3MA 2DIVA 4DR1F 3K59A 2ACYA 2Z30B 1DTQB 2QX0A 1K8AT 4LF4J 1VLOA 3UQSA 3B78A 4LRAA 1W7WA 3I5BA 4U7UK 3TNVA 3HHLB 3H98A 2EFGA 1O8BA 2QE5A 3LUYA 4TLQA 2W01A 3J7Z5 4IOBA 2EK6A 3M8SA 2YKPA 1KVJA 2VFUA 3I56S 1PG5B 3CCQS 2ATCB 3DRPB 2OPQA 1RT5B 3HKWA 4WJBA 4GC7A 4IH5A 1Y5NB 4CYUB 1R0CB 2DH9A 5IM0A 3RR7A 3LO3A 5GAHI 4RW9B 1WC4A 2Q6CA 4CLTA 1REGX 5KOWA 4Q7AA 1HQEB 3AXKA 2HIQA 1RGVA 3EVMA 2BJ8A 3HXMA 5ETKA 4ILMA 4IKAA 5LSLA 1FRXA 3I0RB 3NKYA 3M8ZA 1TQLA 2MMYA 5B0EA 2FVRA 4G3IA 5KG7A 2MGZB 2DR7A 1FK9B 2LP4A 3EGZA 1TKTB 1S1VA 1TVRB 1VK3A 1M1HA 1TL1A 1KVIA 5I42A 2FPHX 4CO4A 2OHDA 3JS9A 1SJ3P 4DDFA 3TVKA 2POKA 2D9OA 3N6LA 2J6SA 2BOAA 1XK8A 3QLHA 5J2QB 3TAMB 3CC4S 4DQRA 1QE1A 3F73A 3Q23A 2MQQA 4QCLA 1UVNA 1NSQA 2XWXA 3KNGA 5F41A 2CKWA 4HDGA 1MWYA 3CJ3A 3THPA 3PM9A 4AYBD 2R8JA 3PJXA 1TK0A 1N6QA 4WP8A 4TQSA 4KGVB 3MD1A 1UZDA 3SQOP 1RHKB 4DPYA 2PD1A 5LSRA 3FBCA 3FC9A 2VASA 1EKSA 5IV3A 1X9SA 1SC1B 2GMHA 5A0YA 3Q2TC 4X4TA 2FHKA 1X5TA 2PGCA 2LXIA 3E51A 1X60A 2A18A 1S6QA 3G87A 2ZC4A 2CFXA 1D0EA 1HHQA 2C2NA 3DOMA 2BRLA 2R9LA 5EWFA 3H2LA 1WOSA 1MN9A 3LPYA 1SJ4P 3FZBA 4WFNQ 4QWAA 3LP2B 2VL1A 2RD5C 3AXMA 2PA3A 1UKUA 4A8FA 3CJKB 3QJJA 4JV5J 4F3QA 4ECXA 4NEZA 3HI9A 4LF9F 1RT6A 1N52B 4HH1A 2VG5B 4F4YA 2CDQA 2JFDA 4DV4F 2YNIA 4LRBA 4LF8F 2VPYB 1JXVA 2FDNA 1QJHA 1S72S 4FNIA 4L72B 2VPXB 1G6BA 1BQMA 3V4IA 2E5JA 4C48A 4JI1F 2R8HA 3MPYA 4OJGA 2MHNA 3EVWA 5J2PA 1FERA 1WUUA 4ELVA 1ZTTA 1TL5A 3GFYA 4YY3J 2GJ2A 1UPPA 3WBZA 2V9WA 1B3TA 5J1PA 2MQNA 1KLMA 1F60B 5L1LA 3MHYA 4HR2A 2XB2D 3R6GB 1LW2B 4JI4F 3LP0A 4ZPVR 4KFBA 2JDJA 4DFKA 3MM5B 3GIKA 1S7HA 3BR8A 3CUNA 1Q4RA 4ZN3A 5M2PA 3I9ZA 2B8QA 4KE5A 4FP9A 2XHWA 1ZTWA 3EXYA 1H74A 2G2ZA 5J1EB 4B9SA 2IJFA 1VJWA 3BBBA 3W9HA 4LVOP 2O1PA 4LF4F 2Q1LA 3M9NB 1VQOS 4ID5A 5HSPA 4B3RJ 1CJUA 2DXEA 2J9EA 1CULB 1YRUA 3GE9A 2YKNB 2IRYA 1WEYA 3QRRA 5LXRA 4KO0B 5HROA 