2M4MA

Solution structure of the rrm domain of the hypothetical protein cagl0m09691g from candida glabrata
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MSLGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELSREGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Solution structure of the RRM domain of the hypothetical protein CAGL0M09691g from Candida glabrata
rcsb
source organism Candida glabrata
molecule tags Unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m4mA00
1HL6A 1X4GA 4Y0FA 2DIUA 1X4BA 2CPYA 1F9FA 1X5SA 1O0PA 3R1HA 3B4DA 3CPWR 1JJ4A 2LYVA 2MZQA 3D2WA 3Q2SC 2NZ4A 4W90B 2RQ4A 3CCVS 2CPDA 1URNA 2MZTA 2MXYA 2MY7A 1YHQS 2DHAA 2M4MA 2MQNA 2CQ3A 3R27A 1WHYA 3CULA 1WF1A 3CCQS 2RRAA 3CCSS 2DHSA 3CC2S 5CYJA 2MKHA 2X1FA 1WF2A 2M8DB 1WG4A 1VC5A 2DNGA 4CH0S 3UWTA 3CMAS 2CQPA 3S01A 4FXWA 3CCMS 1DHMA 2I38A 2PEHA 4WFBQ 3CCUS 2LEAA 2XS7A 1HD1A 3H2UB 3VF0B 1VQOS 4IOAQ 1YWXA 2SXLA 4Z2XA 2CQDA 1VQ8S 2BZ2A 2CQCA 1NU4A 3DLLQ 2DNHA 3G8TA 2DH7A 2FHOB 5GMKa 1JJ2R 1NO8A 3NNCA 3S6EA 5DM6Q 2JVOA 3L3CA 2FPHX 2RU3A 2KFYA 5DDRC 1WHXA 4LJMA 2DNRA 2MQOA 4QU7A 1X4DA 5BJRA 1N8RT 2VONA 3LQVA 1UFWA 1SJ4P 1R8HA 3J7YU 2CPFA 2LKZA 2KG0A 2B0GA 2VOOA 2XB2D 1H2UX 3VAMA 1DZ5A 2JVRA 2OSRA 4BS2A 5LJ5Y 2CPEA 2QFJA 5GAHU 3MURP 1SJ3P 2XNRA 1H2VZ 5GADU 2ADBA 2GHPA 3K0JA 2XS5A 1VQKS 1FT8A 3FEXB 1KOOA 1XN9A 1N88A 1A7GE 1KC8T 1M5PC 2DH8A 2MHNA 3CCES 5D77A 1KQSR 4F26A 2D3OR 3N9UC 2MKJA 2E5HA 4TU7A 2HGMA 4CIOA 4IUFA 2U1AA 1D8ZA 3ULHA 1H6KX 3G9CA 3CC4S 2E44A 1ZZFA 3V4MA 1WTBA 4C4WA 3MD3A 5HO4A 2DGQA 1VQNS 1Q82T 1WI6A 4YUDA 1YJNS 1U6FA 5HL7Q 2X1BA 1U1PA 1U1NA 2KHCA 2MMYA 2KT5A 1L3KA 1HD0A 2LECA 1YJWS 2V94A 2ADCA 2WBRA 1QVGR 2LMIA 2DO4A 1ZH5A 2O3DA 3FEYB 5MLCV 2ERRA 2F9DA 2GO9A 1X4HA 1U1MA 2YWKA 1WWHA 2E5JA 4WFNQ 4IOCQ 1WEYA 5GAGU 4LIRA 5FJ4A 1CVJA 2ZJRQ 5CXTA 1D9AA 5GAEU 1P27B 5DM7Q 2CQ1A 4C0OC 1QM9A 2CQ0A 3G71S 2X1AA 1QVFR 4IO9Q 2CJKA 2LEBA 2DNKA 4YB1P 2FC8A 2JRSA 2OSQA 1VBZA 4QU6A 1B7FA 2CPJA 1FO1A 2KYXA 3HI9A 1M5VC 2DNZA 2AYMA 2M52A 1ZZNA 1UP1A 1UW4A 1WG5A 2MZSA 2YH1A 5D78A 5JVGQ 3MUTP 1WF0A 2N82B 3J7ZT 2ZJQQ 3OW2R 2HZCA 2JX2A 2AD9A 2HGNA 2AYBA 2DH9A 1H2TZ 4OZ0A 1DBDA 2MKIA 2I2YA 4WIIA 3SDEB 1Q7YT 2HYIB 3VAIA 1Q86T 5DDOC 5DDPC 2M70A 2YTCA 3TYTA 2KN4A 2EK6A 1M90T 1X5TA 3THTA 2MPUA 2G4BA 2XS2A 3TO8A 4C7QA 5GVQA 2RRBA 2G1DA 2OIHA 3G4SS 1VQ6S 1X5OA 3BEGB 1X5PA 1K9MT 2E5IA 2DB1A 2A3JA 1YTYA 1WHVA 1HA1A 3NMRA 3SDEA 3MD1A 2NLWA 2CQ2A 1X4EA 2VODA 4RU2A 2M8HA 3MXHP 1SJQA 4ED5A 2OTJS 2PE8A 3G96A 3SXLA 2DISA 2DGOA 3ZZZA 1P1TA 2RUGA 2CPHA 2MQPA 2MSTA 4ERDA 3THPA 5DDQC 2MSSA 1NJIT 2F3JA 1PO6A 4M5DB 3S8SA 2DK2A 4W92B 1S79A 2MQQA 2UP1A 3UD3P 4UQTA 3MUMP 3VAKA 3Q2TC 2DNNA 2DGXA 1U1QA 1WEZA 2LA4A 2MKKA 1YJ9S 1Q81T 2CPZA 2RS8A 2FY1A 4F02A 1OO0B 2DHXA 2KRRA 2LA6A 4WCEQ 5LXRA 4QPTA 1K8AT 2ZJPQ 3H2VE 1FJEB 4QQBA 4Y00A 4P6QA 3G8SA 2K8GA 4WKRA 3VAJA 4CH1A 1FJ7A 2MY8A 1U1RA 1VBXA 3EX7B 2CQIA 1SJFA 1K73T 2KXNB 4WF9Q 2LCWA 2J0SD 5H1SV 2M2BA 3RW6A 5LSLA 1U2FA 2KM8B 1VQ7S 2DGTA 3EGZA 2MQMA 2CPIA 4CQ1A 2LQ5A 3RW7A 1OIAA 1N52B 4PR6A 3BO3A 1VQ5S 2KXHA 3I56S 2L9WA 2M88A 3VAGA 1FJCA 3BS9A 2M9KA 1RK8A 3UE2A 1UAWA 3P3DA 1YIJS 2N3LA 5LXYA 4TU8A 1KD1T 1VQLS 4J5OA 4PKDB 2D9PA 4PRFA 5CA5A 2LXIA 2MQLA 3SMZA 1W2BR 3P49B 2EVZA 2MJNA 2MGZB 2J8AA 3CCJS 1IQTA 2Q79A 3P6YC 5LJ3Y 4LMZA 5EN1A 2YH0A 3MOJB 3NNHA 2U2FA 1VBYA 1SJRA 3BO2A 4OZ1A 3I55S 2DNYA 2RS2A 3P5TL 2XNQA 3CCLS 3CMES 1WEXA 4EGLA 2CQBA 2AYEA 1WHWA 1X4FA 1YI2S 1AUDA 3NS6A 3DXBA 2RT3A 2DITA 2MJUA 4FXVA 2RVJA 1G2EA 1FXLA 1M5KC 4UY8T 2OTLS 5IQQA 2MGZA 2KG1A 1JJHA 1FHTA 2QEXS 3NNAA 1U1OA 3MUVP 2DHGA 2MYFA 3VALA 1OWXA 1M1KT 3ZZYA 1X4AA 2DNQA 2KI2A 1YITS 2CQ4A 5IM0B 1A9NB 2LXUA 2XSFA 3IRWP 3CC7S 2CQGA 2RNEA 4WFAQ 1DRZA 2J76E 2M7SA 2QA4S 3MI7X 2OJ3A 2G0CA 2AYGA 2K3KA 2HVZA 2MKSA 1PGZA 