2M4MA

Solution structure of the rrm domain of the hypothetical protein cagl0m09691g from candida glabrata
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
b'MSLGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELSREGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Solution structure of the RRM domain of the hypothetical protein CAGL0M09691g from Candida glabrata
rcsb
source organism Candida glabrata
molecule tags Unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m4mA00
5LSOA 4WIIA 3UCUP 1R8HA 2DNQA 5LJ3Y 2M88A 4PKDB 2WBRA 2RS8A 5H1SV 3DLLQ 2DIVA 1B7FA 5DETA 2XB2D 1M5VC 4WFBQ 1N8RT 2CPIA 1ZZNA 1NO8A 1JJ2R 2U1AA 3K0JA 1FHTA 1U2FA 1X4DA 2DHSA 3TO8A 3Q2SC 1S79A 2CQDA 1D9AA 4TU7A 2N3LA 2CQPA 4CIOA 3V4MA 2J0QD 2KM8B 2DNRA 1YITS 5DM6Q 2GHPA 3VAIA 1SJ4P 2DGUA 2KXHA 5DDQC 2DHGA 3HHNB 2K3KA 2OTLS 1FT8A 2LEBA 4YOEA 5LXRA 2CPHA 3G4SS 4F26A 2CPZA 2MYFA 3TP2A 5DDPC 1VQ6S 3THTA 3H2UB 3US5A 4RU2A 4Y00A 2MSSA 2E5IA 1WEXA 3VALA 3FEXB 4TLQA 2LMIA 4QU7A 3FEYB 4ERDA 2OSRA 2M8HA 2O3DA 3THPA 2MB0B 2M2BA 5IFMA 1VQ4S 1DZ5A 2KXNB 3CD6S 2DGVA 1U1NA 2BOPA 2RUGA 2AYGA 2CQ0A 3CUNA 2L41A 1X0FA 4ZKAA 1UAWA 2RRBA 2ZJQQ 2XNQA 1N88A 3CCVS 2KFYA 1WTBA 2DGOA 1L3KA 2MKHA 1KOHA 1YI2S 2F3JA 2MQLA 1U1LA 4OZ1A 2HGNA 2PEHA 1WELA 2DNPA 2MKSA 2YTCA 1FJCA 1WG5A 2CPFA 2CJKA 2XS7A 3R1HA 2HGLA 2E44A 2KRRA 2CQ1A 1JMTA 1SJRA 2B0GA 4M5DB 2FY1A 3VF0B 3I56S 3P6YC 3MUMP 2XNRA 4FXVA 4WKRA 1HD0A 3EGZA 1FXLA 2MMYA 5GAHU 1O0PA 2AYMA 4IOCQ 1PO6A 1R8PA 3G71S 2YH1A 5LJ5Y 4CH0S 1U1QA 2VOOA 3P49B 2GO9A 2D9PA 3MXHP 3CMAS 2E5JA 2M8DB 1SXLA 2DHXA 5IM0A 2OJ3A 2CQGA 3ZZZA 3U1MA 3P3DA 1HA1A 3I55S 3B4MA 1X4BA 3CCUS 2MY7A 4Y0FA 3HI9A 1A9NB 5DM7Q 2DNLA 3RW7A 4C0OC 1DBDA 2DH9A 1ZZFA 3SXLA 2JX2A 1K73T 2UP1A 1H2TZ 5LXYA 3N9UC 1X5PA 2LA4A 3P5TL 2M7SA 2RT3A 3VAMA 3MURP 4WFAQ 2RRAA 1K8AT 2D9OA 3S6EA 1YWXA 2Q79A 3CCQS 4PRFA 5MLCV 2KT5A 3NS5A 2HVZA 1Q82T 1WF0A 2MKIA 2RQCA 2M0GB 3CF5Q 2AYEA 2FC8A 4WCEQ 2X1FA 5GVQA 4QQBA 2KHCA 3CC7S 3S01A 3UE2A 2LA6A 2DNMA 1WF1A 2RU3A 4Z2XA 1M5PC 4CH1A 5CXTA 3MD1A 2M9KA 4WFNQ 2G4BA 4V19X 1RK8A 3CCJS 3UCGA 2MY8A 4W92B 3NNAA 2AD9A 1VBZA 1H2VZ 2HGMA 2M70A 2DH8A 2E5GA 2MGZA 3B4DA 2JVOA 1SJFA 3BEGB 1JJ4A 1UW4A 3LQVA 4F25A 1VC5A 1U1OA 2EK1A 3CPWR 1YJNS 5IM0B 1X5TA 1YHQS 2D3OR 1BY9A 2CQHA 2NZ4A 2CQBA 1UP1A 3LPYA 3D2WA 3H2VE 4A8XA 3VAHA 1U1RA 2LCWA 3SDEB 1FJ7A 4TU9A 2G1DA 1VBXA 5IQQA 1XN9A 4QU6A 1D8ZA 3VAKA 2X1AA 2KU7A 2K8GA 2N3OA 3MI7X 2ADBA 2DNNA 3MUVP 3BS9A 2F9DA 1H6KX 2LXUA 1KD1T 3L3CA 2JVRA 1KC8T 1VC6A 1VQMS 2DGTA 2J76E 4LIRA 2MXYA 4UQTA 1W2BR 2KYXA 2MQNA 2DO0A 2N82B 4OZ0A 5HO4A 2KG1A 1FO1A 2MQPA 2QEXS 1X4EA 2LKZA 2CPXA 3CULA 1U1KA 2MGZB 2DHAA 1QVFR 2CQ4A 5GAEU 2MKCA 3EX7B 2MSTA 3RW6A 2CPDA 2HZCA 5DDOC 1X4CA 2MPUA 1N54B 1KOOA 2AYBA 3EGNA 4F02A 2MJNA 4C4WA 1Q7YT 2MQOA 2MZQA 4IOAQ 5D78A 2MZRA 1VQ9S 2CPJA 1VQ5S 3CCRS 2DIUA 4TU8A 1AUDA 2DNHA 2CQIA 1OPIA 1P1TA 2VONA 2DO4A 5EN1A 3CCES 2LXIA 2DB1A 1WHXA 3J7YU 2MKJA 2CPEA 1ZH5A 2JRSA 5GADU 2JWNA 3JB9k 3G8SA 3OW2R 1FNXH 4YB1P 1Q81T 2KH9A 3ZZYA 2DNGA 1WEYA 3CC2S 3G6ES 3VAJA 1S72S 2DGWA 1X4FA 4J5OA 2EVZA 2DK2A 2U2FA 2KG0A 4YUDA 2RQ4A 3UWTA 2I38A 3CMES 2X1GA 2EK6A 3CCSS 2OSQA 5CA5A 4CQ1A 5HL7Q 2FPHX 4ED5A 1JJHA 1OWXA 1M90T 1DHMA 3R27A 1YJWS 1DRZA 1WHWA 1H2UX 2J8AA 1VQLS 2X1BA 1U1MA 4W90B 2QA4S 3BO2A 1FJEB 3MDFA 3CCMS 1K9MT 2I2YA 2CQ2A 1WI8A 3SMZA 1VQOS 3G96A 1VQ7S 1M5KC 1RKJA 1URNA 3TYTA 1X5SA 2MQMA 2FHOB 2RNEA 3IRWP 2BZ2A 3NMRA 1UFWA 1WG4A 1WF2A 4LMZA 1WEZA 3Q2TC 2KM8C 1U6BA 2DGSA 1WWHA 3CCLS 4EGLA 3MOJB 3U1LA 3PIPQ 3BO3A 2M4MA 1YTYA 2HYIB 2OTJS 1WHVA 2KRBA 4P6QA 4PR6A 1G2EA 1HD1A 1X4GA 1P27B 3S7RA 3S8SA 2MJUA 4U67Q 3UD3P 1KQSR 2YH0A 3G8TA 1VQPS 1YIJS 2DGXA 1SJ3P 3UCZP 4LJMA 2PE8A 2SXLA 2LECA 5FJ4A 4BS2A 1SJQA 2MKKA 2DISA 3CXCR 2VOPA 1IQTA 2F9JA 2ZJPQ 2YWKA 1CVJA 1PGZA 2XS2A 5GMKa 1U6FA 2NLWA 3CC4S 4C7QA 2CQCA 1NJIT 3PIOQ 1X4HA 4UY8T 1WG1A 3ULHA 2KVIA 3R1LA 1U1PA 1M5OC 2L08A 3UD4P 1YJ9S 1F9FA 2MZ1A 3CTRA 5JVGQ 4WF9Q 1OIAA 1VQKS 5LSLA 5DDRC 1A7GE 1WHYA 2CQ3A 2KN4A 2XSFA 3IWNC 1N52B 1X5OA 2DNKA 2ADCA 3MD3A 5JVHQ 2MQQA 2J0SD 2DNOA 3DXBA 4QPTA 2RS2A 2DNZA 1X4AA 2ZJRQ 3NS6A 2DGQA 3VAGA 2N7CA 3MUTP 2OIHA 4IUFA 2LQ5A 2V94A 1VBYA 1HL6A 5ITHA 2LEAA 2YKAA 4FXWA 2M52A 1VQNS 1VC0A 2RVJA 1M1KT 2DNYA 3VAFA 1NU4A 4IO9Q 3NNHA 2QFJA 2MZJA 2ERRA 2DITA 3NNCA 1OO0B 1WI6A 2E5HA 2L9WA 2XS5A 2KI2A 3G9CA 2MZSA 2MHNA 1QM9A 1QVGR 3BO4A 5CYJA 2VODA 2CPYA 2A3JA 2G0CA 5D77A 5BJRA 1VQ8S 1Q86T 2LYVA 2MZTA 2DH7A 2FC9A 3J7ZT 2KXFA 5GAGU 3SDEA
chains in the Genus database with same CATH superfamily