3O6QA 1DRZA 5LOQA 5IOLA 2VUGA 2XBPA 3BKTA 4IDKB 1GMWD 4A8QA 2XMWA 4XDDA 2EXUA 2UVVA 3NGRA 4M94A 3WIUA 1FNMA 2H4YB 4IR9A 3KJNB 5IFMA 2YBVA 1O5JA 3TUPA 2VH7A 2IC3B 3CXCR 2K7KA 4TYBA 2I2YA 2ZZMA 4N77A 1JMTA 2HVDA 1FRMA 1WF1A 1VDHA 3MAHA 5LMNJ 1OSCA 5BR8J 1YI2S 4MAKA 1NDPA 1FD8A 3BSOA 4RKUC 4ZVEA 1FE4A 2YNFA 1R3NA 2Z4PA 3KDNA 1EHWA 1HBMB 5HN0A 2BQUA 2HHUA 4CH7A 4RNOA 4WE1A 5C2GA 3PRBA 3SXLA 2AEFA 1U24A 3KJVA 3GIRA 5KG5A 4BDPA 1U49A 3OUYB 4IG3A 4LR9A 4GMKA 1S59A 3HVTB 4RW7A 2CPXA 2GV1A 4NLVA 3LW5C 3OTBA 2OPRB 1OPZA 1WHYA 2LYVA 2MKHA 4U9RA 1U2CA 4RW8A 1KKHA 2VV5A 1QSSA 3D0GE 2ZVIA 3TZWA 4FXWA 4ED6A 3HDSA 1G2EA 4LSNA 5D8HB 4V19X 2LXFA 4KV8B 1PJ6A 4LMZA 2Q79A 3DLGA 4ZOSA 5J2MB 2PMWA 3AT1B 1QUPA 5KG6A 3BN7A 1FVQA 3K58A 2KRBA 4FXDA 3JAMY 3GONA 4JI5J 2V4RA 2IM2A 2NXCA 3NWRA 1KOHA 2HEKA 3R97A 3SV4A 4OMFG 3OQ2A 2IVFB 2XEXA 4AT1B 2OSQA 2XS7A 4WK3A 5A76A 2NSCA 2BXJA 2WAQD 1IKWB 1RCXB 4HT5A 4Q2MA 5C42B 2H4WB 1JLGA 1OO0B 4F2RA 2MQMA 3UR0A 1N54B 2BW2A 3PJ9A 1CQMA 3AD7C 4C11A 4IR1A 1RA6A 4JI6J 3B6BA 2ZFHA 2OPPB 2Z2YB 4TXSA 1WEXA 2U2FA 3D6FB 4M5LA 1H2TZ 4JV5F 2FJBB 3T9ZA 1Y9OA 2QA1A 4DXLA 2EG1A 1FDNA 2AD9A 4IFVA 3M9OB 2QA4S 3MM6B 2KFNA 3J81j 4LF7J 1T9TA 4OZNA 3KLFB 3H0PA 4OZ0A 2P6TA 1IUJA 3G82A 2N7CA 4QWEA 1RE1B 1FD2A 2J76E 1UJ4A 4MYUA 2W9BA 4JV0A 3KK3B 3IC1A 1PYSB 1SH3A 3SV3A 4O3PA 4FYXB 4FNHA 1WEZA 5E3AA 3DYAA 5KG4A 1M5PC 1F9HA 1U09A 4ES1A 3CE8A 1IBLJ 4YY3F 5H9FK 5GADI 1NZ8A 5LL6d 3QYYA 5DS7A 4DUYJ 3M6WA 3H5UA 2IM0A 1S7IA 4CLZA 4G65A 1T9YA 2ZOFA 4ZKAA 2J0XA 2XM3A 1LNQA 2K3IA 4X65J 3BSNA 4OHZA 3R5AA 4PEOA 2WVBA 2IRUA 1NH8A 2RJZA 4Z7YA 3OJUA 4M5NA 4PZVA 1GXUA 3P45B 2DHAA 4S0MA 3KG4A 3NOCA 4I7FB 4QW8A 4YS2A 2CQGA 2ZD1B 4WP9A 1UZHA 5HVHA 5AJ3J 2W7OA 4B3RF 4WXOA 4M5JA 4AD6A 4Z7CA 1VIXA 4ANCA 1V5IB 2JRSA 1UL3A 3QFWA 4CH1A 2P2CB 1OPIA 4LSLA 3MUTP 5B0CA 4ECYA 2OPSA 3PV8A 5D0EA 