3NS5A 2DO0A 2KM8C 3UCUP 2MKCA 5LSOA 1VC6A 2DGSA 3CTRA 2MZJA 2E5GA 2FC9A 2DGUA 2HGLA 2DNMA 3VAFA 3LPYA 3HHNB 1OPIA 2DGWA 5IM0A 2KXFA 2X1GA 2KH9A 1M5OC 2EK1A 3JB9k 3PIOQ 2JWNA 1X0FA 3PIPQ 3UD4P 2DNPA 3U1LA 4TU9A 3BO4A 3US5A 4YOEA 3U1MA 3CXCR 2F9JA 4U67Q 3EGNA 5IFMA 1RKJA 1U6BA 2M0GB 1BY9A 1VQ4S 2RQCA 2J0QD 5ITHA 3UCZP 1R8PA 2VOPA 2DNLA 2CQHA 1SXLA 2YKAA 1WG1A 1WI8A 4F25A 3TP2A 2D9OA 2MB0B 3S7RA 2MZ1A 1VQ9S 3CF5Q 3CUNA 2DNOA 1N54B 3MDFA 2N3OA 1U1KA 2KVIA 2KU7A 1VQPS 1KOHA 3R1LA 1U1LA 3B4MA 4ZKAA 2KRBA 4TLQA 3IWNC 1FNXH 4A8XA 1JMTA 1VQMS 2CPXA 5DETA 1WELA 2L08A 2DGVA 5JVHQ 1VC0A 1S72S 1X4CA 3UCGA 2BOPA 2L41A 4V19X 3VAHA 2DIVA 2N7CA 3G6ES 3CD6S 3CCRS 2MZRA
chains in the Genus database with same CATH superfamily
1X4BA 2CPYA 2E1PA 1O0PA 1NK9A 2O01C 3W3SA 4TY8B 1TK0A 1YHQS 3KDOA 3A8KA 5CYJA 3ENQA 2B4PA 3W8GA 1VC5A 1T94A 2Z8QA 3D4JA 1ZETA 4XK8C 5C2CA 1VOMA 2VFTA 3DGPA 3E3XA 2YWEA 3HZEA 1H98A 5DM6Q 4FKXA 1KFSA 4LJMA 4F04B 3KG1A 3J7YU 4CLWA 2FHMA 4ZDNA 4CO3A 3T1YF 2NXNA 4J9NA 1NK7A 1H2VZ 2ZVSA 3QRRA 4M95A 1KOOA 1JLQA 2ZHAA 3X1LB 4OX6A 2KTQA 2WVDA 3PW7A 2HWTA 3THVA 4Y6IA 1S4EA 4NLXA 3ULHA 2PA3A 1WD6A 3ENAA 2OPPA 4K4XA 1JKHA 2W2PP 2R42A 1IKXA 4H4KA 3CJ8A 1TZ0A 1RTDB 4PQUA 4YY3J 3PV8A 1NXIA 2BRLA 1S12A 1WC3A 4X4PA 1B99A 1OSCA 1G3OA 2ZOFA 4WFNQ 4I68A 1HBUA 3DRPB 2HHWA 4DV5F 1NCLA 3QIDA 3IXQA 1RAJA 2KYXA 2HURA 3M6UA 4DR3F 1UW4A 2UXBF 1ZA2B 4N56A 5JVGQ 2HZCA 2AD9A 3IP0A 4NXMJ 2AYBA 2DH9A 1IBLJ 1Q86T 4DV7J 1LKZA 4O3RA 4EBDA 5M2RA 2CNKB 5K8NA 3W60A 5KAKA 4C7QA 1N5TA 3E01B 3SEOA 3RRKA 3V5RA 3KLEA 5F8LA 5B0EA 2A3JA 4FPRA 4LF1A 3SDEA 4ZHRB 4LRCA 1VK3A 2YKPA 2F3JA 1LXNA 3TA1A 4ZN3A 2BDPA 4KFBA 2W9BA 1T03B 3T6BA 2VB6A 4X4VA 2RQKA 3W7BA 5J2PB 4UQTA 1HIYA 1NB7A 2JEFA 2YKNB 1BWVA 3UPFA 2JSXA 1CSJA 1Y11A 3M32A 1Q16B 3TUZC 3FBFA 1FJ7A 3CEDA 5A8WB 1IJFB 2VKRA 2OEJA 1N56A 5EDWA 1H7WA 1EARA 1VYAA 1IKYA 2V34A 2P2CB 1RK8A 4ECSA 1JLCA 2CJAA 3HJFA 1WOSA 4B9MA 2B9XA 3M2VA 2W25A 1JLGA 2D9PA 2XG8A 1EETA 1OQ6A 3BR8A 1XTZA 3D3BJ 2ATCB 4EEYA 5DQIA 2XO7A 3QMQA 2V4JA 1JXEA 2RMLA 3VZHA 1SJRA 3HX9A 3T41A 3OBIA 4LSNA 2DY9A 2OH2A 3BV8A 2CQBA 1REVA 5D4PA 1HBMB 3CDAA 2ZC3A 2OTLS 3FFIA 2XHCA 2CIMA 3V6DB 3R5JB 4ID5A 4JV0A 2XY6A 1SI9A 2M7SA 5KFTA 3BSAA 2MKSA 3UCUP 4RUCA 4J9LA 4DSJA 2QMUB 4MKAA 1R43A 3HVAA 2F8EX 3OHBA 4YR3A 3RAMA 3JAMY 5FLXU 4C8KA 3DLKB 2RQMA 4B3OB 3SCKE 2W2MP 1K47A 3KYLA 1VMBA 3MMJA 4DV3J 1EKRA 3MM7B 1YBAA 2J5AA 2ZFHA 4N41A 1IBMF 4QR0A 3TEGA 4FYYB 3OR1A 1CQMA 4USKA 3G86A 4FF2A 2OEMA 1JXLA 2W8KA 2RDDA 4ZKAA 3CGIA 2HHTA 2EFOA 2FZGB 2KL8A 3DU6A 1FWLA 1JLEB 3DI6A 4WU2A 1UJ5A 1RWMB 4UW2A 4MFBB 3DMJB 4U7UK 2EG1A 2MZTA 5IQ6A 5K5MA 2CQ3A 3CULA 2C2RA 4ILRA 3ZO7A 4GVLA 2MKHA 1WOPA 3MEGB 2AJ1A 1FXDA 2IM0A 5A8KB 2PFFB 4DCPB 1RT5A 2QA1A 3S01A 2AEJA 2BZ2A 4J9QA 1NKCA 1NO8A 4R5PA 4CTAA 1RT4A 3DNCA 3VHQA 4DSLA 2XMAA 4NCBA 4ZVGA 1WORA 3BZQA 3PDNA 1N5VA 2JLEA 3KLHA 2CVEA 4CYUA 2EI5A 2XSJA 3I4PA 2B5JA 2H1YA 1FFWB 2OPQA 2QV6A 1FEEA 4Q7AA 4X62F 3DOMB 2BQRA 4O23A 1SJ1A 3D6MB 3G9CA 4MMOA 2LVWA 3TJAA 1VQNS 4F4YA 1XNRJ 5E0OA 2CDQA 4I7FA 4DUTA 4BC7A 3I5BA 2IMOA 4U7UD 1U1NA 4PYAA 2XZWA 1YJWS 2FVRA 3B8HA 1FXRA 2OGUA 3KLFB 1MLAA 1ZH5A 2NYIA 3T5LA 5HBMA 3QNWB 4FKYA 1RHUB 4QPXA 2OD4A 2J7WA 1TKXB 5EX0A 1HBNB 1WJ9A 4KO0A 4A8YA 1VHIA 3V4IA 3LAKA 1XJWB 3KUGA 3G2XA 4K8RA 4J9MA 4NLGA 3BKUA 2B8PA 2FQQB 2VJUA 3J7ZT 4JV5F 2DR5A 3DOLB 3I31A 1Q4RA 2BANA 1TKTA 1TV6A 2IVYA 1JLAB 1SV5A 4DFPA 2QYGA 3BGLA 3RB4A 2GC8A 1FRMA 3TO8A 4CM2A 3OVBA 2RRBA 3L7PA 2VC0A 1VQ6S 1X5PA 1O6XA 5L9NA 2VQFJ 1HA1A 1OQ3A 1P1LA 3MAAB 3TAQA 1SJQA 2EFVA 2HNDB 1R0CB 3IRXB 4LUBA 4U6PA 3PO4A 4CO4A 4RBVA 2DK2A 2XMVA 3ZZUA 3CVKA 3VAKA 3KXDA 3NL0A 2XLKA 2DXFA 4CT9A 4DPOA 1JX4A 2QLWA 3HFZB 4Y00A 5LOQA 3G8SA 4I67A 4Q45A 4LF6F 2XCAA 2UUAJ 1TKZA 2KM8B 4P2FA 3EGZA 1TVRA 4RNMA 4QIEA 