5KT3A 3UCUP 3MCNA 4PKDB 1ZM4A 1EETB 5ETNA 1RDRA 1NO8A 3RRKA 4KTQA 3TJ8A 4YR0A 3BGRA 4X4TA 1GMWA 3MFIA 4DUYF 2GIQA 2GHPA 5CQGA 2KXHA 3KMSA 2DHGA 2QTWA 5IWAJ 2CPHA 3BREA 1R8CA 4ETZA 1FDBA 3EVWA 1S99A 1WEXA 4X4NA 2R7UA 4XDCA 1BWEA 1YRUA 2P2CB 4CM2A 1TKDA 5DG8A 3FMBA 4DL6A 5HQLA 1A6LA 1X9WA 1PC4A 1Z1ZA 2GO8A 2G2ZA 3EXCX 1OPZA 1QSLA 5AE2A 1OYEA 4LSLA 1XWLA 3I5BA 2PEHA 4N41A 4DUZF 5KFZA 1B0TA 2V8DA 3EM1A 2ZZTA 1JLAA 2N4DA 3WIVA 1DFDA 1YBTA 3OD2A 3TNVA 4A8MP 1PBUA 4PPZA 3OBIA 1FXLA 2MLXA 4RW7B 4FXDA 4DX7A 5DGAA 1N48A 2C2KB 2GO9A 2ZE2A 1WOOA 3CMAS 2NPIA 1U48A 2W2QP 4QZVB 3TAMB 2BJEA 3ZZZA 4KO0A 7FD1A 3QIPB 4OL8A 4ID8A 2DNLA 1ZAWA 4A8FA 1I3OB 3C19A 2QG9B 1GH8A 2PGCA 4NLVA 4JV1A 3IR7B 1KQFB 2LA4A 1UETA 3AXMA 3HSDA 3Q8UA 2UXBF 2AT1B 1CS4B 3IRXB 3EDRB 1WORA 1YG0A 5B0CA 2D3UA 1UTAA 1DJ0A 1XNQF 4B3RF 4ECWA 2AD9A 1LWFB 2R2UA 2CNNB 3BJYA 4L76A 5CYQA 3GP9A 4MTPA 1U09A 3ITHA 4KGXB 3FCWA 4GVLA 3GYGA 2W9AA 4CLSA 4DPTA 5IT9U 1HNVB 3Q83A 1RHUB 4WFYA 3TZZA 2WSCC 3UN2A 3PM9A 4LF5J 4DR1J 3C66A 4A8QA 2LU1A 4JUZA 2HEKA 4U7UK 5SUHA 2GVZA 2XCPA 2PDAA 2HHHF 1HMVB 4OZNA 1UWBA 3L3CA 2EXUA 2VUGA 3B6BA 3DOLB 2MQNA 5HO4A 2A0FB 2RU9A 2ZH5A 4Y2IA 2QEXS 2UU9F 4B9NA 1KONA 1OSDA 4DV7F 1FWKA 2ZM6F 2O1PA 1KOOA 3DM2A 2FJXA 4Q5VA 2QL5B 5AXLA 4URQU 5D78A 2CPJA 2CFXA 2ZWOA 4QR1A 4K4SA 1YGYA 2A6OA 2VONA 4NLUA 1GQEA 2R7OA 1Y11A 1N5YA 3MPYA 1P9YA 3HHLB 3D54A 2B7CB 4CZCA 3NGTA 2AJQA 3GG0A 3OTBA 3AQPA 3ZZYA 1QUVA 2DPIA 2HIYA 2EFNA 4MYTA 3NCRA 4I64A 3NWRA 1S9EA 5J2NB 4TQRA 2F5GA 2K1RA 1TKZB 3OFGA 3VWSA 4O3NA 4DR5J 4DR2F 1KLMA 3G86A 4CQ1A 2IJRA 1K1QA 2FPHX 3R27A 2J8AA 2P5VA 1GXLA 4F3MA 1FDNA 5ETTA 1KQKA 1SKSA 2RQKA 4JI0F 1K9MT 1VQOS 1KWMA 3T41A 1HPZA 6FD1A 2R2SA 3W8GA 4P72A 2Y8YA 4Q0BA 2UV8G 4ZP8A 3CCLS 1V3RA 4DCPB 4UZBA 1R6VA 3ZTSA 1HBNA 2HZVA 1IR0A 3PJ9A 4FYXB 2DISA 2HMIA 4NXNF 4TY9A 2EC2A 2HNYA 4O3RA 2F7VA 4DPWA 3R1LA 2B8QA 3PEJA 1EETA 4B3TF 2PA3A 2WW4A 2YNHB 5EGYA 3TOQA 2H54B 4ZPAA 3NS6A 2XMJA 3VAGA 5D0GA 2DXDA 3C15B 1U6ZA 4IO9Q 4OHVA 3AOCA 4P74A 3BGLA 1NHKL 1I1GA 3T1YJ 1X8DA 4NCGB 2H4WB 2UUWA 1VMBA 2Y1LB 1YVFA 1JXEA 2J6UA 1Q86T 2WVBA 4M5LA 1CULB 2KXFA 3CJSA 4EYHB 1MWYA 5H1SV 1B7FA 2HKEA 5DETA 2NYIA 2DHSA 4OYBA 5CZVA 1D9AA 3CD5A 3TX8A 2J7UA 4OYWA 4NOHA 3SCJE 2DNRA 2VIHA 4HHHA 4ZJLA 1M1GA 4F0KA 2Y1RI 4HACB 2HHWA 4RW7A 3R5BA 1LWEB 1HNWJ 2I8EA 3J7A1 4OZ3A 1VJQA 2LFVA 3DLKB 3JQMA 4NRUA 3TAMA 4DV6J 4TQSA 2FD2A 3EE3A 3I87A 1RKIA 2MDAA 2B9XA 3QIPA 1E6YB 2R2RA 2L41A 2KJVA 3FNNA 3GLJA 2OUGA 1SL2A 4LF9J 2XZTB 2GV1A 4FP9A 5I3PA 4FF4A 3AHPA 3TA2A 3IAS9 4WP9A 1WELA 3I31A 4RUCA 2QLJB 3C8YA 1QSYA 1CS4A 3IRXA 3I56S 3MUMP 3ZZOA 5E33A 5D4PA 1LWFA 4MKYA 3T3FA 1Q95G 1Q78A 4EEYA 3V2UC 1YDLA 3LGNA 1SKRA 4GKJF 4ECQA 2MY7A 1FRIA 1HNVA 3Q8PB 4WU3A 4B3MJ 2ZBPA 1YWXA 2VG7B 2HWHA 1Q82T 2BR0A 3HHLC 4K59A 5D4OA 1HMVA 5HJXA 4H4KC 1EQ0A 2GS8A 3DOLA 3S01A 1Z2ZA 2CXEA 2HBRB 4Z2XA 2VBZA 2D69A 1S1WB 2HGMA 2HHPA 3B4DA 4LUBA 3R5DA 3NCQA 1U1OA 1YJNS 4QIWD 3IAM9 1N5QA 2PMWA 1KS2A 3P5BP 4ED0A 1KEKA 1U1RA 3OVBA 5B0AA 3HHLA 4U9RA 4X65F 1TK5A 2KU7A 4I56A 4LF2A 2YVSA 2B9EA 5F8NA 1FEHA 1VC6A 4ZLJA 5J2NA 5HVHA 5T41A 4K4UA 4LT6A 1RAJA 3VGSA 4JI7J 4QIFA 1ZETA 4YDXA 2IYGA 4JOUA 3KHHA 3BH7B 3OXLA 3BYRA 2XSJB 1BD6A 3OLBA 1BWVA 2E66A 3BBFA 2BW7A 1V3ZA 3DRPB 2ZUAA 3R6LB 1H73A 4JI3J 2NUHA 4AL7A 3GV8B 1S72S 3KLIB 3NAIA 2JC1A 3CD7A 3QIDA 3TUZC 2X1GA 2OSQA 3DGPB 4K50A 3NRBA 4P2XA 4AXIA 1EKSA 4CLZA 4Q2MA 2YNHA 5E41A 3MDFA 1B7YB 1FEEA 2BRLA 4W98A 2BZ2A 3HVWA 3C15A 1S7IA 2JHEA 1EX8A 1XTZA 4KY3A 5J2PB 4DS5A 1KHVA 2M4MA 4NCBA 2V8GA 1SL0A 4FPIA 5CZXA 2CDRB 3UD3P 4ZP7A 2F4FA 2RMLA 1VQPS 3QRPA 1SIZA 2DGXA 4ZVOB 2VOPA 4ILLA 4NCGA 4NYOA 2F9JA 4V1Ak 1NJIT 4OJ1A 1I94F 1RA7A 1F60B 1CULA 4ED6A 3F0NA 3TZYA 2FJDB 1F9FA 1FF2A 5JVGQ 3CB4A 3IM9A 1WKJA 3QWPA 4DR4J 1SV5B 2K7JA 4ZJOA 4LFAF 2XGQA 2AU0A 3A3OB 1N52B 1X5OA 3A1YG 2ZJRQ 2CAJA 5BR8F 1VBYA 5DQGA 2GNKA 4HACA 3RZAA 3DLEB 1LWEA 3UQSA 2MLZA 3A4TA 2DITA 3DLKA 1TUWA 3HZEA 1WDDA 3MR5A 4YR2A 5CYJA 1FXDA 1E6YA 3RBZA 2ABYA 3HCXA 1C1CB 4ZIWA 3CDEA 4KB7A 4J9LA 3E3XA 1SH2A 3C6UB 1C4CA 1NJYA 3TUPA 4CLYA 2YKOA 1SL1A 3V81B 3VAIA 1UVIA 1BMQB 2ILZA 2OTLS 4M5IA 3QGHA 3ENWA 2Z4PA 2RJZA 2MYFA 3TP2A 5HMYA 1JK9B 4ILRA 3UNGC 3US5A 4LF8F 2FB0A 1RTDB 1N5TA 3HO1A 2ZZNA 1UPMB 3M8PB 1GEHA 2KXNB 1QJHA 2C2NA 2FJAB 3PXGa 4A46A 3BBBA 3ZO7A 3J81Y 4PQAA 3TW0A 2G13A 2VG7A 3IC1A 5DG9A 2CJKA 1NDKA 4M5DB 3AD7C 1FX2A 3KHGA 5KFVA 3E8OA 1S1WA 3RR8A 3VTIA 2ZEJA 1EIYB 4IOCQ 2F8EX 5L39A 2P9EA 4ZA1A 4KQZA 3MR7A 3PX0A 1KKHA 4IRKA 1UVMA 1ZA2B 3D6MB 3I55S 2JFDA 1HQUB 3BKTA 3ILOA 1DBDA 2R7RA 2Q66A 2M7SA 2CVIA 3B54A 4ELUA 4ED8A 2KT5A 2HVZA 3R2DJ 1RTHB 2RDIA 3DN9A 2J9DE 4F67A 1U0SA 1S9GB 2PFDA 2K3IA 1TQLA 4URGA 4WFNQ 3WIUA 3UCGA 4QR0A 3QRQA 3IR5B 2WOMB 1RHKB 3CJ5A 3ZTQA 4MIBA 1HNXF 1CJKB 2C22A 2XSJA 1NSKL 3CIMA 1R0BG 2CQHA 2FLLA 2IJNA 1S4FA 1MW7A 3DRPA 4ZHRB 4TYAA 2RDJA 4J9SA 1AFJA 3LWLA 4DV0J 3ZTOA 2X1AA 3OL9A 1S0OA 1A0OB 4O44B 1XQIA 1H6KX 2O67A 3L9ZA 1D3WA 2QX0A 1BQXA 1S6OA 5MAOA 3KLIA 5FLXU 1I51B 2N82B 3GFZA 3GV5B 4MT1A 1ZM2A 2XI3A 4ZVRB 3MM5B 2MGZB 3KXDA 1FD2A 4ZN3A 2BACA 2CQ4A 4NX9A 2I0XA 2IAJB 3IMQJ 4RWXA 1RYSA 3OJSA 3R3TA 5D4NA 1RU2A 2LXIA 3R7NB 3BDPA 2MKJA 3DLGB 4CM0A 1ZH5A 3FCVA 5J2PA 4F2RA 4Q8EA 3DNCA 2VA2A 1G6BA 3FKBA 4Y28C 4KT0C 2DNGA 3N28A 3CC2S 4M5JA 1NPKA 3OTOF 3OL8A 2EVZA 3UWTA 4HI2A 2VHGA 4IG0B 5FIIA 2EK6A 1BLUA 4NXMF 3JS9A 2PMHA 3V6DB 3KWMA 3POTB 2UVVA 1M90T 3TEHB 1JLFB 1SV5A 4G6VB 2QIFA 2CQ2A 3SMZA 1RT2B 5LM7E 3EXYA 1KVIA 2W7AA 3AA8A 1N6QB 1SJ1A 4HKQA 3DMJB 1TL1B 3DLEA 2I9SA 4HHJA 2YX4A 3OTEA 1UA0A 