1DAXA 2HNYA 3HFVA 3D5MA 1SJQA 3ITHB 1ELOA 2F40A 2B51A 1S1XB 4DG1B 5CD4A 1CJTB 1NSAA 2K7JA 1U6FA 1U8SA 2HRYA 2O66A 4IH6A 1WD6A 2QLWA 4XAKA 2CPJA 1EKRA 2NS1B 2GVDB 1TL7B 2O5DA 1RB0A 5LMNF 4DN9A 3GV8B 2JWNA 2O01C 5BR8F 3G6ES 1U47A 1ZS6A 1P1TA 1VRUB 2M9KA 4F02A 4QW9A 1LFPA 4XDCA 2E5LJ 4DLGA 3SIPB 2BUNA 4R0EA 4KGMA 1S0OA 1OJ4A 2KT2A 1BLUA 2XMVA 5HMWA 2KT5A 3ZTSA 3M8PA 1X0FA 4LREA 1VQNS 3BO3A 3SCIE 3H42A 2MDAA 1SC6A 1S10A 3QMQA 1YBUA 3TYTA 5ETQA 3T3FA 2B8PA 5CYJA 4PKDB 5F8IA 4ANEA 3A1YG 3PRDA 1TP7A 3TR5A 2CA9A 2WVCA 3LWMA 2VOOA 3A8EA 4NEYA 2MZ1A 2HMIA 4GVBA 2DXFA 4E0DA 1RLCL 4OYAA 1X4GA 3OBIA 8ATCB 1E6VB 1APSA 1BWEA 1LEOA 4NZ0A 3SSRA 3A8KA 1VRTB 3ZZOA 3NBPB 5CAAA 1H73A 3W60A 5GAGI 3OVBA 2E1MC 5B7WA 1S79A 2ABYA 3OL9A 2VC0A 3FDSA 3T41A 1SKRA 2ASDA 2RIJA 4W90B 3HK2A 3CCTA 2NXUA 2DJWA 3W7BA 1PILA 2F9JA 5KFZA 3MWBA 4XPEA 4MT1A 3IP0A 2MZJA 2K1RA 3SCJE 2GO9A 4JI5F 1RJJA 4CT8A 5M2RA 3LGHA 5DQIA 4DR3J 2DPIA 2BV3A 1XMQJ 4TYAA 2W8LA 3W3SA 1KD1T 2QLJB 2ZJPQ 2BKPA 1KR4A 2FIUA 1C0UA 1U0SA 4C8KA 2L48A 4O44A 4X64J 4N8OA 4KY3A 4X66J 3DDNA 3FCVA 4JI6F 2B4OA 5HANA 3RJMB 2M0GB 1BXNA 4UOFA 4UY8T 4Y0FA 4NMXA 4EEYA 3NGTA 2Z58B 4UOGA 3IA0A 3VAGA 1B7FA 1DTQA 1QTNB 2QL7B 2RSQA 4UQGA 3HHLA 3FQLA 4LF7F 3D0HE 3VVTA 2A2DA 1NBEB 3FJ2A 1V3SA 4J9KA 3R2DJ 4KSEB 1WG5A 4DOZA 1TKZB 3TOQA 1JJHA 3DRPA 5CCLA 4CNZA 3J7ZT 3FEXB 1RT5A 3ISNC 3GR0A 4CYUA 5MAOA 1O6XA 3T6BA 4JP8A 1W2IA 3AOAA 3NL0A 1FE0A 1R89A 1AA1B 1EAYC 4NXNJ 4RW9A 2OKQA 1IBLF 3R9LA 3GFXA 5DZ6A 2B0GA 2YTCA 2DNGA 4CM0A 4DUYF 2FB0A 1RWUA 4MK7A 2KHCA 1A0OB 5KFQA 4WU2A 1YDLA 2DEIA 5ETRA 3DDIA 3ULHA 5C5JA 1B64A 1KTQA 1EIYB 2G1HA 2K2PA 1WNEA 2CNOB 1JJCB 2IYIA 4OJ3A 4X65F 5GMEA 1VQYA 4Y2MA 2APOA 1FJEB 2QA4G 4JBCA 2KZZA 4HTIA 3HHEA 2ZE2B 3HT0A 2MGZA 1FK9A 2Y0BB 1WHXA 1EQ0A 1TKTA 4EO8A 5U47A 1TVRA 3BS9A 2XS5A 5AJ3F 2ZVSA 4UW2A 1WSRA 4JOUA 2DNYA 