5H9FK 2L9WA 3KLIB 4A8MP 5KFIA 5F0UA 1XEZA 5HN0A 4RLEA 4B3TF 2ZHBA 2WZ1A 2OP5A 2AJFE 2J9CA 1V5IB 1BQXA 2F63A 2MGZB 2J8AA 2ILZA 3GILA 1YJTA 5CZVA 2N4DA 2QN6B 2YH0A 4C11A 2LDYA 1HNIB 4IQMA 2UXDF 1NBEB 1Z2ZA 1RSCA 4OZ3A 2BM1A 2AYEA 4G3IA 2V2VA 2Y8YA 4ED1A 3TUIC 4GVBA 1YBTA 2IYIA 4ETZA 2WSFC 3MCNA 3H2LA 2X7IA 5GMDA 4TQRA 3QRQA 4OYBA 3PEHA 1XR7A 4RBUA 2ZDPA 3DRYA 2W7AA 4LQ9A 5AXKA 2ZBPA 2OLWA 4IH7A 1DRZA 3CDBA 2LQ8A 3PM9A 2K3KA 4WE1B 2FVQA 3D67A 2R7UA 1TTHB 3CJTA 5F3ZA 3QZ8A 2GMJA 5LL6d 3MHYA 4I56A 3W1YC 1GXUA 1RT2B 4C8ZA 5E3RA 2R8HA 4CLYA 3LAMA 2OPSA 2Z0GA 3MPVA 3CJ4A 1J5OB 4XDDA 3KLGA 2VA3A 1RAIB 2R7QA 1AZSA 1RA6A 2XGPA 5HLFB 1GAOA 3BO4A 2GGPA 3US5A 3GB0A 5EWEA 3R6GB 5KFWA 2IJFA 4Q2MA 4X4TA 2IRXA 2GA7A 2UXCJ 2HHHF 2JLGA 2CQHA 4JV1A 4OZLA 2XI2A 4F50A 4X4SA 4NOHA 3HKZD 1RAHB 1N54B 4U8YA 2OPRB 3B4MA 4HH1A 4KT0C 3U02A 3A3NB 2CPXA 4ILLA 1V3ZA 2RUSA 4O0NA 3Q83A 3DLGB 1IM4A 4KGMA 3IR7B 1QAJA 2L41A 4YHHF 4DV0J 4JI7J 1FJGJ 2P8IA 1MWQA 3AD9C 4LSLA 1RQ0A 2F5GA 4DR4J 2HFOA 2A6OA 4JI3J 5DG9A 3D68A 3KK1A 4HLBA 3CCQS 3CCSS 2OFGX 2DHSA 1ZTTA 2XM3A 4DR5F 4DQIA 2IBOA 4KQZA 4PWUA 2ZITA 3OTOJ 2IDEA 2XMWA 4G65A 4LR7A 2B3TB 1VQOS 2SXLA 1VQ8S 1AUSL 2CQCA 1HNWJ 5F9NA 2DNHA 3MCSA 2UV8A 2FHOB 1JJ2R 3UVJA 3K8VA 4P9SA 3OUYB 3OXLA 1SKSA 2KFYA 5IT4A 3IC1A 1UZDA 4DV4F 2AZ3A 1KS2A 4LF9J 3W9IA 4RW7A 1LWEA 1H3DA 3GSIA 2KG0A 4HACA 3NAIA 2ATLA 3D0IE 3PR4A 1X7VA 3FBEA 2XYPB 3LWLA 1VQKS 3NS7B 3Q8QB 1UVIA 2APOA 2MKJA 2XGQA 4ZP6A 5CD4A 1NPPA 3TJ9A 5A2QU 1HBOB 2Q66A 1NK6A 1T9TA 5JJBA 3TJ8A 1XBWA 2WONA 5MLCV 4P10A 3H90A 2YWKA 2J0XA 3M8PA 3IN5A 4E2FB 4JI5F 1PAEX 1NNDA 4QCLA 2JRSA 4PWDA 3K17A 2OFHX 4LF8F 1B7FA 1Y10A 2VFVA 1UJ6A 2DEIA 4PG8A 3CWJA 3PW0A 3TEHB 2CZ9A 3MR5A 2I2YA 1H2TZ 2EBGA 2WVBA 2RDIA 5E3CA 4F0MA 3VAIA 1F5BA 5B0GA 4DL4A 1CS4A 3OLBA 5J1NA 2DR8A 2GO8A 3KK2A 2VIHA 1GTHA 1OMSA 5C2GA 4C8NA 2HNYA 3UR0A 4TY9A 3ZTSA 1X5OA 3BEGB 2IRYA 5ETQA 2JEJA 2ROEA 2C1EB 2D3UA 2W9CA 4J9PA 2AX1A 3BH7B 4ZPTR 5KFFA 1YTYA 2J7UA 1JLBA 1N6QA 4JYAF 1ZOTA 4KHMA 2ZM6F 4ED5A 1RYSA 4DX7A 1P1TA 5HMWA 1PAUB 1L3VA 2BE9B 3D66A 1YRXA 1S79A 3M8YA 4I64A 1N5YB 3Q2TC 3GLJA 1S1UA 2FJBB 1CC7A 3B82A 1VHFA 4ECQA 1YJ7A 2DR7A 2AGOA 4B9NA 3FQLA 1FE4A 2ZJPQ 1N34J 2WOMA 2CAJA 4B3MJ 4ZVRB 4NWBA 3NGKA 3EX7B 2CADA 5LSLA 1RCOB 3GV5B 5HQLA 1UEUA 5G4DA 1VQ7S 4OQJA 4P75A 1D09B 4XDCA 3OV7A 4JI6J 2GQCA 1VQLS 4F3QA 1N36J 7FD1A 4LFBJ 1TU0B 2QRRA 5CA5A 3SMZA 2MJNA 3H8YA 3HVRA 3QPIA 4WK3A 4OHVA 3UDVA 5C24A 3M8WA 2W9AA 4DSEA 1KTQA 2F8HA 3HP6A 1R8BA 2VV5A 5T41A 1U8WA 1N33J 2GFFA 2W7OA 1T95A 2UUCJ 4MH8A 1M1KT 1VRUA 4PPZA 3MR2A 1P8GA 4UOHA 3K58A 1A9NB 4FVCA 2EKNA 8RUCA 1UFLA 4OYMA 4GO5X 4URGA 5B09A 5E41A 1UJ4A 4H4MA 2AYGA 1IKWB 3GONA 2VG7A 3VR1A 2YX4A 3LOUA 4PEOA 2JJ4D 1SL1A 2MZJA 3SYZA 5HP1B 1VISA 2HGLA 5T7LA 3H4BA 2DGWA 2A2CA 3Q86A 4NMXA 4HHJA 3HLUA 4PXCA 1I6JA 1HNVB 4ZPBA 4G1PA 4I2PB 4DHVA 2FZKB 5I3PA 5KG5A 2KZMA 4GRSA 3ZTPA 4PCQA 4ECYA 2E5LF 1ZYQA 3FRYA 2YKAA 1K1SA 1NB2A 4F3OA 2ALYB 2ZC4A 1PBAA 3LTOA 4DQRA 3O6QA 4LRBA 3QZ7A 2IC3A 1KHVA 5B0FA 2XEXA 5EGYA 4A8SA 5JVHQ 1C0TA 3UCGA 2I0XA 1XR6A 3D6HB 3K2YA 3TVYA 1EQ0A 3I87A 2KJVA 4ZCIA 2MZQA 3IFEA 1F9EB 4NLPA 4KKOB 5DQGA 3PJ9A 5F8HA 1U26A 1N48A 3C14A 3CMAS 1HD1A 3CCUS 1CULA 3MM5B 3L7UA 3OVAA 4LF4J 2NR0A 4DQPA 4ZIVA 4KH1B 3NXZA 5F8MA 2RU3A 2J9DA 1LEOA 1DQ9A 4QW8A 4J9UE 3N6LA 1R8AA 1PJ7A 5EX3A 5KFKA 3DRSA 4NLVA 2AKWB 2HFUA 1RTHB 3UQSA 3P8BB 1DTQB 3JTPA 3BSNA 1GX5A 2XI3A 1M5PC 3PVXA 3R2DJ 4OJGA 3Q23A 1KQSR 1WKKA 4Y2KA 3QT6A 1RTJB 2ZWPA 2QSFA 3LP0A 3I5AA 4IUFA 1S6PB 3I5CA 4ZMMA 1F5CA 5DGBA 4V19J 5AE3A 3OXFA 3VQSA 2KT5A 1HWUA 3ILOA 1SC6A 3WDOA 4HVZA 1VLYA 2ZNZA 3GR1A 2BJEA 1U1MA 3PR5B 2E5JA 2BW7A 2ZJRQ 2KFZA 1QVFR 3AB2B 2Y0BB 2FC8A 1YVFA 1M5VC 4OL8A 3GYNA 4OMFG 4MT1A 3KFWX 4IDKA 3A3PB 2W01A 2DR9A 3MUTP 5HI7A 3BPSP 1MSWD 4Y65A 