2YXLA 2HQ3A 1FCAA 1OSCA 2AEMA 3PX6A 5ETPA 1HWJA 3NGKA 2XMWA 2KVIA 1C1CA 4CI0B 2KL8A 2YWFA 5E3AA 4FNHA 3NCPA 5BYSA 4GKKJ 3C6UA 2UVRA 1A7GE 3NLCA 2MTLA 2WCXA 3IWNC 1T05B 2J0SD 3V81A 2VL1A 4AL5A 3WQPA 3LWMA 2APOA 3UN5A 2BDPA 1S59A 4M95A 2IPOB 4FXWA 4GC6A 2IDEA 1C0UB 2NYHA 4ILMA 1RTDA 4ITSA 3G6XA 2F4VJ 5A8KB 2R7QA 2HHVA 3FUYA 3GYNA 3BO4A 3M8PA 2GMHA 1KTVA 2G0CA 2E5LJ 4ES2A 1DQ8A 4AFFA 5F0UA 1FKOB 1S6PB 2DH7A 3P4UB 1NH7A 2WBRA 3OUYB 3DLLQ 5B0EA 4JI5F 4B9UA 2PIIA 3OFHA 3OV7A 5C25B 2J0QD 4RNMA 1VLOA 3V5RA 1SJ4P 4QW8A 1FRXA 4M5DA 3UNYA 3H5SA 4ED3A 3H2UB 4F4YA 3D0GE 3MAQA 2IVMA 3MPWA 4P2SA 5KG4A 4LF4J 4WK1A 1HQUA 1J5EJ 1XMQJ 2ASJA 1RADB 2CG4A 1CQNA 2ZOGA 4ER8A 3ICLA 1GAOA 1V5IB 4J9PA 1RTHA 2BM0A 1S9GA 3L95X 1W2IA 1QTNB 1T3OA 3P6YC 5KFSA 4DPUA 2G1HA 1HD0A 5EUHA 1QAJA 2AYMA 2CJXB 2VDIA 2WOMA 4X62F 1U4BA 3M8ZA 1AB8A 2AJFE 4P73A 2CNLB 2PT0A 1FI4A 3U7JA 2M8DB 1MMNA 5DQHA 1CJKA 4OYPA 3FMWA 3Q22A 5JUMA 4MKBA 1FNOA 3B8HA 1LFWA 3KG4A 1R31A 4F7VA 3NG8A 3R6GB 3D0IE 3SV3A 5LMNF 1K73T 2WB1D 4LSNB 4ZHRA 3N9UC 3IN5A 4QWCA 3CCQS 4JYAJ 4O44A 2J0WA 3MPUB 2AYEA 5KFPA 3G82B 4USMA 4CLLA 2W24A 1KFDA 2RU3A 1RK8A 2UUBF 2GQQA 1GK8A 3MM5A 2HFOA 2MGZA 3K2YA 5KFXA 1AFIA 1WKLA 4CT9A 2IAJA 2R3VA 4R0JA 4MMOA 3GJTB 4DLEA 1QAXA 4OYMA 2PO4A 1VK3A 3V6KA 3KJVB 3T1AA 2YKNB 2QA4G 3DLGA 1UVKA 1D8ZA 2PI5A 3HKWA 3M2VB 3T5KA 3G8QA 1RQ0A 2V6AA 4DZ6A 5KFJA 3KHRA 1DQ9A 1W2BR 4B9LA 3PCOB 4IG0A 2BQUA 1TUVA 3O6QA 1YJVA 4CP5A 2LKZA 3V6DA 2QO3A 3POTA 3VGTA 1IR2A 3EX7B 1JLFA 4HR2A 1PAEX 2WSEC 2CJAA 4I6AA 3HD1A 2GQ2A 1RT2A 3PZPA 5CD4A 2E9RX 1RCXB 3BZQA 2ASLA 4CH7A 1N6QA 1SCJB 2VPYB 4EU0A 1Q5YA 2DKOB 3DMJA 2VV5A 4ES1A 5E3CA 1TL1A 4CO4A 5DJBA 4L75A 2GJ2A 2RD5C 1PBAA 1RUSA 4J5OA 5ETKA 5KG5A 3IWLA 4RW9B 2I38A 4ZVPB 1NZAA 5HANA 3CCSS 5EWFA 1U8SA 3PYFA 2V63A 1NK8A 4IO1A 2NXCA 3LOUA 4HH1A 4RUAA 2WHOA 3HT3A 3CO0P 3IBCB 1CC8A 3SYZA 1IVZA 2E7XA 4N56A 1T05A 3I0RB 1X5SA 3ZXWA 2FVRA 3H7HB 3NGUA 3I0SB 5B0DA 4M8LA 1RTZA 3Q2TC 1E6VB 3N01A 2VKZG 4ZVTB 3N6MA 3ADAC 4YR3A 1C0UA 5JJBA 4PR6A 1LW2B 2UXDJ 3M8YA 5A8KA 2RHQB 1IBLF 3MF5A 3PRBA 3NL0A 2QRRA 3PIOQ 2HG4A 1FKOA 5IT9Y 3R97A 1S6PA 3TVKA 1YRXA 4FS2A 1TL4A 3OUYA 3HHDA 2DR6A 2V4RA 1TMJA 2FJBB 1W7WA 5D3GB 2R7TA 4YFUA 3W2VB 4EO6A 3GU0A 1DY3A 4DUTA 5JVHQ 5C25A 4LFCJ 4EFAC 4X84A 3KNGA 1GNKA 2DNZA 1IXKA 2LQ5A 2R8IA 2V94A 4U6PA 1SC1B 2YKMB 2WVCA 4TYBA 2B5JB 4USTA 4LFBJ 5I3QA 2QFJA 3W5XA 2IDLA 1T8EA 2R8KA 4JP8A 1PKUA 2ACMA 4C8YA 1OO0B 1WC3A 2Z57B 3AAWB 2GAHC 4KGMA 2CPYA 2NXEA 2UZAA 4OQJA 4PAAA 3SDEA 2ZDOA 4WIIA 3ILIA 2H5IB 3H0PA 1M5VC 1ZZNA 2JLFA 2W8KA 4MH8A 4FF3A 2R7VA 3LPEA 1N5VA 1RT4B 2OEJA 3CT9A 3FEZA 1RLCL 1U7LA 4RU2A 3TQ1A 4MKVA 2Y3YA 3W1YC 1U26A 4YB6A 2F63A 3K5PA 2H4YB 1VYAA 3I82A 2UXCJ 3F44A 2XC9A 2XYPB 2BQRA 2BJ8A 1VQ4S 5GAGI 1RWNB 2RUGA 2QGFB 2FYXA 2YPYA 3O2IA 4NYPA 3UDEA 4A8YA 3MECB 4ZITA 5T14A 3JAMY 4AQYJ 4LSNA 2VF3A 4FYYB 2MQLA 1GX5A 1RHMB 1V9OA 3K58A 1FWLA 3G82A 2OEKA 3FRYA 4RNHA 2KRRA 5HQMA 2IC3B 4F50A 2BKOA 4PWDB 4OI3A 5IV4A 2VOOA 4GMKA 2D9PA 2XZWA 2OJ3A 1MROB 3QQCD 3CDBA 3KUHA 2G0JA 3KJVA 5DM7Q 2YKNA 3GPAA 2ZKUA 4DUYJ 3OR1B 3O8WA 3ETOA 3JYTB 1H7XA 2NSBA 1C1BB 3K8WA 2QSWA 3M2VA 1CEZA 2RQCA 4Q8FA 3D67A 1ZA1B 3ILLA 2EW9A 2LA6A 2DNMA 2M9KA 4W92B 2LDIA 3RYLA 3QFHA 1EARA 1S5ZA 4F25A 1TL7B 1N0VC 2BEFA 1UCNA 2CQBA 2FGOA 5DZ6A 3LPYA 2E7VA 1WC1A 3HFKA 1NBEB 3D3BJ 4DUZJ 2FHMA 1VJWA 2AIRB 4DX6A 4O3QA 3W7BA 4ZDNA 5IQQA 1DTTB 1T9WA 4ZVFA 4C48A 5KFUA 3EZUA 3MUVP 3ZZTA 1FE4A 4DSEA 5HI7A 2GJIA 3TRGA 3D3CJ 3I32A 2HIQA 1OJ4A 2GFFA 4RW9A 4DDFA 3CCTA 3GV7B 1U1KA 4P2MA 4QR2A 4X4VA 5DDOC 4I6WA 3BBCA 2MQOA 4F4XA 4Q7AA 1TK8A 2E9ZA 1FTRA 1NJWA 4TU8A 3I0RA 1P1TA 4YHHF 3OL7A 2P8IA 3I0SA 3AFGA 1RAAB 1E6VA 3NOGA 4NCAA 3LP0B 1WC5A 1G3OA 4J91A 4XO0A 1Q81T 4B3RJ 1LW2A 3FGVA 4UQGA 4HI1A 2BRKA 2U2FA 3MTKA 3THVA 1FFGB 4P75A 2EBEA 5KOXA 2HRUA 3GIIA 2W4DA 5D3GA 3CCMS 3G96A 5HVGA 4W4MA 1VK8A 2HVHA 4DQPA 4I68A 1F2HA 4EI2A 2HHHJ 2HFZA 5H9FJ 2YKMA 4EGLA 2B5JA 3M9MB 2R8GA 2OTJS 1LV5A 1FVSA 1TFYA 2UU9J 2ZH7A 4DV7J 4DJBA 2BMBA 4QWDA 4RL1A 1U25A 3GILA 5F8LA 3QPIA 1YJ9S 1SI9A 4L3NA 3QLHB 1OIAA 3GTYX 4X64F 1WC4A 5LSLA 1NK0A 2Y0BB 3A8KA 5A8RB 1WHYA 3QT6A 1JQGA 2E1RA 2F1FA 3LAMA 1RT4A 4QPTA 4J9NA 2RS2A 1X4AA 3KKFA 1NZ8A 1JKHB 2JFKA 4RWWA 2W7PA 1RU1A 1NUEA 2DNYA 3PVXA 2YWGA 2MZJA 2VH7A 3Q8YA 1FK9B 3O1LA 3GG1A 4DR2J 4HTIA 1V6HA 3JSMB 3JQJA 1VHIA 2A6MA 3MECA 3OHAA 2IVYA 3GJRB 2E7WA 4USHA 5AE3A 5DGBA 4PYDA 1M5SA 1PJ6A 3T9ZA 2W1BA 5HK4A 3V6JA 4ZLLA 4F0HA 2JNJA 2IC3A 3FC9A 5D6GA 1XERA 3PV8A 3J80U 4F26A 2CPZA 5DDPC 1QSSA 4NXNJ 4WU2A 5E3QA 4Y00A 2P9CA 4PWDA 4PZVA 3C46A 5E2QA 4EMDA 4NEYA 4NLRA 5IWAF 5IFMA 4B3TJ 1MROA 1U1NA 2CQ0A 2XO7A 1MNEA 3MMAB 1HQ2A 4PWWA 1WD6A 3HP6A 4LF1A 2JC0A 1PYSB 3OR1A 1XMBA 3JYTA 3DLBA 1U1LA 1C1BA 3MR6A 5HSPA 5D0EA 2YTCA 1UFKA 3JSRA 2OGUA 2OFGX 3GR0A 1XR5A 2E44A 4OJGA 2CRLA 4C8LA 4EZ9A 4LBHA 2VPZB 4FXVA 2DEIA 1P9QC 2W8LA 1TL7A 1ZAXA 4USUA 3KDOA 4K4TA 2LP4A 3MEEB 1OQ6A 3K5OA 2XY7A 3M32B 1X4BA 3RTVA 2GQCA 1SPBP 4ZK7M 1Q16B 4DLGA 4QWEA 5C2GA 1DTTA 1ZOTA 2Q79A 3PY8A 2A10A 2IM3A 3MEKA 3CVKA 