3JB9k 2V2QA 3TZZA 4K4UA 3Q8PB 4NYZA 2IM1A 2YH0A 4NA1A 4RNNA 2BKNA 3AQOA 4DBQA 1Q79A 4J5OA 4B3SJ 1QD1A 3L7OA 1CPZA 3SMZA 2FZKB 3TAMA 5J2QA 2KU7A 3EMTA 5E3RA 4NLDA 2VG6B 2R2SA 2Q6BA 3F0NA 2VDHA 1QAXA 4BWMA 1H2UX 2ASLA 1NK9A 3CMQA 1ZA2B 1KFDA 3OTEA 1WELA 2YWGA 3A3OB 5L8RC 2HVEA 4IH7A 2OTJS 4UT4A 1SL1A 3PW2A 3TW0A 2RQKA 2AIRB 3IR7B 2B7CB 2E5LF 4C0BA 2R7SA 1Y5IB 3GMGA 4HI1A 4OHVA 2DGSA 1XERA 3CJ2A 5KFDA 5HMZA 4GKJJ 2ZBRA 1HW8A 2N7YA 1RT2B 2N3LA 2ZWOA 2A10A 4B9VA 3MECB 4QWDA 4P2FA 5GVQA 2HHPA 1RZMA 1B7YB 1S76D 3KUGA 3UWTA 3LP2A 3NGUA 2G13A 2C2RA 1CVJA 3CO0P 4H54A 2DR5A 2FHOB 1S9EB 1RISA 3CJKA 2ZKUA 1U25A 3ENWA 1FTRA 1WG4A 2HFOA 1RBOB 2X3DA 2KG1A 3D4JA 3HFKA 1JIHA 2NQPA 1GXLA 1ZAWA 2VG5A 1Y7PA 2M5YA 4AXIA 2N3OA 1T11A 5KFIA 4Y34A 1U1QA 3TX8A 1FDBA 3VQTA 1U4BA 3MR3A 4OI3A 3BR9A 2ZH3A 6FD1A 3N6MA 2KVIA 3TA0A 3FBEA 4DPUA 3PW7A 1SUQB 3HLUA 2V4QA 3RB4A 1F3FA 3MM8B 3KLVA 3KOAA 1KQKA 1T9XA 1YKWA 2ZKTA 3F56A 2ZOGA 3WC0A 1HBUB 5CZVA 4DR3F 4KYZA 3GFZA 3SBMA 1V9OA 4ELTA 1QLNA 1XMQF 3LGNA 2XSJB 5HP1A 3M8QA 5F8MA 3PHTA 1U1PA 3G86A 1HQ2A 2HHWA 1LW2A 4X64F 3KLHB 2HKEA 2ILYA 2B43A 2UUTA 3MM5A 4X66F 2I8EA 4F50A 2CVIA 4F4KA 3PNIA 5C24B 2SXLA 1T05B 2BJ7A 4U96A 1ZPVA 3M30B 4B9MA 4OHWA 3OXLA 5GAHU 4EYHB 5J1EA 1Q86T 3SQGB 3TARA 1KQFB 2VFSA 3FMWA 4MIBA 4M1KA 1RWNB 3ETMA 1KDNA 1CULA 2YKNA 2XNRA 1X5PA 5ETNA 5M2UA 4IG0B 4KO0A 1YBAA 3M32B 3NXZA 5DGAA 3UVJB 3OLBA 1U1LA 1FRJA 1AUSL 3MI7X 3M6UA 1FFGB 4ES2A 2HZAA 1AB8A 3G8SA 4CLYA 4RPFA 2DTJA 3MUMP 1WKJA 2IC3A 1LK5A 1RAGB 4NXNF 4ECQA 1NK6A 2M4MA 1WWHA 3HSJA 3GTYX 4FXVA 2HBZB 4Y2IA 4BC7A 1MG7A 3HHNB 2RU3A 5ETPA 1M5HA 3SDEA 4HVZA 3I5CA 4C3MA 4FS2A 4QYRA 3CW2C 1I1GA 3AODA 3DU5A 4OI2A 5B0BA 7FDRA 4P74A 2J8AA 4EZ9A 5GAEI 3MPVA 5H9FJ 4NLUA 4ITSA 3OUYA 1XBWA 2J9DA 2FZCB 3HVTA 3SCLE 1WG1A 2E44A 2AJ2A 1JX4A 2W7AA 3DN9A 2OPRA 2C22A 2VA2A 3N5FA 2W4DA 