4OZ0A 4MK8A 1N5SA 4ALZA 1WC4A 3I0SB 2QGFB 1PSDA 1CQNA 3R5GA 1B7YB 2IA0A 2YQ1A 5ETMA 6FD1A 3NBPA 1DY3A 4TKTA 1R6VA 4ZPVR 2FGOA 2HAFA 3LA0A 5D4LA 5HMXA 1X9SA 2W8LA 3K5LA 1X9MA 2XCPA 4AL7A 2JNJA 2GJIA 1VRTB 4W92B 1TUGB 4L3NA 4S0MA 3HD2A 1BMQB 4C8YA 2W7PA 4DF4A 3EZ5A 1FRKA 1RHKB 2H5IB 1VBXA 3KMSA 2L9NA 3GE9A 2GAHC 4A48A 4NEYA 3FVYA 3JS9A 3N6MA 4JI2F 2G1HA 3MF5A 3MMCA 2N3LA 1RT6A 3PYEA 3FCHA 3VGVA 2LXFA 5K14A 1OPZA 1C4CA 1S59A 4QIVA 3G82A 4WBFA 3PRBA 2I1RA 2QMWA 1RAFB 2YNIA 3DRPA 3I4HX 2HBYB 1BGXT 1YJRA 2OO4A 1Y0HA 1SCJB 3T9NA 4KBIA 4DL2A 3NAHA 4DZ6A 1D8YA 1MU2A 1O5JA 3M9OB 2QLXA 3BDPA 1U1OA 3JQJA 3WX8A 3VALA 1ZPVA 1LWCB 4RW4A 4U9RA 5J1EA 2HQ3A 3RB0A 1DTTA 3HMJG 5KT3A 4F8RA 1TL3B 2G0CA 1UVLA 1VS3A 2KM8C 1GK8A 4H4OA 1XNQJ 2N4CA 3A8EA 1TP7A 3W64A 4LFCF 2PSZA 2KO1A 4AXJA 2VBYA 4J9RA 2FHKA 4KRWA 1L3TA 3AAWB 1U02A 3QWUA 3W2VB 3GFXA 1ZAVA 3GIRA 4DV6F 2RQCA 4IFVB 5I3QA 1FRXA 3OL6A 2C2KB 1SKRA 2QZ8A 3W63A 4IG0A 1B0VA 3NCQA 4WU3A 1AFIA 2GNKA 1RHRB 4Z7YA 4PXEA 3N01A 1FNXH 3N5BA 3AJDA 2Y1RI 5J2QB 2V67A 1VQMS 2PMZD 4KGXB 1CJUB 4ILMA 2DGVA 3LUYA 2ASJA 3T1HF 3CJQA 3I6PA 2MZRA 2VDHA 5HMYA 3IS9B 4FYXB 3IWXA 1MMLA 4NCGA 3IAM9 1O51A 3MOZA 3C19A 5F8JA 3TQEA 2H65B 4X65F 1VK8A 1SKUB 1S9EA 2UUWA 2IM2A 3GR0A 2GMHA 3MPDA 2Z57B 3BBCA 3HSDA 1ROFA 1Y3JA 2GIRA 3UWTA 3BGRB 4FXWA 4GC6A 3KOAA 4WXWA 3HVTA 4IQXA 2BKNA 3AXMA 3K5MA 2OHDA 2Y8WA 3C8YA 3AA9A 3QRPA 2HQIA 2W1BA 1SJ4P 1MMNA 3ISZA 4K4VA 3BB5A 4ZP9A 3CCZA 2VPZB 1OSDA 5LJ5Y 2CPEA 2MLZA 2QFJA 1E6VB 4C97A 3CD0A 2GHPA 2AJQA 1EX8A 3NWGA 3S1TA 2HVEA 2NXJA 4BHQA 3CCES 2JDJA 2GIFA 1S1VA 4X64J 4TU7A 1VI7A 2QG9B 3EXCX 3DLKA 4C4WA 5G0RB 1HYSA 1RWUA 3M2UA 4NZ6A 4CRJA 1CVJA 5CXTA 2ZD1A 4IKAA 5GAEU 1QM9A 4NEZA 2V9WA 1TFWA 1T8EA 1RISA 4YB1P 2ZNYA 3KHRA 1VBZA 3BGFA 2DNZA 2I6WA 3ITHB 3QBCA 3SV3A 1GFWB 3PYDA 2YVSA 4I69A 2PC6A 2H51B 2IA6A 2LP4A 4CLLA 5DDOC 2F8MA 3D0GE 2EC2A 1NK8A 4WJBA 4OX9J 1T9UA 2A10A 2I5JA 2W24A 4NZ7A 4B3RJ 5GADI 3EMTA 5ETNA 2E5IA 4XPCA 2ASYA 3RBXA 1WHVA 1SH3A 4N77A 2HFVA 4FZVA 4YY3F 3RGIA 2MSTA 3KUEA 1RT1A 2HS4A 3CSKA 3MECA 4KIAA 3ILIA 2R2TA 4DDFA 1Q1KA 3CW2C 1Q81T 2IVMA 1FCAA 4RUAA 4NLDA 4WTOB 4F0HA 1K8AT 3EZUA 4KE5A 1JB0C 1FDAA 1S5ZA 1CJKB 4DL7A 1K73T 2CQIA 1SJFA 3DLBA 4NXMF 1IBLF 1MWZA 5HK4A 3GPAA 1KDNA 4DV7F 2DCLA 3ETOA 4PR6A 4F4AA 3I56S 4MIAA 2XZTB 3TANA 2MQLA 1T3OA 4K7QA 2JEGA 2XULA 4DSIA 1DJ0A 1RAAB 4TVAB 3ILJA 3CDWA 1B70B 3HHLA 4K5RA 2O1PA 2MJUA 5GMEA 3V81A 1FESA 2BQ3A 1RT3A 4TQSA 5L46A 2AJ0A 2MYFA 1SPBP 4F4KA 5IM0B 1QAYA 1U48A 2JL9A 1RGVA 4NLRA 4G1QB 1WKJA 3NEKA 3MM8A 3H5XA 3OJUA 5A6PA 1RAOA 4I6YA 2YBVA 4FYWB 5KT6A 1CLFA 5IT9Y 4HT7A 2DXEA 1M5OC 2XZDB 4ZPDA 3TNVA 3WC2A 1FDNA 3UD4P 5T14A 2GQQA 1JLFA 2YNGB 5HROB 2L9DA 3VCDA 2ILYA 1AROP 1BY9A 3LP2B 2ZH1A 1MROA 4AXIA 3DOKB 3EICA 2BW2A 5KFZA 3TX0A 2XYGB 5H9FJ 3TZXA 1BQMB 2DNOA 4P2SA 2N3OA 3IAS9 4TLQA 2RE1A 5CYMA 1JMTA 2EW9A 4DX6A 4I1TA 1NSPA 4R8UA 5HQMA 3CD6S 3B4DA 4X84A 1YKWA 4QW9A 2JLFA 4MIWA 1WHYA 3RJMB 1B3TA 1C1CB 3OD2A 2YNHB 3GIJA 1WC6A 1N0VC 4ED8A 2EWHA 4IFYB 2PN6A 4CLKA 2J0WA 3WC0A 4WFZA 2CQDA 4A47A 4DV3F 2Z2LA 2DH7A 4W4MA 1YG0A 4IO1A 3EPIA 3ILLA 2B7CB 2QO3A 4I2QB 4ZVOB 2WK4A 3R7NB 2VOOA 2JVRA 3DYAB 2QL7B 3BYPA 1SJ3P 1Y5LB 2ZH4A 2ACMA 2WAQD 1NZAA 5K8PA 3D28A 3FEXB 1NRKA 1RWPB 2GVZA 1NK0A 1HFEL 2C3MA 3MFIA 1UVNA 2YY3A 4HR2A 1XMOJ 3QO9B 1SBRA 3KJNB 1G4CA 1Q7LB 2XWXA 5I3UB 3MD3A 4CNZA 1WI6A 5DZ6A 1HR0J 2NUUG 1NM2A 3M2RA 2LU1A 3HD1A 5HLFA 3UW1A 4ZLJA 1WEYA 5GAGU 2P6SA 1AT1B 1JJCB 1D9AA 3JYTB 4NYZA 2B51A 4CDIA 1QTNB 5L9XA 4OV6A 4EZ6A 3QIPB 3I0RA 2VG5B 2BJ9A 4GKJF 2K1RA 1SQGA 4K0KJ 1NSKL 2BEFA 3BF4A 2MZSA 3QSYB 4J9SA 2EC0A 4UOFA 2BX6A 3M30A 2HYIB 1SIZA 1TL1B 1UVMA 5DDPC 4BLGA 4RJVA 3LF0A 2DXDA 1X5TA 3THTA 2IVFB 5GVQA 3FBCA 3M9MB 1R7IA 2V8HA 5C5JA 4FBTA 2QTWA 1R3NA 1GMVA 2VODA 1LWFA 1XNRF 