4OI2A 1C2PA 4ZLNA 2OLWA 4K4WA 3H90A 4PEOA 2EWHA 4EO8A 1IR1A 3CC7S 1FDDA 4OV1A 4F3OA 4DPYA 2M70A 2HWIA 2AJ1A 3W65A 4B9TA 3O3LA 2JVOA 3BEGB 1T03B 3FSYA 1N4LA 5K8MA 4URSA 2AF6A 3Q86A 2PMZD 3NY0A 1VRQC 2XLIA 1X5TA 1XR6A 4AUKA 4IQMA 1YHQS 3HVAA 2NZ4A 2VB6A 5LMUF 3I4HX 4AYBD 2JSXA 4BDPA 2G9OA 3FQLA 1S0VA 3TX0A 3LP0A 4LR7A 2JZ5A 2WAQD 4ECSA 2GAGC 5AXKA 2ADBA 3M8WA 1IM6A 5KFNA 4ED7A 1VQMS 2GA7A 4DPOA 2ILYA 2QYGA 2Z0GA 2R9LA 4GKJJ 5A2QY 3OXFA 3HDSA 2CJ9A 3EGNA 2HQCA 3NS7B 3QAUA 3GFXA 2DNHA 4NE9C 2FJVA 1Q8LA 3LTOA 3A8JA 3W61A 2DB1A 3J7YU 1YSJA 2R4FA 2GMLA 4ZVUB 3CJKB 1GTHA 3RRGA 4OYOA 1TKTB 4DR3F 2I5JB 1N34J 3M8RA 4ECRA 3Q24A 1H38A 5E5NA 1RT6B 2WVEA 3LF0A 1FDAA 3LUYA 4K0KJ 3R5GA 3CMES 3IWXA 5CA5A 4BC7A 1MMDA 3FJ2A 1PG5B 3X1LB 1IWAA 3QLHA 3KK2B 1RBLA 1WC6A 1DURA 1WJ9A 5A8RA 4RW8B 1SC3B 4X65J 3T6BA 3BSOA 5IOLA 2HW3A 5HATA 4FYWB 1JKHA 5SZTA 2FUG9 3PIPQ 1FK9A 1SBRA 3HSZA 3PNIA 4UT4A 2LECA 2Y8WA 2VC0A 2DRBA 3FK4A 1X60A 3JSMA 3FBCA 2CQCA 3GQCA 5D0RA 1VRUB 3DU6A 1Q8BA 4CLPA 4XK8C 1OY9A 4B9VA 1HR0F 3EYZA 5K5MA 4FPRA 2BOAA 3CDUA 4E98A 3WC2A 3ISND 1REVB 1HL6A 5ETSA 8AT1B 5KT5A 1OY8A 3D66A 3VAFA 4ZCMA 1NHVA 4ZJQA 3D5MA 3SCIE 2ERRA 2BVZA 1DTQB 2L9WA 2PC6A 4DCOB 2GIRA 3AJ1A 1VQ8S 4C98A 4ED1A 3MMAA 2HQFA 4HVZA 1R8HA 3MAHA 4KFBB 1TTHB 4L73A 1QD1A 4N8NA 5BYQA 4Q2LA 2CPIA 4FS1A 1RHQB 4RO0A 4DQQA 4F4AA 3FZBA 3KLGB 4CNYA 3W9IA 1NDCA 2ALYB 2KM8B 5GAHI 3PKYA 1YITS 3PO5A 3GYXB 2DGUA 2V34A 3LGHA 1FT8A 1O51A 2I6WA 3GFYA 3TVYA 3GZ7A 2OMLA 1UWAA 1I94J 5AT1B 3KUEA 1TP7A 1NPPA 2QFIA 1NPRA 2AWZA 4RKUC 1RE1B 3MEEA 4PUOB 3M32A 3MAAB 4LFAJ 2ZITA 1H0HB 4YQWA 1IUJA 2DGOA 4DG1B 1RAOA 3F56A 4OLOA 2PI4A 1Y3JA 3I5AA 1FJCA 1EP4B 1HKAA 4EBEA 2OPSB 1SJRA 1JXVA 2V50A 2VFTA 3C6TB 1RWUA 1REGX 2VD3A 4NMLA 1T03A 2G0IA 4HEA9 1Q0NA 4O3OA 3KUGA 2AP6A 4OIXA 5H9FK 4ECTA 1JNRB 2IMWP 3ZZPA 3SCKE 3MMJA 3RW7A 5LXYA 3VAMA 1U24A 4Q45A 2FC8A 3GIRA 5H9EJ 4A4JA 4LF8J 3K5NA 1H7WA 3AD9C 3UE2A 4NLXA 3MD1A 1S77D 4V19X 4LR8A 4D3HA 2IRUA 1Y7PA 1T02A 3TARA 4G1PA 2RH3A 4NLDA 2OO4A 4IFYB 2V9WA 3QT5A 4EYIB 4OYIA 3LO3A 2AW0A 2BANB 3DDIA 2DCLA 4J9OA 1HARA 3H2VE 1RWXB 4DU7A 1V5VA 3QRRA 3CJKA 3VHQA 1QUPA 1NNDA 4QU6A 3M6VA 1TKTA 1WSVA 1X0PA 2I5JA 4ECXA 1VRTB 2DNNA 1SQGA 4MK7A 3D1QA 1RT6A 2J76E 1K0TA 2HBZB 3D6HB 3CJ8A 3PW5A 5D8HB 2FZCB 3IGNA 2KT3A 3MFHA 2B51A 2CPXA 2K2PA 1KRPA 1QVFR 5GAEU 3KK2A 2E1PA 4ECZA 4QIGA 4DV5F 2MPUA 2AYBA 4C9DA 4RW8A 2XLJA 4JI7F 3I9ZA 4C3MA 1SKWA 1HWIA 2HLUA 3DOMB 2EC0A 3CCES 4USVA 4HL9A 1IKYB 1WHXA 3AT1B 4UOGA 4IRDA 2XG8A 3HFZB 1NKBA 3QZ8A 3JB9k 2UUCF 2KH9A 3DRYA 3KLVA 4ZVHA 5THWA 4MJKA 1X4FA 2XLKA 3BF4A 1HNXJ 4USJC 3RGIA 4I67A 1Z2LA 3W62A 1YJ7A 1VRUA 2NS1B 1FRHA 3QGIA 1DHMA 4W90B 4I4BA 3BO2A 3MZIA 3L7OA 2J8SA 1WI8A 2J6TA 2Y1JA 3QWUA 2Y1IA 4ICLB 4P52A 3NMRA 2NQPA 1KTQA 1UVJA 2IBKA 1CJTA 1REVA 1WEZA 2XMMA 2KM8C 2LEPA 2DGSA 4KC5A 3KOAA 4USWA 4P6QA 4DR6F 4DF4A 1NKCA 3S7RA 3S8SA 4U67Q 2RB7A 2PEBA 4J7CA 1DTQA 1S1XB 3BGUA 4C8KA 4C3KA 1PC5A 3CO9A 3FBBA 5GMKa 1IJFB 1U6FA 3OHBA 3FQKA 3KG0A 4LRCA 2I1RA 3CTRA 1K0VA 3KLGA 3U1NA 5E3RA 4WBFA 2GHWA 2FGCA 1T9VA 3OTOJ 4DR4F 5ITHA 2WVFA 1S49A 3SSQA 4NXMJ 3PYDA 3LANA 2MZSA 1S0MA 2VODA 2Z2MA 4ZP6A 4PUOA 4DL5A 3MAAA 1U2CA 1L3TA 5LJ3Y 4DG1A 1NK4A 3T5LA 2DIVA 1JLCB 4YB5A 2AX0A 5L1JA 1F6TA 2CQPA 3PHEA 1EP4A 4DL3A 1XEZA 4TY8B 2OPSA 4M5MA 4JI2F 1KR4A 1KBRA 1Q1KA 1RHJB 3C6TA 1T9TA 3I6PA 1FFWB 4IG3B 3VALA 3BSCA 4LQ3A 4LRAA 3SQGB 1ROFA 5EDWA 3CGIA 2O01C 1NJXA 1N5SA 1S10A 2H51B 3CD6S 1CLFA 1L3VA 2ZJQQ 4DFKA 3G6YA 3MCMA 1JLEB 3TUJC 2FJEB 1NAQA 4OZ1A 2HGNA 2OD4A 5IV3A 3M6UA 3CJQA 1MWQA 2B9YA 3PJWA 3VCDA 3PHTA 3C2PA 3FDSA 2HGLA 2FVCA 4YY3F 1JMTA 4ETXA 3CEDA 2QL9B 2Z2LA 2MMYA 2GC8A 4ID5B 1S12A 2BYCA 1U1QA 3BSNA 1PCAA 4MYUA 1DQAA 5IQ6A 2QC3A 4WJBA 4JI5J 4DQRA 2BANA 1WNEA 4IR1A 2AX1A 1N36F 4DV3J 4C0OC 2DH9A 3LP1B 1F1BB 4OJHA 2RT3A 2OPRB 2DR7A 1M0SA 2W9BB 2VJUA 1T0TV 1VRTA 2ZOMA 3OXGA 3BKUA 3KK3B 5GVQA 2HQGA 2XMUA 1D9FA 3QYYA 5KFHA 5F0WA 1FRLA 4DX5A 2WBMA 3JTNA 4KPYA 3MPDA 2DR8A 2WB4A 1LNQA 2AZ3A 2L9NA 3BR9A 1U47A 1VCTA 1BY9A 4N47A 2ZH6A 5KFCA 3OTCA 2BW2A 3DOMA 3QO9B 3OJUA 4A8XA 1IKYA 4CWBA 3CSKA 4X4PA 3H5XA 1ZPWX 3MM9B 2N3OA 3MM6B 4KV8B 2DGTA 4LIRA 3QT8A 4HDHA 4X4SA 2ZOFA 4OZ0A 3D1HA 3HM9A 2FDNA 4RU9A 3A13A 8RUCA 2XBPA 1R0AB 2W25A 1F9HA 1T11A 4KHPF 2QV6A 5LMNJ 4F02A 4C4WA 1Q7YT 3OL6A 2BE7D 2BE9B 1VQ5S 4OYAA 4ICLA 2ZHAA 2XMVA 5EN1A 4BHQA 1UJ4A 5E0OA 4M94A 2D74B 5A6PA 3ZZ0A 2FZKB 1Y0HA 2QZ8A 2YWEA 1WKKA 1B64A 1JIHA 3MEGB 5KFOA 1WEYA 3GFHA 2UUBJ 2CZVC 2GHVC 1S1XA 3BQ1A 2EG2A 3MM7B 2RQ4A 3N5BA 3W5ZA 4G1QB 1HI1A 4KR0B 4ED2A 5L8RC 4PCQA 3O5TB 2CZ4A 5IT4A 1YJWS 2B6AB 2B56A 2X1BA 4NA1A 4KE5A 3TA1A 3H42A 2B3TB 2YNGB 4OX9F 3TEGA 1R43A 4WTOB 4XPCA 1HWUA 2DT9A 2DYAA 3PO4A 2C3PA 1FERA 4RW4B 5ETVA 1YTYA 5IXUA 1WHVA 2M5YA 3R2CJ 2ROEA 5B09A 2YKQA 2VG5B 4EK2A 1UEKA 2HVDA 1TV6B 4CO2A 2YWKA 1PGZA 1HNZF 2NLWA 3CC4S 4C7QA 1X4HA 1QTMA 1HBOB 3W2WB 2CZ9A 5CYMB 5L38A 4ZOSA 4QWAA 4C0BA 1JLCA 5H9EK 4CO3A 4RUBA 2RSQA 1VQKS 4CYUB 1NK5A 2YBVA 4ZPDA 4DX8H 2RUSA 1WOSA 2BV3A 1TFWA 5KFTA 5KFMA 4TY8A 4B3OB 3H59A 2OIHA 