2ZH8A 4QR1A 5HJYA 3IWLA 3A8IA 1ZH5A 2H5EA 5DG8A 4B3SF 3HT3A 1SB6A 1WHVA 2XI3A 6AT1B 3AY0A 1FTCA 4C3LA 1KEKA 1OWXA 2IIHA 1H6KX 1SL0A 2Z8QA 4I56A 4EZ6A 1N32J 2YWKA 4DL6A 5KFSA 5EHHA 2OMOA 3CMAS 5J2MA 1F9EB 4CIOA 1PCAA 4KQZA 1VCTA 2ZZNA 4DZDA 4A8XA 3IAS9 3J7A1 3VAJA 1OS5A 4PQUB 3MR5A 4OV1A 2H48B 4K4YA 1VQPS 3D6HB 4GKJF 1H0HB 1B70B 5SZTA 1UA0A 1IKWA 5C42A 3TWZA 3F41A 5LJ5Y 4ALZA 1RU1A 1YJVA 2RQ4A 2ASYA 4ZPBA 1VQ7S 3NCQA 1Q8BA 4PXBA 3GJTB 4RUBA 2XLKA 2OPPA 5F8HA 3QJPA 3MM9B 4W98A 1ZZNA 4N5SA 1A9NB 4NWBA 1JLAB 2HHTA 1PO6A 3JYTA 3GV5B 5C7PA 2HK3A 2WK4A 3W8PA 3VQSA 5T14A 3MM6A 2BE2B 2AWZA 1E6YB 1RHRB 5KT3A 3B4MA 3HZEA 4UZBA 3KLFA 3RB3A 1RTJB 4NXMJ 2HRTA 2VBWA 2Z56B 4RZRA 2XZDB 3WQPA 3CD5A 5A6WA 4OI6A 1W2BR 3E2EA 4YR0A 3K5OA 3KK3A 1F6TA 1RWPB 4OZLA 2I9SA 4LFBJ 4QR0A 4KT0C 1PAEX 5CXTA 3PACA 3D3CJ 2I38A 2JLEA 1HNIB 2FJVA 1Q53A 4C98A 3TJ8A 3QT5A 3TUIC 2ROGA 1HD0A 1R8BA 2WBMA 2CPFA 3PYFA 5DLGA 4NLQA 1QY7A 1RWXB 4I4BA 1RHUB 1XR5A 4J9PA 4DFMA 5THWA 3PG9A 3QNWB 4DQIA 3ENQA 3W1YC 2X3GA 5F8LA 1FXRA 2A3JA 4I7FA 2XS2A 2ZD1A 4MIWA 1VQ9S 3D67A 4Y2AA 3L9ZA 3CWJA 2ZITA 2VJVA 4CRJA 3BYPA 4USJC 4NL5A 1HNZJ 2IA6A 3HKZD 1TKXB 4J90A 3L7PA 4OQJA 1S49A 4HHJA 2IBOA 2JVRA 3ITHA 3J80Y 3THVA 4Q8EA 4K4WA 3CCMS 1S1XA 4DG1A 1PYTA 1CJTA 3MEEB 1C2PA 5IV4A 1RT1B 1UJ6A 4J9SA 2VBXA 3Q83A 2X1AA 3IS9B 3UE2A 1N36J 2HS4A 1MWZA 3BPSP 4LR8A 2DY1A 2EI5A 3W66A 5E5NA 1KRPA 2B4VA 2GVDA 1TL7A 5FIIA 2E7VA 4PWDB 1LW0B 1CQNA 1VRUA 2PO4A 2CZ9A 1V5VA 3Q8SB 2B6AB 2WVDA 1VISA 4J37A 4YB7A 3CJRA 3DGVA 1R8HA 1TR0A 2CDRB 3EPGA 2CXEA 1WC3A 2VC1A 2MKSA 1RAAB 2BJ3A 5KFLA 2XCPA 3QQCD 3TJ9A 1JLCB 1PSDA 1ROFA 1Q7LB 1KBRA 1KQSR 4FKYA 3R7NB 5D77A 3ZNJ1 2QGFB 3WC2A 1PKUA 4PWUA 1Z1ZA 1DTTB 1WOOA 3VZIA 3JQKA 4PQAA 4P2XA 4UOCA 3NLCA 4PXEA 2DNHA 2YKQA 1JKHB 3B4DA 1E6VA 1M0SA 3DRSB 4I6YA 3PO5A 1VRTA 3NBPA 5HQMA 2H3EB 1DQ9A 1D09B 1O0PA 