1HNZJ 1RACB 3ZZZA 3MM9A 1LW0A 3MMAB 3J81Y 1E6YB 3BPDA 1SB6A 3LP1B 1HWKA 5F8NA 2DHXA 1HHQA 3L4BC 5LMNJ 2RIJA 3M1VB 1RBAA 3IM9A 1S6UA 4WWSA 5SZTA 2ZE2B 2AWZA 1TELA 3VAGA 4ECVA 2BRKA 1LWXA 3W61A 2QLJB 2GCFA 1Y9OA 3CE8A 2VQFF 4PABA 1C0UA 3HSGA 3ELHA 2BKOA 3ADAC 4OX7A 2U2FA 1RADB 1C4AA 3NP5A 3CMES 3KK3A 1WHWA 2MEWA 2COLA 4EFAC 2VG6B 4Y2AA 3C6TA 2HQCA 4UOGA 3T6JA 3NNAA 2VBZA 4BWJA 2AGQA 5C7PA 2AV5A 3ZZYA 3CJRA 5IWAJ 4ZPWR 3OFEA 4A8OA 4NYPA 2XY7A 5HAOA 1OYEA 2CWKA 1L3UA 4WXOA 4P72A 4OZNA 3NS5A 3UR3C 2UUAF 1WUUA 3KJVA 4R0EA 3FC9A 4TLRA 3N28A 2B8QA 1S1XB 2XY5A 2PO4A 3O8WA 2MDAA 4RW8B 2D41A 2MQ8A 3M05A 5GAGI 3PIPQ 1NDLA 1QDUB 2VUGA 5I42A 5JMNA 3H4DA 5D4OA 4KV8B 1U0HB 1HMVA 1T02A 3MGJA 1XMQJ 4O4GB 4P2XA 5A0YA 5DGAA 1GT8A 3KHHA 2BVZA 1AB8A 3MEDB 4JI0J 2HEKA 5KT7A 1IBCB 1L3SA 3R1LA 3IWNC 4URSA 4YB6A 4FDFA 4ZVSB 4A8QA 4PZVA 1YQHA 1F3VA 3G6YA 1T05A 3JXOA 1F6TA 1U2RA 2VH7A 2DIVA 4KGVB 5LM7E 1X4GA 1VQYA 3MR6A 1X5SA 4RWWA 3JSMA 3R1HA 3CPWR 5L1JA 1JJ4A 4BWMA 3DGPB 2NPFA 1SVDA 2MY7A 2DHAA 2RF2A 2B4UA 3R27A 1QD1A 3HFKA 4CT8A 2KJWA 1Y3KA 3DKDA 3KDNA 1WG4A 5HVGA 3FCWA 2DNGA 3HFVA 2CQPA 1QSLA 4C0HA 2XMJA 1RWVB 4Z2XA 1XC9A 1NU4A 4USMA 3DLLQ 3QAEA 1JLQB 3R5AA 5CQGA 4M1KA 2QE5A 2BJ7A 1T0TV 2UXCF 5FD1A 1ZM4A 3G8QA 2KB2A 1ACMB 2OPPB 1JKHB 5GAHU 1IKXB 2GHWA 4IRCA 4PQUB 3R3TA 1SKWA 3LW5C 3C2PA 4RL1A 4NL5A 1BQNB 3TAPA 2D3OR 2IDLA 4XIUA 1HBUB 5L1IA 3NOCA 3T5HA 2HS3A 4DV0F 4JI7F 1FJGF 1T3NA 4DFJA 5KT5A 5F8IA 3SIPB 3GSDA 4LF7J 3PW2A 1Q82T 2V6AA 4DR4F 2PT0A 4JI3F 2BR0A 2V94A 2HHXA 2GHVC 4WP9A 4A4JA 3OJSA 2F9DA 4ZVEA 2J7KA 3OTOF 5IC6B 1P27B 2V2QA 1Q8KA 2CQ1A 5RUBA 2CQ0A 3G71S 4D3GA 3PJWA 2ALZA 4DUZJ 1HNWF 5IV4A 1VFJA 2VICA 4QYZJ 2YWHA 4Q44A 1HNXJ 4ZP7A 2FLLA 1Q5YA 4LF9F 3BN4A 4K2XA 2IRUA 3NG8A 4DOZA 2NXUA 3SDEB 4PQAA 2ZVIA 4FF3A 1LFPA 4M5HA 3GFYA 2DTJA 3PTWA 1W26A 4DR2J 2W9BB 2EG2A 4KFBB 2ZOGA 2D7SA 1EP4A 4LT6A 4KKOA 5IOLA 3MD1A 5A6WA 3RBZA 4BBYA 2OTJS 4F4ZA 1QJHA 1HHSA 4B9LA 2PDAA 4ICLA 3UDCA 3SZ2A 5U47A 4UZCA 3EVMA 2PEBA 1RAGB 1V5VA 3D1OA 1IKYB 2P9EA 2N7YA 2LA6A 4ATNA 1JLCB 2FVCA 2J9EA 3BN7A 3M2VB 1JLGB 1CBKA 4CO1A 1EETB 4WFYA 2DJWA 3M6WA 1OS5A 2CPIA 2V4JB 1OIAA 1N52B 1RTZA 4EYHB 1KQGB 1VCTA 4LSNB 3J80U 2A18A 3RBEA 1REVB 3MR3A 5J2NA 2X3GA 4J5OA 3MWBA 2MKYA 4TXSA 3DGVA 3DLEA 3BQ1A 2FB0A 3FFIB 1IBKJ 3SQGA 3CCJS 5K20B 4USIA 5D0GA 1HQEB 3ISNC 3BO2A 1JXVA 3RRGA 1Y4ZB 4EUVA 4ID5B 5ETSA 4HDGA 3RYLA 1HKAA 3IBWA 2XLJA 1KKHA 4JUZA 1NKEA 1NKBA 1FKAF 4JI4J 2DHGA 3HULA 1VJQA 1F2GA 4RW9A 3IWLA 1FD2A 1N34F 2B7BB 3GCXP 4B3MF 3W5ZA 2V2KA 2HVZA 1FWPA 5AE1A 5AJ3J 1JQGA 2MKCA 4PXBA 3FSXA 5LSOA 5KFDA 4L74A 3FEZA 2QA4G 4G1IA 2DNMA 2DD8S 2FVPA 5KT4A 4JI6F 5DG8A 3MPWA 3V6HA 4KGKA 3OR1B 5KFJA 3PACA 1KVIA 4LREA 4M5JA 4CP5A 1N36F 3A8IA 2JWNA 4LFBF 4DEZA 4K4ZA 1IQZA 4PG4A 2YKMA 3TZWA 3GWCA 4J37A 2CA9A 1ITPA 1V6HA 2BE2A 3DI6B 1FWKA 3EDRB 1SXLA 4KY3A 4N5SA 1N33F 5CCLA 5FDLA 3AHPA 1KOHA 3C66A 3Q8PB 2UUCF 4DI6A 5KFOA 4QR1A 3F44A 2BA9A 1I1GA 2DR6A 4NI2A 3ZZTA 1LXJA 1S72S 1J5EJ 2AEMA 2ZWOA 1RT5B 3VAHA 2R7OA 3AQOA 2ZH2A 1BWEA 1D1UA 2MLXA 1U2CA 3J81j 3CCVS 4R5PB 3DFEA 1RT4B 3TVZA 2GVDB 4CO2A 3GFHA 3SFGA 1WF2A 5KFMA 1HQUA 4DL5A 1RBOB 1DHMA 4JI8J 3KLHB 3PYGA 4HHHA 3H2UB 4YMEA 4CYUB 2XSJB 3G87A 2B5JB 1TK5A 2VJVA 2HQGA 1PIEA 4AT1B 4DCOB 3LQVA 2QFIA 2LKZA 5DRKA 5KFPA 8AT1B 4UUWA 4KHRA 2WVFA 2QLBB 4JV2A 4I7FB 4MIBA 1HPZA 1WSRA 1HARA 1S1WA 4OI3A 1XQIA 4FS2A 2YQ0A 1FI4A 1KC8T 1N88A 5HBMB 4B08A 2KDOA 2R2UA 4CLTA 1D8ZA 3QJJA 3MEKA 4KO0B 2X3DA 3V4IB 3GJSB 3EWGA 2RKIA 1KTVA 4Z37A 5IC4B 3ISND 2D69A 3FBBA 5B0DA 1UCNA 2BANB 3OTCA 3M8QA 3PHEA 4LF4F 1FKPB 1IWGA 1TKTB 1TV6B 2K2PA 3RB3A 1SV5B 2EFQA 1S7IA 5CD4H 2DPIA 2HVHA 1HI0P 2HFZA 4DLEA 3EVOA 3MCOA 4ZLPA 2Z2YB 2ZJQQ 1RDRA 3AJ2A 1JNZB 1TAUA 3J7YI 2B56A 4ES3A 1KWMA 2ROPA 1K1QA 3TUPA 2HKEA 3TI0A 4MK9A 1K9MT 