4LSZB 4NRTA 5RUBA 4IG3A 2VFSA 3SQGA 4OZLA 2XS5A 2MEWA 3AODA 4J9KA 3GCWP 3IBFB 4DXLA 2V69A 1FFSB 2IJFA 1QLNA 2VFUA 2QLWA 2DNQA 2HHSA 3DI6B 3HSJA 1N8RT 4K5SA 2E1MC 3NGSA 4CIOA 3V4MA 3IXQA 2H5JB 2DHHA 3DC2A 5E7OB 1F5AA 3KJFB 2ZUGA 5DDQC 2K3KA 3DHWC 4YOEA 3G4SS 5AXMA 1GXUA 3J81U 4ID5A 2BBEA 4QWBA 3M8SA 2IY5B 3AXKA 3M9NB 3PDNA 1LQ9A 4CLWA 1N33F 3HPOA 2LLZA 2ATLA 2O3DA 4J9VA 5B0FA 4XPEA 4YB7A 2XNQA 5AJ3F 1VISA 4R0EA 2KFYA 4QYZJ 2A2DA 2ALZA 3DGVA 3LP1A 5J2MB 4Y6IA 3I4PA 2OPRA 4LF4F 2W9BA 2AGOA 4ED4A 5F8MA 2XS7A 3KK3A 2R7WA 3GJQB 1TKZA 2FY1A 4L3KA 1PO6A 1RWVB 5LJ5Y 3FVYA 3RAXA 3H8YA 2PSZA 2CYYA 3GONA 2QSFA 3BN4A 1P8GA 4BC9A 2CQGA 1I6JA 3EPGA 2WVDA 5AXNA 3QO9A 1SQEA 5KG1A 4BWMA 3IS9B 4B3SF 5CABA 2A18A 5C24B 3MURP 3L4BC 1TELA 2GGPB 3S6EA 4DBQA 2RRNA 3MM9A 1SKUB 3LP2B 2HRTA 1PYTA 2M0GB 5KG0A 3CF5Q 4IR9A 3MM6A 4KV8A 3H5UA 3ZC4A 2DVIA 1IM4A 1YJUA 1WF1A 4IOBA 2MY8A 4TXSA 1R0AA 1L5UA 2E5GA 2KB2A 3D7SB 1SJFA 2KT2A 4KGZB 5F3TA 1MLAA 1UZHA 2LXFA 5KG6A 4PABA 4GRSA 1KQGB 1VBKA 4QOTA 2EFVA 3G87A 1G1XA 1OQ3A 1T94A 1VQSA 1V3SA 2HNZB 1D0EA 2COLA 1IBMF 4JI4J 4HTJA 3MEGA 4JI6J 5A6WA 5LOQA 5C7PA 1UA1A 7AT1B 6FDRA 3AH6A 4JV5F 3MM7A 4ZPCA 4G1QA 4BCAA 4ANDA 4AXJA 3CJRA 3IM8A 3OLAA 2ZVIA 2B6AA 2CPDA 4I2QB 2BM1A 3Q8SB 1X7VA 3RBEA 3UDVA 2VQFF 4UOFA 1X9MA 4ZS6A 4ECYA 2MZRA 2YNGA 4N76A 1OPIA 1Q5VA 2OI2A 1OYDA 4M5HA 1NK7A 3NBPB 3IP0A 2QMUB 4RW4A 3OR2B 2DBBA 4PG4A 4Y65A 4RNNA 4DU8A 3C16B 2VG5A 5DQIA 3UI3A 2DK2A 1TV6A 3DFEA 2FVSA 4L72B 4RNOA 4RPFA 4OZ5A 1HBOA 3W2WA 1IQZA 3VGUA 5CYMA 2NXNA 5HL7Q 2OPPB 4DSIA 3GIMA 4IRCA 5L1KA 2PA8D 3HULA 4CYUA 5KT7A 5T7LB 1LWCB 4UUWA 4WP8A 2YWWA 4OHZA 2XHWA 1MU2B 4B3OA 4WXOA 1WF2A 1MSWD 2WK4A 1LFPA 3B82A 2JEFA 3D6TB 4BBYA 1KQSR 1YIJS 3ZFVA 3UCZP 3N0VA 2J5AA 3UPFA 3MR3A 1IQTA 1FRMA 2XWYA 2XS2A 3A3PB 2WW8A 3HD2A 4ANCA 2YX1A 4GO7X 2UXDF 1U1PA 3UD4P 4YHHJ 3DI6A 3D0HE 2Q1LA 1IBKF 1UVLA 1Y5LB 4EUVA 4WK3A 2ZD1B 1S97A 1NHUA 1LK5A 1LK7A 1FJGF 1WC0A 1UFLA 1R7IA 2HFNA 1HI8A 1M1KT 3KNAA 4OMFG 2V5HG 1T9XA 2V2QA 3P8BB 3SBMA 3KYLA 2EPIA 1RP5A 3TI0A 2AGQA 2XMAA 4X4OA 3BGOP 2CADA 1KP6A 2N7YA 4A8SA 5D77A 2E1CA 2BJ1A 1ZTWA 1GT8A 3H25A 1KN6A 5B7WA 3BDEA 2MZTA 2FC9A 1CQMA 4DR7F 5J2MA 2ASYA 3C3LA 4ES3A 1ZAVA 2JDJA 5F8HA 3TO8A 4TN2A 3DRRB 2N3LA 1NMEB 2VJVA 1BGXT 1ZTTA 3AB4B 1GMVA 4UOHA 5M2RA 2DXEA 2XY6A 7FDRA 1RCOB 5HMXA 1JXLA 3THTA 2HBQB 1NB7A 4TLQA 3W9JA 4NMXA 1ITPA 4ZPWR 3FEYB 3A12A 2ROGA 2V68A 1DZ5A 5KFRA 4X64J 4NLSA 2E9TA 5F8IA 4UY85 1W25A 2XO6A 2MKHA 2HK3A 2W2PP 3IS9A 1HBMB 5C24A 2DPJA 2GGPA 1OY6A 4XTTA 3LP2A 3RU0A 4PG6A 2MKSA 5FD1A 1WG5A 1YBUA 4AQYF 4AE5A 3DGPA 1AXQA 1AUSL 4WKRA 1TVRB 1HLWA 3JSBA 2IM0A 2YH1A 5B0BA 3NKYA 5K8NA 1F5BA 4YDDB 3SSSA 1HBNB 1U0HB 4Y34A 2HVIA 5K14B 2NXUA 1A9NB 1FKAF 5CCLA 2W2OP 4JV0A 2HNZA 2JX2A 3P5TL 2NSCA 4ZVGA 5MLCV 3U02A 3GIJA 4WCEQ 3M8QB 2W2MP 1IWGA 4J9RA 1RBAA 2IA0A 4NLWA 3L09A 1NDLA 4IH7A 1Y4ZB 1JJ4A 1UW4A 4K4VA 2GZOA 4I2QA 3ZZRA 4P9SA 1H3DA 2OKQA 5GADI 1SC4B 3VAHA 2HBYB 3NBPA 4DZDA 3NAHA 4TU9A 2BJ7A 2DRDA 3MEDB 3OR2A 2PN6A 3RR7A 4RX6A 4CNZA 4OFZA 4MIWA 3K57A 3C16A 4AL6A 2LXUA 3G2XA 4UQTA 2DD8S 5L46A 2B4OA 2ASDA 4K2XA 2YQ1A 4OX8A 4PXCA 1YZ6A 4DCJB 2EFOA 2OPPA 2BUNA 2DHAA 5F8JA 5EX3A 1MN7A 3QATA 5T7LA 3LALA 3RJMB 1RHRB 2YWHA 1LWCA 4F2SA 4K5RA 2FTRA 1TMMA 4MKAA 4NYZA 1NEEA 1CG2A 3BM7A 1MU2A 1N32J 3PYGA 1RB0A 4O3SA 1JWWA 1RAGB 3M9OB 4HT7A 4CTAB 3G8SA 2V0NA 1U45A 2F8HA 3G6ES 2ZZMA 4QYZK 1NSPA 1ZM9A 3HHLD 3WX4A 1BXNA 3HSGA 2UUTA 2BQ3A 2CWKA 4DFPA 4HHUA 4JV2A 3HF5A 1XMOJ 3PW4A 4X4QA 2EEYA 2ZDPA 2WRMA 5LMUJ 4UTGA 1NJZA 2Z58B 1FJEB 4LF7F 1TL3B 1MG7A 4X66F 2ZD1A 1EB0A 3J7YI 2RNEA 2KJWA 4UW2A 1QDUB 1L3SA 1S6QB 2CA9A 4USKA 3QGGA 4KJIA 3BO3A 5B0GA 1W26A 3BKFA 4LJMA 2R2TA 5FJ4A 2F8MA 3MGJA 1RXOB 4U96A 1YJTA 3BSAA 1WG1A 3ULHA 1H72C 3B78A 4WF9Q 3W9HA 4ZVSB 3R5AA 4V19J 2XSFA 3DRRA 4TLRA 3MD3A 2EFPA 4X2BA 1L3UA 1NSAA 4DR3J 1MMLA 1Z4UA 3EDQB 2LQJA 3TAPA 1FWPA 5HN0A 1NH8A 1CJVB 4DMZA 1AYEA 2HLTA 1FX4A 3NNCA 4DL7A 1WI6A 2ZH4A 3HJFA 1QM9A 4DV1F 1PYOB 1IKVB 3SIPB 3KTQA 1R0CB 3AOAA 4KGKA 2XB2D 4FDFA 1HBMA 1JJ2R 1S48A 1UVNA 3JTPA 1S6UA 3PW2A 2HURA 4J9MA 2KVQE 4NLQA 4OI1A 1TVRA 3AY0A 1M1HA 3W66A 3JAMU 1RWWB 5J1EB 3EMTA 5I4MA 4ERDA 4WTYA 1Y3KA 3Q23A 1U0HA 2OSRA 4OI4A 4LF6F 5K14A 3Q8RB 4OI0A 1U2RA 3M1VB 3BQ0A 2J9CA 1HR0J 4LBPA 2FJWA 4FYDA 2V8PA 3V6HA 2POKA 2HK2A 2XMTA 3A8IA 5HP1B 1T3NA 3M8QA 1BUXA 1HNIB 1J2VA 4TNOA 2CQ1A 4NZ7A 3LAKA 3EGZA 5HVFA 3P96A 2CJYB 1BQNB 1RAEB 4DV4F 4Y2KA 5KT2A 3MXHP 2F65A 5KAKA 4A8KA 1Y5IB 4LBIA 5KG2A 2OHDA 4X4UA 3U1MA 3R7SB 2QT7A 3HI9A 4Y2AA 3IGVA 4XDDA 3MEDA 3H40A 1SIWB 4PRFA 4NLGA 3ENAA 1EZZB 5HLFB 4QYRA 1M5HA 1Y00A 3D68A 3I9V9 3C14B 3NNAA 2UUAF 1CJUB 2FZGB 2IA6A 3EJMA 2B4UA 1D9DA 2L9DA 4NLTA 2VQEF 2ZBQA 4CRJA 2RE1A 2BKNA 3D2WA 2J9EA 2AJ2A 4RBVA 4QIVA 4P2FA 2LCWA 2IRYA 1KSPA 3M7VA 2F40A 4DL0C 3QJLA 4CTAA 2CG8A 4E0DA 3DOKB 2QJ3A 1YZ7A 3SFUA 3GMGA 3BS9A 3VVTA 2JEIA 4DS4A 1XR7A 2GCFA 4QW9A 2DO0A 4DN0A 3T9NA 1FD8A 5IC6B 3IA0A 2BXJA 1ZS6A 2ZBCA 1RYRA 2HZCA 2WZ1A 4RBUA 1H74A 3K17A 1X4CA 3PX4A 2C28A 1RT5B 3Q8VA 2BJ9A 1DARA 1TL3A 