1N32F 1K9MT 1J5OB 4L6V3 4RNHA 1ZA1B 5B0AA 2MJNA 2FJEB 2PE8A 2KYZA 1FJ7A 2MKYA 3IBWA 1XMBA 1N0UA 2OEMA 4DL2A 3CB4A 1FNOA 1HWKA 3TA2A 4C7QA 3CCRS 2FGOA 2PFDA 2R7OA 1RT7B 1VS3A 4R5PB 3NS7B 1I6JA 4A4JA 4K2JA 3VTIA 2MY7A 1DLOB 4PXDA 2RS2A 4RLEA 1F2HA 5CZXA 4ZVRB 1FO1A 4IFYB 4KGXB 4X62J 3S1TA 4UTGA 3RW7A 1S0MA 4I2QB 3LPEA 3EUNA 2HS0A 1LFWA 4LT6A 4NCAA 5GADU 5KFTA 4ED1A 2BM1A 1JLBB 4KJIA 2GW8A 1M5OC 4ED0A 1D9DA 1RT3B 3X3UA 2WW8A 3HD1A 1T94A 4U8VA 2MQ8A 4PPDA 1QDUB 5I3PA 1VMBA 2DYAA 2LDYA 2AJFE 5F8JA 1LWFA 4ZP8A 4NXMF 1Y11A 2BM0A 1XMOJ 1RABB 3EDRB 1FT8A 1TKZA 4OYIA 1FNXH 4L76A 3IG1A 5LJ3Y 4M8LA 2J7KA 4M5KA 1GXTA 4LR7A 3P4UB 5KG3A 2IPOB 4LFBF 3QWPA 2XLJA 2XNQA 4P72A 4F8RA 5D3GB 1VQ5S 3EM1A 4XPCA 1NH7A 2QZ8A 2VA3A 4ZPDA 3QGIA 3GR1A 2ZBIA 1OYDA 2LQ5A 4OZ5A 3VGTA 1UMJA 1IKXB 1ZM3A 5CA5A 1X4CA 3JTOA
chains in the Genus database with same CATH topology
2IRXA 3NG8A 2RE1A 3BGUA 4WE1A 1K73T 2WONA 3PRBA 2E29A 4OI1A 5DM6Q 1VBXA 1XTZA 3SXLA 3QGPA 1HNVA 1U24A 4H4MB 2OTLS 1BGXT 3KJVA 1ZPWX 2HRUA 1TL3A 2VFTA 5IWAF 1L3VA 4ILLA 2EKYA 2UXDF 3PVXA 5F3ZA 3CO9A 3PKYA 5KG5A 4BDPA 4B9TA 4F4XA 1NU4A 5A8RA 5DG7A 1U49A 2ZE2A 4MIAA 1IKVB 2BANB 4K2XA 3OUYB 4DQPA 4N8NA 4IG3A 2I5JB 5A2QY 4NLPA 2FJXA 4GMKA 3NNCA 2J6UA 3HVTB 4RW7A 3EXCX 1KHVA 4KPYA 2CPXA 2B9XA 1S6PB 2GV1A 4NLVA 3LW5C 4I2PB 3PO4A 3RRKA 4DPOA 5GMKa 1N5SA 1UEVA 2LMIA 2VBYA 4EYIB 3OTBA 4CO5A 4HEA9 3H25A 2Y0SD 2OPRB 2HFZA 5DGBA 1OPZA 4HTJA 4DV5F 1WHYA 4Q5VA 2LA4A 3POTA 2LYVA 3DRYA 3I4HX 1TAQA 1YJNS 1RTHA 2MKHA 3QO9A 4WU3A 1YHQS 3P6YC 4NLTA 4U9RA 4RW8A 1S1UB 5EUHA 5DDQC 3KK2B 2JEFA 4ID8A 2VV5A 3DRXA 4NMLA 5CH7B 3D1QA 1QSSA 4DS4A 3D0GE 5D4NA 4AFFA 2AYGA 3QIPB 1HNZF 1P27B 4WFYA 3H2VE 4Q0BA 5JXSA 4I68A 2D1CA 2XZWA 4FXWA 1HQUB 1JLQB 4I6AA 4BBYA 2LECA 4ED6A 3HDSA 4OLOA 3M2VB 2DCUB 1G2EA 2BVZA 4LSNA 3V6KA 3EGNA 5D8HB 1RTIB 4V19X 4F3MA 