2BQUA 1PC4A 3X3UA 4MTPA 3KHGA 2V4RA 1X4EA 2XMKA 4YR0A 3MXHP 3AQPA 3G96A 3SXLA 2DGOA 2RUGA 1CJVA 2FIUA 2OEKA 2HPUA 4IH5A 4FPIA 3M8RA 3TAMB 1IKVA 4B9TA 3D9BA 3L9ZA 3CNQP 4CO0A 4USWA 3MUMP 1TKZB 1W25A 2LA4A 1IR0A 2LDIA 4NZ0A 1TVRB 5A8RA 1S77D 3AD8C 3GFZA 2OAUA 4WCEQ 4OYOA 4JYAJ 5KFVA 2LQBA 3CJKA 1RTIA 4M5DA 5AXNA 3C3LA 4HTJA 2J0SD 3GV8B 5HATA 3SFUA 3OHAA 1FTRA 4FNIA 4C11B 3UFCX 1MW7A 1FJCA 2YXLA 1UW9A 4AQYJ 1HWIA 5C42A 3FUYA 3UE2A 1KVKA 5LXYA 4IG3A 1UA0A 3AH6A 5J2MA 4GVBB 3GJQB 4PRFA 3NLCA 3P49B 2VHGA 4BC9A 1H74A 3QT8A 4QJVA 2RS2A 3M7VA 5ETLA 3PX0A 4QYRA 3FQKA 3J7AN 3NS6A 3PZPA 4AD6A 2DITA 4GC7A 5ADZA 1AYEA 3DM2A 4UY8T 1F1BB 4HT5A 1FHTA 1KHWA 2AP6A 3NGDA 3IR6B 1FK9B 3TA2A 3ZNJ1 4ANDA 2VPYB 4RWXA 5D4NA 3IRWP 4CLSA 5DQHA 1WSVA 2OPSB 3KLGB 1AZSB 1DLOA 2P6TA 2W2OP 5KFYA 2GGPB 1QTMA 3QJLA 1S6QA 4A46A 5SUHA 4P73A 1WC5A 3NWRA 3OTEA 5K9FA 1TL7A 2X1GA 3I96A 3ET6A 3R8YA 4L75A 2EK1A 2XLIA 2GX8A 2L48A 1UVJA 1SQEA 2AJ4A 2F9JA 4I0WA 1ZAXA 3VGSA 2DKOB 1R27B 5AE2A 3TZZA 5L38A 4OLOA 4DR6F 1WI8A 3CF5Q 3G6VA 1SH2A 2DVIA 2E1RA 4LSLB 2ZBQA 1HWJA 2FLPA 3QFHA 2KRBA 2NXCA 4K4TA 4A8XA 3KK1B 4HEA9 2RJZA 2RD5C 4NE9C 2HVIA 1HL6A 2IM1A 1XNQF 3Q2SC 4WP3A 2RQ4A 5CYQA 3UVJB 2MXYA 3QLHB 2CNLB 1LWEB 4U8VA 3W9JA 4HACB 2E1CA 4CH0S 4RUHA 1FRIA 2EFGA 1YWXA 2LLZA 2K06A 3RTVA 2C3OA 3KWMA 2E7WA 4DV1J 3C16A 5D3GA 3L3CA 3L09A 4P74A 2ABYA 4QU7A 5KG1A 2OI2A 2VQEJ 1UFWA 2I9SA 2CPFA 3GV7B 4ZITA 1CPZA 1F60B 5KFGA 4O3PA 5C25A 1G1XA 3OXGA 1FKOA 1R8CA 3SBMA 4G1QA 2WONB 2H4WB 5D77A 4LF5J 2QC3A 3N9UC 1XERA 3AB4B 1EIYB 3M8PB 5A2QY 2QYCA 2ZUAA 4DR1J 3EXYA 5HO4A 4LBHA 2HK2A 3EVWA 4H54A 4C3KA 4PWDB 2MMYA 1CG2A 2ADCA 1B64A 4KPCA 2PFDA 1X4HA 1R6YA 1MN7A 4ED7A 3Q22A 1CS4B 2UUBJ 3CJ2A 3KHLA 2CJKA 3KK2B 3FZBA 4ZLNA 4UTGA 1T7PA 4CM0A 3MM6A 3CJ5A 1RHQB 2CPJA 1UWAA 2HNYB 4ED4A 2FY8A 4K5SA 3HO1A 2QT7A 2JFDA 2W9CB 4PPDA 1JLBB 1N6QB 2WCXA 3BH6B 2F7VA 2J9DE 4ZVPB 2J6TA 4RZRA 2HHSA 2EK6A 2V2ZA 2G9OA 2OIHA 4F2SA 3D6FB 4X64F 1KNZA 2PD1A 1N32J 1C1CA 1S1UB 2CDRB 1X31C 4KR0B 2YKOA 2PE8A 1ZM9A 3HHKA 4Q43A 1UWBA 2WOMB 2YWWA 1F5AA 1PG5B 3VZIA 2HHUA 2MSSA 4DG1A 3PX6A 4F67A 3C15A 3K59A 1YRUA 3W2WA 2BJ3A 2UP1A 2UVRA 2R7TA 2JOQA 4J91A 2FY1A 3C46A 2H4YB 4O44A 2KRRA 4ELVA 4ZOSA 4CH1A 2FUG9 1S9GA 1TUVA 3RU0A 3MEEA 3AA8A 1T9WA 4L73A 5H1SV 1KP6A 4B9VA 4KYZA 5C24B 1RT7B 4PUOA 2WSEC 1VQ5S 3L95X 2HBZB 4N47A 2ZBCA 2V9KA 3BQ2A 2XMMA 3GJRB 4YP3A 4OX9F 1S6OA 1KLMA 3ENVA 2YPYA 1NPKA 4B3RF 2YX1A 1NHKL 4NASA 3ZZOA 2OUGA 4DV2J 3HCXA 4LRAA 1VRUB 1Q8LA 1NJWA 1I3OB 4DPUA 3I55S 4QIWD 3K5OA 1FX4A 2IPOB 5ETVA 5DLGA 1VDHA 2RSQA 4U96A 5ETPA 3AJ1A 3MMBA 2NSCA 1G2EA 4MJKA 2VG7B 2DPJA 3O2IA 1T11A 5F41A 2JEIA 1SUQB 1C1BA 1UL3A 4KAIA 4WKYA 5T7LB 4LFAJ 2DNQA 4OHZA 2CQ4A 4EZ9A 4YR2A 2LXUA 2PI4A 3BBBA 1LW2A 1XIQA 5E3AA 5KFHA 2HWHA 6FDRA 1LV5A 1XMBA 2CJXB 2DGSA 3NCRA 4FBUA 3GIKA 3VAFA 1AA1B 1I94J 6AT1B 1X0FA 4BDPA 2QL9B 3CD7A 2F4VJ 1OYDA 2H54B 5THWA 2CJYB 4K4WA 4B3SJ 4DMZA 2VOPA 1C0TB 3IA0A 1MG7A 2G2ZA 1RZMA 1X8DA 1H38A 2Y1JA 3OL9A 2D9OA 2HLUA 4DCJB 4ZIWA 1SQFA 3M6XA 3K57A 2IAJA 5K8OA 4URQU 1PBUA 2HMIA 1RU1A 2CG8A 1G7CB 2FYXA 2BOPA 4V19X 2AZ1A 3TOQA 3C14B 4R0JA 4EK2A 1R0AA 1CULB 1XR5A 5KG6A 3DRRA 2LYVA 2M4MA 1YGYA 3ZZRA 4OI0A 2RRAA 3CC2S 2C3PA 2X1FA 2M8DB 3R9LA 2FTRA 3IBFB 3DRSB 3LGHA 2C2OB 2CYYA 3IG1A 1TMMA 1CJTA 2DRDA 2FZCB 5D6GA 1FDDA 4DS5A 3NNCA 3NGSA 2WBMA 3WIUA 4PYDA 4M5NA 5BJRA 1N8RT 2C3UA 3LP0B 2B0GA 3E8OA 3A4TA 4EU0A 1SC3B 3GP9A 2EFNA 1RBLA 1U24A 4DPTA 4ZPAA 4X4RA 2V4QA 1WNEA 2NSBA 4MKBA 1FT8A 3AFGA 4I6AA 2E9RX 2AT1B 1QE1B 3K8WA 2HGMA 4CIOA 1QAIA 2E44A 4Q0BA 2RAQA 3PXGa 3Q8YA 1HD0A 1Q8IA 2LMIA 2DO4A 4IDKB 2V8DA 4RW6A 1UFKA 4Y3CA 1FF2A 3POTA 5KFBA 4DR7J 2ZBRA 2ACYA 2YNFA 3MEDA 1FO1A 3HPOA 1WG5A 3R5BA 4LRFA 3NBPB 1ELOA 4DFMA 2YX7A 3MR7A 4C48A 4UZBA 1FRJA 3JQKA 5AXMA 3ZTOA 