3PR5B 3LH2S 1XNRJ 4KKOB 3CCRS 1JLGB 1LOUA 1O6XA 2V2KA 2H1YA 3M2RB 1Y5NB 5DRKA 1S6QA 4NEZA 2X51A 2JRSA 3UVJB 3W64A 1WSRA 1S1VB 3ENQA 1NRKA 3TUIC 4Q44A 3DXSX 4YUDA 3BR8A 1RTJB 4FVCA 2HHXA 1SUQB 4GVBB 5GAEI 3QJPA 4PQUB 4B17A 1N34F 2JOQA 5HROB 4J9QA 2FIUA 1IKWB 1H2UX 3GB0A 1VQLS 3R8YA 1UEVA 2BJ3A 2GVDB 5KFLA 2NPFA 3FSIA 4K0KF 2ZVSA 5KG3A 2B8PA 3K59A 3S1TA 4DL2A 2DJWA 1S7HA 1S4EA 1RISA 1WG4A 4OX6A 3PACA 3PG9A 4C2MA 1WTFA 2YNFB 3EZ5A 2XYGB 1CJVA 4KRWA 2E1AA 2YNIB 2W7OA 4H4KA 3HLUA 1HW9A 4BS2A 1EJ7L 1SJQA 3CXCR 3LGMA 2ZNYA 1IKVA 2W4PA 4DV5J 3EWGA 3TQEA 2C2MB 3HFVA 3QT7A 3VV2B 1ICEB 3T1HF 4RJVA 4C0HA 3VQTA 1KDNA 1AZSB 1IBCB 3MCOA 1NDPA 1HW8A 3KDNA 4HYKA 1P6TA 3ET6B 1VOMA 2HQDA 4LR9A 2UUCJ 4B08A 2RIJA 2QLBB 2XI2A 4IUFA 2AZ1A 1TAUA 1VC0A 2QMWA 3WBZA 2X3DA 1RZMA 3NNHA 4ANEA 3K5MA 5J1EA 1FRKA 3PJXA 3X3UA 3G9CA 4EBDA 2MHNA 1HWLA 9RUBA 1PIEA 1JLBB 3CJ3A 1WACA 1TKXB 3KG1A 4RW6B 4USIA 2HAIA 4ZP9A 3M1VA 2JEGA 3F41A 3AB2B 2VBXA 2HAFA 4FN5A 8ATCB 5E3PA 5F9NA 5HP1A 1Q7LB 4OZJA 5DM6Q 4DR6J 1YRTA 1HNIA 2C2ZB 5L9NA 3PW0A 4ZPBA 5LXRA 1HHSA 2EI5A 3HK2A 4JB8B 3RB6A 3J81j 1BQNA 1G4CA 1HYSB 3UFCX 3DLHA 3Q8QB 1NK6A 2XYHB 2Z8QA 3DDKA 2VU5A 4WPAA 4C8MA 2B9WA 2K7KA 2GIFA 3OVAA 2M2BA 3HXMA 1PSDA 2BOPA 2XZDB 4PXDA 2A1BA 1HHQA 3CCVS 2C3MA 5HMZA 4OYXA 1KHWA 1NB2A 2XCAA 1N0UA 4XAKA 1F3FA 3SEOA 5HLFA 2OH2A 1FXRA 1RI7A 2B0GA 3C14A 3VF0B 5GAHU 4Q43A 1FA0A 2Q6BA 1DAXA 4NI2B 2OMOA 1CJUA 3KLFB 3TJAA 2JH3A 3P3DA 2LQBA 1K1SA 2UXBJ 3NOCA 3N5FA 1O8BA 1F5CA 3SZ2A 3NMAA 2V8HA 1ZZFA 1SH0A 1XNQJ 1HQEB 2HFUA 3L7UA 2ZHBA 4EBCA 1Y10A 4JI2J 3DOKA 3QFWA 4X4RA 3RAQA 4HLBA 1S1TB 1HHTP 1R8BA 3BPDA 3ZZUA 3EGWB 4FKYA 4UOCA 3CIZA 2G4BA 1PILA 2L48A 3CCJS 1NK9A 3BQ2A 1VBZA 3PKMA 1WDTA 5J2QB 4IH6A 1NLKL 2C3UA 3GR1A 2KFNA 3MMCB 4ELTA 3UD5A 3W2VA 1FKPB 1VC5A 4U95A 3UR0A 1RT5A 4E2FB 2DTJA 4KKOA 1JLGA 4EWTA 4OLPA 3M2RA 1TZ0A 2DY9A 3NEKA 2C3YA 1VBXA 3W60A 4YY3J 4ALZA 3UVJA 2V9KA 1S1VA 4H4MB 4M5GA 4IDKB 3KLHB 3EGVA 1RAHB 5A2QU 1KD1T 1QE1B 2MXYA 2ZM6J 1RTJA 1PAUB 2HFVA 2A2CA 3E2EA 2J7WA 2IMOA 1SUQA 4GVBA 3HJVA 2MQPA 1X4EA 4PQUA 4JI1F 4U8YA 5HROA 2QLFB 2MKCA 1IKWA 2GVDA 4YP3A 1N36J 2C3OA 3DKDA 1KVKA 2DIUA 1Q53A 2DO4A 4JI8F 3MMBB 2R8HA 3M6WA 4DV2F 3IR6B 3H4DA 2YNFA 2JWNA 3OW2R 2ZH9A 2EFQA 2YNIA 2WONB 2KG0A 4CO5A 4F04B 4FNIA 1OMSA 2QN6B 4JI0J 4TVAB 3WDOA 4P7TA 5L9XA 3OPKA 3CW2C 5B08A 1DRZA 1H98A 4DSJA 2R42A 2XTJP 1AZSA 1LW0B 1S57A 4LVNP 2Z2ZA 2V8VA 3ET6A 5KFWA 3OFFA 3PFOA 4LMZA 4G1IA 4IFVB 2VZ9A 4RLEA 1P27B 3VGVA 4A48A 5F41A 1B0VA 2YH0A 3G8TA 4A8OA 2RF2B 4KHPJ 4ZCIA 4U7UD 1JLBA 2AQ4A 1TKXA 4UY8T 4RW6A 3LW5C 2L08A 2OPQB 3MM8B 4B9MA 4K7QA 2WTFA 1BHNA 4GC7A 4ZPTR 3KJNB 2XY5A 2ADCA 3RG6A 3V4IB 4QCLA 3DXBA 3QZ7A 4DF8A 4ZMMA 3T5JA 2OFHX 5ETQA 2VBWA 1X31C 3K7RA 1HYSA 3J7AN 2HFSA 2E5HA 2N4CA 4R5PB 2K06A 3ZNUA 4PPDA 2XULA 1FNMA 5BJRA 2HHUA 2LYVA 2FVPA 3DHXA 2E29A 5LSOA 1GFWB 4OX9J 1EQMA 4F4KA 2VBYA 1U2FA 1X4DA 3Q2SC 3TJ9A 4TU7A 1TAQA 4ENOA 1LXJA 2Z2YB 3A3NB 5K9FA 3KJQB 1RBOB 1O5JA 2V67A 2LEBA 1YKWA 2XQCA 1HNZJ 4NI2A 3QSIA 2QMXA 1AROP 1HBUB 2HHTA 4H54A 3KLFA 5IS2A 4DL4A 4A8WA 2OP5A 2Q43A 3THPA 4WYLA 5HBMB 2AYGA 1J5OB 3CJ0A 2JJ4D 3KMQA 3BGFA 4ZKAA 1UAWA 1K44A 1G7CB 5KFIA 1KOHA 2LQ8A 5DS7A 1HQEA 2QLXA 4Z7CA 5A0YB 2F3JA 3R9LA 4YS2A 2DNPA 3H2LA 4HT5A 4C3LA 4O23A 1S1TA 4AD6A 2RQMA 2CPFA 4LF5F 4DR1F 1B70B 3R1HA 4IYQA 3AJDA 2C2RA 1R3NA 3WZ0A 2CWXA 5J2QA 3FRZA 1R8PA 4ZN1A 3P49B 3MMCA 4DQSA 1FKPA 2J6SA 4L74A 2FHKA 3UW1A 2ZHOA 2VASA 3J7Z5 2IHR1 3SXLA 4ZCKA 1X5PA 2GX8A 2Y0SD 1K8AT 5DLFA 5GMDA 4H4MA 3KLHA 4IDKA 2AHOB 5A8WB 3OT9A 1QE1A 2ACYA 3UDCA 2KHCA 4DV3F 4CH1A 1N33J 1N56A 1QAIA 2IM2A 5GMEA 5KOWA 1UPPA 3UO0A 3D4JA 2IYIA 4CLUA 3TWZA 5I3UB 2HHQA 1R89A 5AJ3J 4DR5F 5KT6A 1ACMB 4QJVA 2C2DA 4OHYA 1JX4A 2Q3PA 3SDEB 3MMBA 1NCLA 1FJ7A 4C97A 3AD8C 4DEZA 1CBKA 4M5KA 5EWEA 4PXBA 1UW9A 2K8GA 3MR2A 4LVOP 2VFRA 2JVRA 2WONA 1RLDA 4I6YA 3HMJG 2D7SA 3G6VA 3K5LA 2Z56B 1YQHA 2VDHA 2CJBA 1JJCB 2MSTA 6AT1B 2FQQB 2NR0A 1N54B 2HWTA 1LW0A 3L7PA 4I2PB 4B3SJ 5DG7A 2FHJD 5FLXY 9ATCB 2CQIA 2V2ZA 4P71A 3I5CA 4J37A 1RJJA 5CAAA 5DO2A 4IFVA 3BPSP 2YQ0A 1FNXH 4YB1P 2ZKTA 1JB0C 3VAJA 2DGWA 2RF2A 2DCUB 5L1LA 1RT1B 1XK8A 5K8PA 4ECUA 4FBUA 2AMCB 4WE1B 3RB0A 3JTOA 4I7FB 1LEOA 1HI0P 4TKTA 3TANA 2VFVA 3T1YF 2GMJA 2OELA 4ED5A 1JJHA 4P10A 1WHWA 2OPQA 3MM8A 1U1MA 4KBIA 2H9ZA 1UKUA 1VS3A 4NPOA 2C1EB 2VPWB 5KFDA 1VQ7S 1M5KC 5C2CA 1IBMJ 2W2NP 3V4IA 4BLGA 2HNDB 1JLQB 5J1PA 4PG7A 1U6BA 5D0HA 4JV5J 4J9UE 1LXNA 2MKYA 1X4GA 2J7KA 2KFZA 5CD4H 2PE8A 4R5PA 2MKKA 4FYVB 2H3EB 1TL5A 3NGRA 1HNWF 3R5CA 4UUXA 1KFSA 2VQFJ 3VQSA 2AGPA 4OHXA 5C5JA 5BR8J 3RB3A 4DV6F 1HIYA 5DDRC 2KN4A 5M2PA 4LF9F 5HQ8A 4M63A 2GW8A 1RACB 1RT7B 5F3ZA 2DNOA 2YQ3A 1R8AA 3QSYB 3K89A 1Q8IA 4ZLPA 3AA9A 4DFJA 4U7CA 2LEAA 2V4JB 2RILA 2M52A 2RVJA 1NU4A 4DPXA 2IRXA 2V2VA 1AT1B 1HBUA 2CDQA 3O44A 2NREA 3BH6B 1Y9OA 2KI2A 3F73A 2BE2B 1QVGR 3RBDA 1UEUA 5HBMA 2BX6A 5KFGA 1J5OA 1XIQA 2KKHA 4F36A 1CPZA 2AKWB 2D3ZA 2MQQA 3UR3C 2M88A 4CCHA 2CVEA 3M6XA 4FZVA 2ZH1A 1QAYA 4WFBQ 3PTWA 5A0YA 2W9CB 2H65B 2IBOA 2OD6A 1S79A 3HT0A 3P45B 