2LXFA 3BDEA 4QIEA 1HQEA 2VG6A 1K1SA 3LP1A 4KIAA 2UV8G 5B08A 2QRRA 4KV8B 4LMZA 3UCUP 2DBBA 2EFOA 4KGKA 3FFIB 2Q79A 1D8ZA 3DLGA 4ZOSA 1RT4B 1SQEA 4O4GB 2VZ9A 5J2MB 4Y2CA 3BSAA 2DNQA 2L9DA 4KR0B 3PR5B 3CC2S 1N36F 1QUPA 5KG6A 2BABA 3BN7A 5KG2A 3K57A 1FVQA 3I0RA 2V4JB 3SFUA 3K58A 1SH2A 4FYDA 4DSJA 3CD0A 2KRBA 1DQAA 1NO8A 3GYNA 2ZDOA 3G6XA 3KHRA 4FXDA 1NK0A 1UAWA 2VFRA 2KFYA 4QR2A 3JAMY 3BGFA 2JVOA 1SKWA 2QSFA 1JLEA 3QPIA 1HI8A 4USHA 2V4RA 2IM2A 3UCZP 4FS1A 4QU6A 3HO1A 4U67Q 4ED7A 2DHXA 3X1LB 4YB6A 1KOHA 2RU9A 1HARA 3SV4A 4OMFG 3ZZYA 4CO2A 5DDPC 3OQ2A 1HHSA 2ZHOA 2XEXA 2IVFB 3CDBA 2HGLA 2VD3A 3T1AA 4URGA 5HMXA 3FSYA 2OSQA 3ENVA 4ZHRB 5KFPA 4X4SA 1CEZA 2MPUA 2XS7A 4WK3A 2NSCA 3BJYA 3CCWA 2BXJA 2WAQD 3RZAA 4K0KF 1IKWB 4HT5A 4Q2MA 5C42B 2R8GA 2RVJA 3JTNA 1GX5A 3V81B 4FF3A 4A8OA 5I4MA 3RB6A 1AUDA 1JLGA 1VHFA 3PZPA 1KS2A 1OO0B 5E33A 4F2RA 2EFQA 2MQMA 5GAGU 1LKZA 2GQ2A 1FCAA 1RT2A 2LQ9A 1JXLA 4JI7F 2WHOA 1LWEB 2ZHBA 3UR0A 1N54B 1WF0A 2BW2A 2YNGB 2KXFA 2AYEA 4GO5X 3GG0A 3QIDA 5CYQB 1CQMA 4C11A 3CDUA 3MECA 4IR1A 1RA6A 3M8RA 4ZPWR 3OW2R 2JH3A 4PG7A 3K5NA 2L9WA 2IFXA 2ZFHA 4EWTA 2OPPB 4DLEA 1Q78A 2DNZA 3S7RA 4ELUA 3OV7A 2CYYA 2W9CA 4TNOA 2KN4A 2BA9A 3FGVA 2UUAF 2L41A 3KHLA 1U6BA 4TXSA 1UJ5A 1WEXA 1CC8A 2E5HA 2ZUGA 3VWSA 5DG9A 1GTHA 2U2FA 3NNHA 2W25A 3BQ1A 3OL8A 1H2TZ 4DN0A 4B3OB 3S01A 4KBIA 4JV5F 4MJKA 1OQ6A 2FJBB 2GJIA 3T9ZA 4BS2A 2A2CA 4PG6A 3TVZA 1DQ8A 1Y9OA 2QA1A 1YJ9S 4A8KA 1S9EA 2EG1A 1FDNA 1MU2B 2AD9A 2DO4A 3PIPQ 4YUDA 3DLLQ 4YR3A 4FZVA 4IFVA 3M9OB 2QA4S 3EZUA 2GIRA 3MM6B 2KFNA 4C0HA 2L9NA 2M52A 2CQIA 3BQ2A 4TY9A 2FLLA 4AXJA 4CZCA 3IS9A 3Q2SC 4OZNA 2DNLA 3KLFB 3AQPA 5K8OA 3Q0AA 4OZ0A 1Q8LA 1Y3KA 5A8KB 2P6TA 3S8SA 3MMJA 1V3ZA 1IUJA 1NHUA 2OPQB 2GX8A 2N7CA 1NRKA 4ECZA 1BD6A 1RYRA 1URNA 1LWCA 2MKKA 2D3ZA 3LANA 5KFVA 4QWEA 4ILRA 1FD2A 2R7TA 4USIA 1D3WA 1DBDA 2J76E 3ETOA 