2UU9J 3R7BB 2RB7A 1XMOF 4CZCA 2R7XA 3GMGA 2DB1A 4WZMA 1DURA 4CWBA 2NLWA 2CQ2A 3ZFVA 1HR0F 4M94A 3HK2A 1H0HB 5M2PA 4EBEA 3J7Z5 3UDLA 2MQPA 2C2EA 1YBUA 7FDRA 3RAQA 3OR2A 4P52A 2V8VA 1NJZA 2DGXA 3PY8A 2W4PA 3MTKA 3TQ1A 4WP8A 4K0KF 3U1NA 4MK7A 3MZIA 4ED3A 3MMCB 1RT6B 2A2DA 5CHCB 2FD2A 5K14B 3IM8A 3G82B 3B54A 4XPEA 5CCMA 1BQNA 3RW7A 2YNIB 1TK8A 3O5TB 4M8LA 4MAKA 2QL5B 3V6KA 3A12A 3FSYA 2M9KA 1S1TA 2HQFA 1KEKA 1VIXA 3T1AA 5L39A 3RR8A 1J2VA 3TR5A 4ELUA 1MU2B 2LXIA 1W2BR 4KJIA 2EVZA 4Q8FA 3RR7A 3CMQA 3N0VA 5EN1A 1HNZF 1FTCA 5KG3A 4RW4B 5J1EB 2KZZA 1S57A 1DTTB 3FKBA 1YI2S 1AUDA 2ZH7A 3N79A 4H4OB 4PAAA 1RHJB 1JJHA 2V0NA 1FVQA 4ED0A 1WTFA 3WZ0A 1RI7A 1YZ7A 7AT1B 3D1QA 2W2QP 3BREA 5LMNF 2J76E 3MI7X 3ZZPA 2IIHA 3O44A 2CZVC 4K50A 5IV3A 5B0CA 2HQDA 1HI1A 4OHWA 3Q0AA 2HRUA 2PI5A 1R31A 4DU8A 3LPYA 2AEFA 2KH9A 2IYGA 3MTJA 3ICLA 3DCAA 4IG0B 1AXQA 3PNIA 4Z7CA 2EXUA 2AHOB 3EGNA 3DDIA 1U6ZA 3W8PA 1B4SA 3OFGA 2G2YA 1GXTA 4F36A 2B9EA 4PWWA 3AD7C 3GJTB 3LWMA 4ED6A 4CLPA 4JI1J 4NCGB 4ENOA 5E5NA 4C3MA 2G0IA 3DDNA 3B6BA 3HXMA 1S9EB 2HNZA 4N8OA 5B0BA 5IWAF 1VC0A 2R3VA 3G6ES 3BKFA 2V8PA 2KT2A 1RA7A 4P7TA 3HVTB 1S48A 4U95A 3RRHA 1GH8A 2MQNA 3RBDA 1LNQA 3CB4A 4Y2IA 4A8FA 2HZAA 1HQEA 5K8MA 1GEHA 5KG7A 3K0JA 4V1Ak 5EHHA 1BLUA 3M9NB 4TY8A 3S6EA 3D7SB 4OX8A 2Q43A 1XMQF 1X4DA 2VONA 1S1VB 3CT9A 4DL0C 1M1HA 1WDTA 2GW8A 1DARA 1H2UX 4JI0F 4USJC 4OZJA 4O0IA 1OY6A 1MMDA 1HYSB 2Q6BA 2ADBA 3R7SB 3F73A 3HHEA 2JHEA 5L8RC 1M0SA 2DRAA 3M2UB 3JSBA 2ZD1B 3UN2A 1BXNA 1T9YA 3CC4S 5HJXA 1Q5VA 2ZHOA 4L76A 1U1PA 3T19A 2LECA 4ER8A 2NUHA 1S0VA 2LEPA 1PC5A 3FEYB 1D9FA 1IR1A 4IOCQ 1U49A 5FJ4A 4DUYJ 2XO6A 1LK7A 2XBPA 4OZ2A 1RTDA 3HDSA 1DQ8A 3H20A 1PYSB 2FJWA 2K3IA 3HI9A 4DPYA 3PCOB 1SIWB 2Q6CA 4NA1A 5E3PA 1UP1A 3OVSA 4KHPJ 2I5JB 2HZVA 4Q2LA 1NJYA 1N5QA 1TQLA 2BACA 3BGUA 2YKQA 4ANCA 2YTCA 1URRA 2NQPA 4O3QA 2IMWP 3ENWA 1RT1B 2G1DA 5E7OB 4Y28C 4GKJJ 5DLFA 3P4UB 3MECB 4J7CA 3AOCA 3DHXA 2GVDA 4O3SA 1CC8A 3EJMA 4LF7F 3AY0A 2DISA 4QOTA 3VGUA 3KJQB 1RJJA 4ECWA 1M5SA 1Q78A 3E01A 3DRXA 4E0DA 4ANEA 1TAQA 4DUZF 4ZHRA 1WOOA 2HW3A 1HNXF 4WKRA 1W2IA 4C98A 1KONA 1U1RA 2HAIA 1T03A 2ROGA 5J2PA 3CDUA 2F40A 1X0PA 1P9QC 4YFUA 1C2PA 2B9WA 3OFHA 3LH2S 3T3FA 2KXHA 5ETRA 2YKNA 2UZAA 3HHLB 3MAQA 5CH7B 4NLSA 1UAWA 4DR2F 5A8WA 3V81B 4NMLA 1RT3B 1BD6A 2CWXA 5BR8F 3HM9A 2O67A 5LMUJ 5LJ3Y 4LMZA 5DO2A 5KFQA 3CO9A 2VF3A 5KTQA 2DNYA 4EGLA 1FKPA 2E9TA 2XHWA 2DHHA 3R5CA 2AU0A 5HSPA 1FA0A 4KSEB 2GAGC 3O3LA 2CRLA 1NUEA 3MCMA 3MM8B 3MUVP 2V5HG 4IOBA 3R6LB 2KI2A 1W7WA 4NLOA 4P7VA 1S0NA 2IJRA 2PGCA 1OY9A 3PX4A 3P96A 1JLFB 1M1GA 5D0HA 3M6VA 1HBMA 2IBKA 1VC6A 2IY5B 1MROB 2ZZMA 4RU9A 2IFXA 1A0OB 3V6DA 1PJ5A 2FGCA 2B6AB 1OPIA 1YK9A 4XAKA 3JAMU 4ZN1A 4EBCA 1S76D 4P2MA 3U1LA 4DWIA 5AT1B 4DF8A 1IBKF 3CXCR 5CYMB 3TAMA 1VBKA 1D3WA 3QSIA 1U6BA 5D0EA 4CLZA 2BBEA 1NHUA 2J0QD 2XC9A 4R8UB 4B3OA 1WG1A 4TN2A 1UZHA 4JP8A 5KG0A 2C42A 3GQCA 2KVIA 2GMLA 2JH3A 4JI4F 3MM7A 1ZAWA 1ICEB 1FRLA 2NXEA 3OTBA 1Z2LA 1Z4UA 4ECXA 4GKKJ 3TARA 4C8LA 1RWWB 1TR0A 2ZKTA 2NCKL 4RNNA 3MPYA 1DFDA 5AJ3F 2G13A 3Q8UA 5L1LA 1I5OB 4QZVB 4HTIA 4X2BA 3FJ2A 4ZP8A 4LBIA 4OIXA 2HFNA 4F3MA 5FIIA 1JLEA 1L5UA 2E29A 4MFBA 1SL2A 5KFCA 1FFSB 4FNHA 2HWIA 4WFBQ 2GJ2A 3DMJA 1D9DA 5B08A 1F0XA 2VA2A 4HKQA 5CZXA 2CVIA 2H5EA 5DDRC 2OD6A 2XMUA 2DNRA 2GVZB 2MQOA 4QIFA 3MEGA 4FN5A 4OJHA 2F65A 4X66J 5A8KA 1FK9A 3PJXA 4AL6A 3QGPA 5BXIA 3VAMA 4ZS6A 4QWBA 1YX2A 3UI3A 3M4XA 1KRPA 3M2RB 4PG6A 3RG6A 4OHXA 1GMUA 1XN9A 3NGTA 1A7GE 2DH8A 2Q3PA 3UNYA 4PG5A 2ZH5A 1J5EF 2QLFB 1R0BG 2B43A 2E5HA 3IO1A 2PIIA 1SC1B 1YJVA 3KJFB 1T9XA 3I0RB 5HL7Q 2K1RB 3FRZA 1RWKB 2AF6A 5H9EK 2HLTA 1L3KA 3BDEA 4MKVA 2ERRA 3JSYA 4DXLA 3M30B 1VR6A 2GZOA 3DOMA 4ELTA 4JB8B 5DM7Q 2E7VA 1LQ9A 4JI8F 3LGNA 2OMOA 2EFPA 3D0HE 4NXNJ 1APSA 1YSJA 2DNKA 2OSQA 2FJEB 3H40A 3QWPA 4FXDA 