1R6YA 1IKXB 1RAFB 4B3MF 5CHCB 4PXEA 2NCKL 1YK9A 3HHKA 3HHNB 2D3O1 1VQ6S 4FKXA 1GTEA 5ETOA 4PWUA 3TVZA 2VKRA 5D4LA 2M8HA 2QYCA 3VZIA 2DGVA 3H98A 2J0XA 3Q89A 1IBKJ 3CUNA 3MHYA 1WTBA 3H4BA 4I0WA 1VFJA 3WC0A 1XC9A 4K4XA 1YI2S 1FJGJ 1APSA 4OX7A 2W01A 4KH1B 3ZNJ1 4CLTA 3GSDA 3M05A 5A8WA 3FBEA 4Y3CA 3KHLA 1RWMB 5BXIA 2ZBRA 4H4OB 2R8JA 2XNRA 3MWBA 1FESA 4CH0S 2YKPA 5I3UA 2E5JA 1Q79A 2ZC3A 1SXLA 2AJ4A 4DR7J 3WX8A 2NXJA 3WHIA 3CCUS 3GE9A 2HS3A 2RHSB 4UZCA 3N79A 2VA3A 1VI7A 1C0TB 1H2TZ 2VC1A 2KTQA 3EUNA 1BE4A 4O0IA 2D9OA 3NS5A 1RAIB 1NSQA 2FLNA 1ZPVA 4E8UA 2IIHA 4CO0A 1T95A 3T19A 2X1FA 1ELOA 4QQBA 4JI3F 5KFAA 2HS0A 2NZCA 3DYAB 1H2VZ 2AEFA 3ILJA 5C42B 1RGVA 2KHDA 1F9EB 1FVQA 5KFYA 2LVWA 1XJWB 4UF4A 2G2OA 2KO1A 4I2PA 1X9SA 4NLOA 1GX6A 3AQOA 4QBUA 3CE8A 3NWGA 3GJSB 1XN9A 1AW0A 3CJ4A 5DZ7A 2CIMA 4F4ZA 2JL9A 5BYRA 3QAEA 3M4XA 5IT0A 2HVEA 4DFMA 2KYXA 2ZH8A 1RT1A 3MTJA 4WE1A 3PR4A 1FO1A 3PRVA 3FZ2A 4I7FA 4JI4F 4KFBA 1RT3B 4JI6F 2MLYA 3FSXA 4F3QA 2ZH2A 4WWSA 2MJNA 5U47A 2AJ0A 4DSFA 1ZYQA 2O5DA 2HNDA 4XIUA 3ISNC 4C11B 1B0PA 1JLQA 4OYZA 3R7BB 4NWBA 5ETMA 1F0XA 1ZM3A 5EX0A 2OEMA 2VICA 4ZVQB 4ZPVR 2CNKB 4DI6A 5AE1A 4KSEB 2YPZA 4MFBB 3M2UB 2EFGA 1DLOB 1I5OB 4NA3A 2VG6B 2BKPA 1XBWA 4OZ2A 2W4CA 2ZWPA 1WUUA 2FHJA 1U49A 4CDIA 2ZH3A 1RT7A 3W63A 5LT5A 3EVMA 1UFWA 4LRBA 4D3GA 3DRXA 2V4JA 2RAQA 1JNZB 3MOJB 3U1LA 1LKZA 5KFFA 4LQ9A 2HYIB 1FE0A 3VVUA 5L1IA 2EBGA 2BABA 2SXLA 2BE2A 2XM3A 2ZJPQ 4A47A 2B7BB 2CUYA 4K4ZA 4PG5A 1S9FA 1RABB 2MZ1A 3AOBA 2W9CA 1RA6A 3OTDA 2PD1A 3E01B 1IKXA 3GWCA 2JEJA 1S1UB 1S76D 3ENVA 2N7CA 1EAYC 3FCHA 2YKAA 1D8YA 2WSFC 4IFYA 2DR5A 4Z7YA 5HJYA 2ROPA 1VLYA 4WZQA 2RKIB 5KFKA 3SFGA 4O4RA 4LF7J 2FLOA 3KK1B 4X66J 2LU2A 1SH3A 1YLXA 2RS8A 3BB5A 2HS4A 1EHWA 1FHTA 3K0JA 3OSPA 2QE5A 4DOZA 1ULRA 2XWXA 4WFXA 4PG8A 4H4OA 4C8OA 4FF1A 1F3VA 5JMNA 2MSSA 3FEXB 5ETRA 1SQFA 4QU7A 1VDHA 3QMQA 5HAOA 2MB0B 2B43A 1TUGB 4ECVA 1X0FA 2RRBA 4KHRA 1CC7A 4NASA 3D6FB 3SCLE 1N88A 3RB4A 1L3KA 4NA2A 3FBFA 1C0TA 4B02A 5HMWA 4C6AA 2IM1A 3VR1A 4X62J 3RRHA 4DV0F 1AA1B 1B3TA 3CDWA 3DYAA 3HVTB 4HH0A 4DV1J 1LWXA 4WKYA 5C42A 5EHHA 4L6V3 5F8GA 3D9BA 3UN3A 1RSCA 4MAKA 2DHXA 3N6LA 4KGVB 1HA1A 3B4MA 2XEXA 4ELVA 3UDLA 4ATNA 4Y0FA 5J1NA 4DQIA 5JXSA 5K20B 4M5NA 5KFEA 4R25A 4OV6A 3ISZA 5LL6d 1VIXA 3T6JA 4WFAQ 4K8RA 1WF0A 4KYZA 3FFIB 2DEJA 2P6SA 3DU5A 4OI6A 2V4QA 5KT4A 1KNZA 1M5PC 3D28A 5CXTA 4J90A 4LF6J 1RT3A 3TZWA 1U02A 2B4VA 2XMKA 4ZVEA 3LQVA 4N7TA 2MQ8A 1NXIA 3HKZD 3LA0A 1BC6A 4HDGA 2O66A 3CMQA 5IM0B 2D3OR 2KZZA 4CO1A 1NKEA 2ZNZA 4C11A 2FY8A 3ONQA 4NL5A 5IZHA 2G1DA 4N5SA 5FDLB 3VAKA 1T9YA 3I96A 2AV5A 5EWGA 1TK0A 1B4SA 2F9DA 3HZGA 4ZCLA 2C2EA 2X3GA 4DV4J 4FF2A 4Y2MA 4MFBA 3M2UA 4KAIA 3IBWA 4WYWA 1DLOA 1PJ7A 3KFWX 3CULA 2VG6A 2X7IA 4WP3A 5ETLA 4F4WA 3RW6A 1URRA 4IOAQ 1VQ9S 4DN9A 1J27A 3SI8A 3PYEA 4GKKF 2L3MA 3N6NA 2CPEA 1YBAA 5GADU 4B9SA 4O4GB 1Q4RA 4CLFA 2UUAJ 3MOZA 1N32F 1BQMB 3TZXA 4RUHA 5G0RB 2EKYA 4IH5A 3ELHA 1WOPA 2F4VF 1JLEA 1KLNA 4RNFA 1OWXA 1UJ5A 3D1OA 2VQEJ 4DSKA 2E5LF 1RTIB 3QGPA 3E01A 3ZTRA 1URNA 4LIWA 3TYTA 3IG1B 2MQMA 2FHOB 4NZ6A 1S1UA 1XMOF 4O0NA 4FVMA 1IBLJ 2FVQA 4BWJA 3TAQA 1TU0B 1HFEL 2KRBA 4WXWA 3W5YA 1QY7A 2MJUA 1CSJA 4K4YA 1SJ3P 2RKIA 1CVJA 4RBTA 4FBTA 2KYZA 3N4WA 5D15A 1YX2A 3KK1A 2QA1A 1M5OC 2OAUA 3VZHA 2JLEA 3DRSB 1Q8KA 2NUUG 1J5EF 3H5YA 1XMQF 2DY1A 2EKNA 4WZMA 2DNKA 4GO5X 5I42B 3GCXP 3H20A 5KFQA 2DGQA 1GMWD 3MUTP 4R8UB 2P6TA 4CLKA 2LDYA 3W3SA 4I1TA 1VQNS 3R5JB 2H48B 5CH7B 3GSIA 3CD0A 5M2UA 2BA9A 3M30B 3JQKA 4EZ6A 1OS5A 2A3JA 3PW7A 3OFEA 3IO1A 5KFBA 3J7ZT 3KLEB 2CKWA 3RAMA 3CDAA 2U1AA 1MN9A 2CQDA 3EZOA 1B99A 3A8EA 3ETMA 4WIQA 3BYPA 5IC4B 3BN7A 3CNQP 1UL3A 3Q0AA 2G2YA 5F9LA 2R7XA 4OJ3A 2CJQA 3HVTA 1F2GA 3NGDA 4JYAF 3OVSA 2E5IA 2B4PA 3SQOP 2LMIA 1YJRA 2QL7B 2LQ9A 3T1HJ 1IN0A 5CCMA 1HWKA 3J80Y 1PJ5A 2KDOA 3CJ2A 4K2JA 2GJFA 4KH0B 3QJJA 1GXTA 3CWJA 3W8PA 3BGRB 3K8VA 5DLGA 4NZ0A 3FFIA 4KPCA 1S0NA 4C8ZA 2Q6CA 1FRJA 2HSEB 3E51A 1CJTB 1O0PA 4Y2CA 3G71S 1KVJA 2UVUA 2PFFB 2YY3A 1UJ6A 4Z37A 1D09B 4RZRA 4N77A 5IM0A 4C8NA 4AT1B 3OQ2A 1SVDA 4G3IA 3DLJA 1C4AA 3BV8A 3OSNA 4I69A 2UP1A 2D1CA 4LSLB 4LREA 4DHVA 2RRAA 1NM2A 2YX7A 5FDLA 2MHEA 2MKIA 4OHWA 2DRAA 2JLGA 2ZC4A 1JLAB 2BJDA 4P7VA 2C42A 1ZBTA 1RWOB 4F0MA 3EVOA 2DH8A 3EICA 2H5EA 2IVFB 2ZE2B 1UMJA 2IFXA 2EK1A 4ZIVA 3QBCA 4WFZA 3CPWR 3NXZA 4KO0B 5ADZA 2FLPA 1UP1A 4NLYA 5G4DA 4KHMA 4LRDA 3QNWB 3JSYA 4NLPA 3TR5A 4CT8A 3HVRA 4O4GA 3MI7X 2J9DA 4O3PA 1KC8T 5KTQA 1BQMA 3PFEA 1EKRA 5G0RA 4JBCA 1TR0A 2KG1A 4MIAA 2VPXB 1GMUA 1FTCA 5CYQB 2QA2A 1VQYA 2RDDA 3ITHB 1RTIA 3U27A 2D41A 1SB6A 2MZQA 3CCZA 3GIKA 4QIEA 1AUDA 3IG1A 3CCWA 3RUBL 1K47A 2UV8A 4MK9A 1VR6A 2AEJA 1SC6A 5LSRA 3DDNA 4S0MA 1RWKB 4LFCF 3PEHA 1XNRF 4U8VA 1T7PA 2GVZB 2HQIA 4KIAA 2DR9A 1RWPB 2R7SA 1VGYA 1UWBB 1P1LA 2XHCA 4LFBF 4IKAA 3NP5A 4M1KA 1D1UA 1MWZA 2ZBIA 2CNOB 1VIOA 2ATCB 3DCAA 3DRSA 3SV4A 2QA4S 3DM2B 2I2YA 5A76A 3IFEA 2ZFHA 3AJ2A 1RKJA 1R27B 2C2OB 5I42A 3IRWP 5K8OA 1N5YB 4R8UA 3EPIA 1WWHA 3TA0A 1HD1A 1G2EA 4N8OA 1IJEB 3M30A 4G65A 2P9GA 4JI1J 1VHFA 4QPXA 1S9EB 3PRDA 1UZDA 2HZAA 2EG1A 2K1RB 1KLMB 4DSLA 3KLEA 3ZTPA 2UXCF 3RBXA 4MK8A 3HHEA 3SSRA 2HPUA 4JI8J 4F8RA 4DWIA 2CQ3A 4YMEA 4DV2J 4YEAA 2XGPA 2HRYA 1U8WA 1HPZB 3MCSA 3CJTA 4PYAA 4Q0BB 3MPVA 2Y9HA 2KZMA 2M3DA 1T9UA 3HX9A 3JXOA 5KG7A 4IQXA 2HMIB 4YN3B 4RR5A 2HNYB 3T5HA 2UVWA 2DXFA 4LRFA 5GAGU 2Z30B