4IQMA 2BQ3A 1UJ4A 2JC1A 1X7VA 1Q81T 4OLPA 3QAUA 1SBRA 4MYUA 3KLGB 3HVRA 2W9BA 4NLGA 5KG0A 4DF4A 4JV0A 3OHAA 1SJ1A 3KK3B 4NA2A 3DOLB 4FPRA 3IC1A 2JHEA 2N4CA 1SH3A 3SV3A 1SUQA 2HWHA 3M2RB 4O3PA 4I69A 3OL7A 4NRTA 4FNHA 1WEZA 5E3AA 3DYAA 4ZPCA 4WFBQ 5KG4A 3TAPA 3HP6A 2D3OR 4A8YA 2AJQA 1M5PC 4DX8H 2KG0A 1U09A 4ES1A 2MB0B 3DRRB 3CE8A 3MM8A 2DGUA 4HT7A 4YY3F 3EYZA 1HYSA 4ICLB 3R5CA 5KFKA 3FQKA 5GADI 5LL6d 2KDOA 1KN6A 2LCWA 2VG7A 3QYYA 5DS7A 2XMUA 3VZHA 1T02A 1BC6A 4ZP9A 3M6WA 3T5KA 4B9NA 4Q8FA 3H5UA 1SIWB 1HBUA 2IM0A 3PX6A 1U2FA 2BACA 5HI7A 1UETA 3QGHA 2XMKA 1XN9A 3PXGa 2OIHA 4IRKA 2DGXA 3PW0A 5FDLB 4YQWA 3R1LA 2XSJA 1M5VC 4FVMA 3CF5Q 3CDWA 1QVGR 3MZIA 2ZOFA 4ZA1A 4ZKAA 5AXMA 2J0XA 3KWMA 2K3IA 3BSNA 4OHZA 1ZOTA 3R5AA 1S1VB 1VQMS 2IRUA 4PUOA 1FHTA 3Q8RB 5DQHA 1U7LA 3G9CA 1NH8A 2XMMA 2RJZA 3KLHA 2ADBA 2R4FA 4QPTA 3OJUA 2HS3A 1TL1B 4M5DB 3UD4P 3M9MB 1GXUA 2DHAA 2BZ2A 4MH8A 3UDCA 4CNYA 4ECRA 3O1LA 1RYSA 5I42B 2KXHA 4IYQA 2YWFA 3KG4A 4Q43A 2OO4A 4I7FB 5C24A 3MPWA 4QW8A 1T05A 2X1GA 2CQGA 2ZD1B 2HNDB 4X62F 1IQZA 2ROPA 3M30A 2R7RA 2ZH5A 5DQGA 5L1JA 3VR1A 2W7OA 2OD4A 3M1VB 4C9DA 4B3RF 1IJEB 4WXOA 5KT6A 2E9RX 4JV1A 1S1TB 3SQGA 1S1WB 3OXFA 1S6UA 1VIXA 3I96A 3MMBA 2X51A 4NA3A 1RTDA 2JRSA 2E1AA 3QLHB 5K14A 1UL3A 4CH1A 1OPIA 2KM8C 4LSLA 5F0WA 2ZJRQ 3T6JA 3MUTP 3NAIA 5B0CA 3MMCB 3BO2A 4ECYA 4C3KA 1FKOA 2CPYA 2OPSA 3PV8A 1QE1B 1DAXA 5KFBA 1U1NA 2HNYA 2FHJA 3D5MA 1FKAF 2IMOA 2RF2B 2FC8A 4A46A 2ZH7A 1SJQA 3K8WA 1S9FA 1N8RT 3ITHB 1ELOA 1JWWA 4KKOB 1AFIA 4TN2A 3IAM9 2DITA 2F40A 2B51A 4RUAA 5KFHA 4H4OB 3CMES 1S1XB 4DG1B 2JL9A 2E5IA 4DJBA 2JJ4D 4IG0A 5EWEA 1ZM9A 2R7QA 2K7JA 4C8OA 1N5QA 3OR1B 2DGWA 1U6FA 1U8SA 4QIGA 4TQRA 2HRYA 2O66A 1XMOF 1WTBA 4IH6A 1WD6A 4EFAC 2FC9A 3O8WA 4FF1A 4C8ZA 2P9CA 1N6QB 2GO8A 2PMHA 3DFEA 1Y00A 3US5A 2QLWA 3HHDA 4XAKA 2CPJA 4MK8A 1VGYA 4BHQA 5G0RA 2NS1B