chains in the Genus database with same CATH topology
5LSOA 5KT3A 2VFUA 2ZDOA 4WIIA 3UCUP 2QLWA 2DNQA 4PKDB 1ZM4A 1EETB 2HHSA 3DI6B 1M5VC 1N8RT 1RDRA 4F4KA 2VBYA 1ZZNA 1NO8A 2JLFA 4K5SA 1U2FA 2W8KA 1X4DA 3RRKA 2E1MC 4MH8A 4KTQA 3Q2SC 4YR0A 3BGRA 4TU7A 4X4TA 3MFIA 4FF3A 1TAQA 4CIOA 3V4MA 2R7VA 3IXQA 1N5VA 1RT4B 4DUYF 2GIQA 2GHPA 1LXJA 3DC2A 5E7OB 1F5AA 5K9FA 5CQGA 2KXHA 3KMSA 5DDQC 2DHGA 2ZUGA 2K3KA 1O5JA 2LEBA 3DHWC 4YOEA 3CT9A 3FEZA 2CPHA 3G4SS 3BREA 1R8CA 5AXMA 4ETZA 1FDBA 1U7LA 1GXUA 4RU2A 4ID5A 2BBEA 1S99A 4QWBA 3M8SA 3TQ1A 1WEXA 2QMXA 1AROP 1U26A 4YB6A 4X4NA 1HBUB 3PDNA 3M9NB 2HHTA 3K5PA 4H54A 2E9ZA 2R7UA 3KLFA 4XDCA 5IS2A 1BWEA 1LQ9A 3I82A 4DL4A 1N33F 1YRUA 4A8WA 2OP5A 3F44A 2Q43A 2XC9A 3HPOA 2BQRA 2LLZA 2ATLA 2O3DA 3THPA 1TKDA 1VQ4S 4WYLA 5DG8A 5GAGI 3FMBA 5HBMB 4DL6A 2RUGA 2AYGA 1A6LA 1X9WA 1J5OB 3CJ0A 5B0FA 1PC4A 1Z1ZA 2GO8A 2JJ4D 3KMQA 3O2IA 3BGFA 1OPZA 3EXCX 4NYPA 1UAWA 4YB7A 4ZKAA 4XPEA 1QSLA 2XNQA 3MECB 4A8YA 5AJ3F 4R0EA 2KFYA 4QYZJ 2A2DA 5AE2A 1G7CB 5KFIA 3JAMY 5T14A 4LSLA 4LSNA 3LP1A 2ALZA 1KOHA 5J2MB 1XWLA 5DS7A 4Y6IA 1HQEA 2QLXA 5A0YB 2F3JA 2MQLA 3I4PA 3I5BA 2OPRA 4LF4F 1GX5A 2PEHA 2W9BA 1V9OA 2DNPA 4N41A 2AGOA 3H2LA 4DUZF 3K58A 4HT5A 5KFZA 4C3LA 4O23A 1B0TA 1S1TA 2V8DA 5F8MA 3FRYA 2RQMA 4RNHA 2CPFA 4LF5F 2XS7A 3KK3A 4DR1F 3R1HA 4IYQA 1JLAA 2N4DA 2R7WA 1DFDA 2KRRA 1TKZA 2FY1A 2C2RA 2IC3B 3TNVA 4A8MP 4PPZA 1R3NA 3OBIA 4F50A 1FXLA 3WZ0A 4RW7B 4FXDA 5DGAA 5J2QA 3FRZA 1PO6A 1R8PA 4PWDB 1N48A 4OI3A 5LJ5Y 3FVYA 2VOOA 3RAXA 3P49B 3H8YA 3MMCA 4GMKA 2GO9A 2D9PA 2ZE2A 4DQSA 2PSZA 1FKPA 3CMAS 2NPIA 2XZWA 2J6SA 1U48A 2CYYA 2FHKA 4QZVB 2QSFA 3TAMB 3BN4A 1P8GA 4BC9A 2CQGA 1I6JA 2OJ3A 1MROB 2BJEA 3ZZZA 4KO0A 7FD1A 3EPGA 3QIPB 3UW1A 4OL8A 2ZHOA 5AXNA 3CDBA 2VASA 3QO9A 4ID8A 1SQEA 3J7Z5 3KJVA 5DM7Q 2YKNA 2DNLA 1ZAWA 4A8FA 2ZKUA 5KG1A 4BWMA 1GH8A 2PGCA 4NLVA 2IHR1 3SXLA 3OR1B 3IS9B 4ZCKA 4JV1A 3IR7B 4B3SF 3O8WA 3ETOA 2A18A 1X5PA 1KQFB 2LA4A 3JYTB 1UETA 5C24B 1H7XA 2GX8A 2NSBA 2Y0SD 3MURP 1K8AT 1C1BB 2GGPB 3K8WA 3S6EA 2RRNA 4DBQA 3MM9A 3LP2B 2QSWA 3M2VA 5DLFA 4H4MA 3KLHA 4IDKA 1CEZA 5A8WB 2RQCA 2M0GB 4Q8FA 5KG0A 3CF5Q 2UXBF 4IR9A 3MM6A 1QE1A 2EW9A 3IRXB 2ACYA 3H5UA 4KV8A 3ZC4A 3UDCA 2DVIA 2KHCA 4DV3F 1YG0A 5B0CA 2D3UA 1IM4A 1YJUA 2LA6A 2DNMA 1WF1A 1DJ0A 1XNQF 4CH1A 4B3RF 2M9KA 4IOBA 4ECWA 1N56A 2MY8A 4W92B 2AD9A 1QAIA 2IM2A 4TXSA 1LWFB 2R2UA 2LDIA 3RYLA 3BJYA 1R0AA 5CYQA 1L5UA 2E5GA 5KOWA 2KB2A 4MTPA 1U09A 2IYIA 1SJFA 5I3UB 2HHQA 1R89A 2KT2A 4F25A 3ITHA 5F3TA 1N0VC 4DR5F 5KT6A 2LXFA 5KG6A 2W9AA 1KQGB 2CQBA 2FGOA 4QJVA 3LPYA 3HFKA 4QOTA 2EFVA 2C2DA 1G1XA 2FHMA 1HNVB 1OQ3A 1T94A 1VQSA 4WFYA 1JX4A 4OHYA 2Q3PA 3SDEB 1V3SA 1VJWA 2HNZB 2WSCC 3MMBA 1D0EA 1FJ7A 2COLA 3PM9A 4O3QA 3W7BA 4ZDNA 3C66A 4C97A 5IQQA 4DEZA 4A8QA 1DTTB 2LU1A 1IBMF 4JUZA 4ZVFA 4U7UK 5EWEA 4HTJA 4PXBA 5SUHA 2K8GA 2XCPA 3MEGA 2PDAA 5A6WA 5KFUA 2HHHF 3EZUA 3MR2A 1UA1A 1HMVB 4LVOP 1FE4A 3ZZTA 3MUVP 5HI7A 2VFRA 4DSEA 4OZNA 2GJIA 1UWBA 3TRGA 3L3CA 2JVRA 2WONA 2VUGA 6FDRA 3AH6A 4JV5F 3MM7A 3I32A 3DOLB 4I6YA 2HIQA 4ZPCA 2MQNA 3HMJG 2D7SA 4G1QA 4BCAA 2GFFA 4RW9A 5HO4A 2RU9A 2ZH5A 4Y2IA 3G6VA 2QEXS 2UU9F 3K5LA 4DDFA 4B9NA 3CCTA 3GV7B 1U1KA 1KONA 1OSDA 1YQHA 4AXJA 4QR2A 4X4VA 2CJBA 3OLAA 2B6AA 4DV7F 2MSTA 2CPDA 5DDOC 4I2QB 2BM1A 3Q8SB 4I6WA 2O1PA 2ZM6F 1X7VA 2NR0A 1N54B 1KOOA 3DM2A 2HWTA 1LW0A 3RBEA 3L7PA 2FJXA 4Q5VA 2VQFF 4I2PB 2MQOA 5DG7A 1X9MA 4F4XA 4Q7AA 5AXLA 4URQU 5D78A 2MZRA 4ZS6A 4ECYA 2CPJA 2YNGA 1TK8A 1FTRA 2CFXA 4QR1A 2FHJD 5FLXY 4TU8A 3I0RA 1YGYA 1NJWA 4N76A 2CQIA 1OPIA 1P1TA 4YHHF 3OL7A 2VONA 4NLUA 3I0SA 1NK7A 1GQEA 2R7OA 3I5CA 4J37A 1N5YA 1RJJA 3NBPB 1E6VA 3MPYA 4NCAA 3LP0B 3HHLB 3D54A 5DO2A 2B7CB 4IFVA 4RW4A 3OR2B 2DBBA 4PG4A 4CZCA 2AJQA 1G3OA 3GG0A 4Y65A 4XO0A 4RNNA 1FNXH 4YB1P 3OTBA 2ZKTA 1Q81T 3AQPA 1LW2A 1QUVA 3ZZYA 2DPIA 3FGVA 1JB0C 2EFNA 4MYTA 3VAJA 3NCRA 2DGWA 2VG5A 4I64A 4UQGA 4HI1A 5DQIA 3UI3A 2DK2A 1TV6A 2BRKA 1S9EA 2RF2A 2U2FA 5J2NB 4TQRA 3DFEA 2DCUB 2FVSA 5L1LA 1RT1B 1XK8A 5K8PA 4L72B 4RNOA 2K1RA 4ECUA 4FBUA 1TKZB 3OFGA 4WE1B 4OZ5A 3JTOA 1HBOA 4O3NA 3VWSA 3RB0A 4I7FB 4DR2F 1KLMA 3W2WA 3G86A 3MTKA 1IQZA 4TKTA 5CYMA 4CQ1A 1HI0P 5HL7Q 3TANA 2OPPB 4DSIA 2VFVA 3T1YF 1K1QA 2FPHX 2GMJA 3THVA 4ED5A 1JJHA 3R27A 1WHWA 3GIMA 2OPQA 2J8AA 2P5VA 3MM8A 5L1KA 4IRCA 2PA8D 1GXLA 2EBEA 4F3MA 1U1MA 4KBIA 5KOXA 1FDNA 2H9ZA 2HRUA 3GIIA 1KQKA 1SKSA 2RQKA 2W4DA 1UKUA 5KT7A 5T7LB 4JI0F 1VS3A 5D3GA 3CCMS 1K9MT 1LWCB 1VQOS 3G96A 4NPOA 2VPWB 1VQ7S 5KFDA 1M5KC 4UUWA 1VK8A 4OHZA 2HVHA 3V4IA 2XHWA 2HNDB 4DQPA 4I68A 1HPZA 1MU2B 4B3OA 1JLQB 5J1PA 6FD1A 4WXOA 2R2SA 1WF2A 4PG7A 1MSWD 1U6BA 2UV8G 4Q0BA 2HFZA 2WK4A 4ZP8A 2YKMA 5H9FJ 3CCLS 4EGLA 2B5JA 3M9MB 1V3RA 1LXNA 2R8GA 2OTJS 1LFPA 3B82A 1LV5A 1FVSA 1X4GA 2JEFA 1TFYA 4BBYA