3GG0A 3KLFA 1FX2A 5F8GA 3OLAA 2BJ1A 2N82B 3OW2R 2BJDA 2JX2A 4OI1A 2VBXA 3FMWA 2BJ8A 2HHVA 1TKXA 4ZVQB 1HBNA 1LWFB 1QSYA 1GX6A 3F0NA 3MM9B 1LW0B 3TYTA 2R8JA 3FK4A 1IM6A 4ZVUB 2G4BA 3W5XA 4X4NA 2J8SA 4JOUA 2HRYA 4Y34A 2VL1A 4Y2CA 2CZ4A 2VBWA 3QLHA 3DOLA 5CABA 3E2EA 4AYBD 1JLAA 3PG9A 4CI0B 4OJ1A 1LFWA 4QWDA 3D3CJ 4KC5A 1U1QA 4KPYA 1U25A 3Q24A 2HK3A 3MAAA 2HNDA 4QR2A 4YB5A 1TMJA 4ECUA 3IRXA 2ZDOA 5GAEI 1YZ6A 2DT9A 4L6V3 3CD5A 1F9HA 9ATCB 3D6TB 2VFUA 4WF9Q 4OYIA 5ETTA 2LCWA 3FZ2A 1C0UB 4BCAA 3GTYX 5HVFA 4CQ1A 4CO5A 4DL3A 5F3TA 4F4XA 4NYOA 2LQJA 3TWZA 3KK3B 1S0MA 1KD1T 4LRDA 5JUMA 1FFGB 4PKDB 3H59A 2LFVA 3DC2A 4NLUA 3C6TB 4DU7A 1HHTP 3DDKA 3PW5A 2Q79A 2ZZNA 5HANA 1ZTWA 3KLIA 2XNQA 4OZ5A 3QGGA 4CLUA 4IRDA 2RVJA 1CEZA 2MTLA 3ZTRA 2P9CA 3KJVB 4M5GA 2MGZA 5D0RA 4XO0A 2BM0A 2QA2A 4WIQA 1HNIA 2WB4A 2XSFA 1S97A 3CC7S 2RNEA 4G6VB 2B9YA 3WX4A 4HDHA 1PGZA 5I42B 2IHR1 1FVSA 5MAOA 2V50A 1RB0A 3GU0A 4E98A 2Q1LA 1HMVB 3FGVA 2E5GA 2FC9A 2WVCA 2VFRA 3OPKA 3QGIA 4AQYF 3DXSX 5A0YB 4FF4A 3RUBL 4LIWA 1YRTA 4QWCA 4WE1A 2DNPA 5EUHA 3NCPA 2CJQA 1A6LA 3PFOA 3LO3A 2BKPA 1R8PA 3JSRA 1RT2A 4IR1A 1T05B 3BR9A 4A8WA 3LGMA 2VPWB 2MZ1A 1J5OA 2VC1A 1NPRA 3T1YJ 3JSMB 2X51A 1U1KA 1Y00A 2RF2B 1IVZA 4YEAA 3PFEA 2FJXA 2CNOB 1NSAA 1AW0A 1RT7A 3GYGA 1U09A 3ZXWA 3AT1B 1RABB 2F1FA 2OPRA 1RE1B 1FE0A 3M8SA 1DQAA 3DLGA 2E7XA 5M2UA 3EPGA 1YJNS 2I38A 3KMQA 3ETMA 4DV5J 3CIZA 4USHA 1VGYA 3O1LA 5EWFA 2JVOA 4LR9A 4W98A 3QYYA 4F7VA 4DR3J 2UXBJ 1SUQA 2W4DA 2J6UA 3PYFA 4DQSA 4F2RA 2W4CA 3NY0A 1KQKA 2BABA 1S7HA 1H7XA 3C6UB 3JQMA 5KG4A 3OUYA 2MHNA 4OFZA 4LBPA 4HI1A 5LT5A 5BYSA 2A0FB 4X4UA 2BE7D 1U6FA 2KHCA 3CJ3A 3QFWA 3EGVA 4DQQA 1B0TA 3BSOA 3D54A 5DS7A 1RXOB 4C9DA 3AODA 2NYHA 4C0OC 4QYZK 1RCXB 2Z30B 1RYRA 3EE3A 4OYPA 4IO9Q 2MHEA 3FMBA 1HBOA 1QUPA 2KFNA 4DV1F 4QU6A 5DZ7A 2AYMA 1KSPA 2VQEF 3W5YA 4OYWA 4O3OA 4ITSA 4RO0A 1EP4B 2WTFA 4O4RA 2MKIA 4RBTA 1Q7YT 4JBCA 3V2UC 3VGTA 4CCHA 1YJUA 2XS2A 2AJ2A 2FLNA 2UVUA 2ZKUA 4LF5F 4ICLB 1Q53A 4N8NA 3F41A 1AFJA 4EWTA 3PEJA 2GQ2A 1H72C 1SH0A 4HI2A 4UT4A 3CIMA 4DR1F 4B02A 4C0BA 5KOWA 2FLOA 1K44A 1UMJA 4NLWA 3THPA 2CUYA 3BM7A 1PJ6A 1PO6A 3S8SA 3IMQJ 2RHQB 2MKKA 2UUBF 4TYBA 2RS8A 1YDLA 2D3ZA 4QPTA 3H2VE 1Q79A 1IR2A 3AOAA 2K8GA 5J2NB 1KVJA 1UPMB 5A76A 4NLTA 2KXNB 3DLEB 3H98A 1N5YA 2OKQA 3SQGB 1ZA1B 2VZ9A 3J80Y 1QE1A 3BO3A 3A13A 3MAHA 1UEKA 4YQWA 1P9YA 4TU8A 2F4FA 2Z2ZA 4J9OA 1N32F 4RX6A 4LF2A 5EWGA 2HIQA 1VQSA 2B4OA 3WQPA 2E1MC 2E9ZA 4Q8EA 3E51A 4DPXA 4RW9B 1IBMJ 2CNNB 5HVHA 3I82A 1SL0A 5AXLA 3DXBA 2DEJA 2GV1A 2AQ4A 4CLFA 4DFKA 2DBBA 4HHUA 1OY8A 4ZJOA 4FF1A 4M5MA 1EZZB 2CQGA 4WFAQ 1T9VA 2DO0A 2YKMB 3HKWA 5KT2A 1UA1A 4DJBA 3HHLC 3EZOA 2BE2B 3IGNA 5F0WA 4IR9A 2HRTA 1UKUA 3OSPA 3JB9k 4M5IA 3FCVA 3EYZA 1UPPA 1IKWA 1TFYA 5FDLB 3N5FA 4DV2F 2HG4A 4YOEA 3TZYA 2YWFA 4WK1A 8ATCB 4DPWA 4NI2B 5HP1A 3VVUA 3TW0A 2V63A 2VPXB 3SCLE 5BYQA 2HIYA 2DNLA 3QATA 3VQTA 2MB0B 3S7RA 1GQEA 3CUNA 4DN9A 2M3DA 3KUHA 1HNVA 2KU7A 1VQPS 4I2PA 3EDQB 3EGWB 4AL5A 4LFAF 4O3NA 4MKYA 2UV8G 1HQUB 4X62J 3KNGA 3DLHA 1Q0NA 4J90A 3H25A 3PRVA 1G6BA 1F9FA 1WKLA 4DR6J 4W90B 1XWLA 1URNA 2CPDA 3DU5A 3KLEB 1J27A 3A3OB 4L72B 3IBCB 3KKFA 2CJ9A 2Y1IA 1WACA 2WVEA 3VWSA 1I94F 3K89A 1RHMB 2H5JB 1UVKA 2XS7A 2F4VF 1GXLA 4IOAQ 1K0TA 1HPZB 3G8TA 1S1WB 5GMKa 1QSSA 1U8SA 1OJ4A 4MYTA 2QX0A 4B3SF 2IJNA 5KG2A 2H48B 4M5LA 1QAXA 1R8HA 2K7KA 4JV5J 2XB2D 4UF4A 1DZ5A 3FNNA 4BS2A 3M32B 3MM5A 1Q95G 4ZJLA 3HZGA 5GADU 2AW0A 3OL8A 3BGOP 3A8JA 2RKIB 4WYWA 4ZCKA 2XS5A 1BC6A 4WPAA 2Z56B 3F56A 3UDEA 2K7JA 1TL5A 3WHIA 1H6KX 4OLPA 3V4MA 3R2CJ 2EEYA 1WTBA 1FERA 3M8QB 1RTHA 1RAEB 1EHWA 2BYCA 1R89A 1DTQA 3CO0P 1EKSA 2WBRA 3KG0A 1NSQA 1RTJA 3JTOA 3I32A 3SI8A 1S6PA 2C2ZB 1WC1A 1HI8A 4ES1A 3M8ZA 3RB6A 4DN0A 3B78A 4FYDA 3LALA 3PKYA 4RNFA 1UETA 4OV1A 3LPEA 2UUTA 1QUVA 5E2QA 4ID8A 3P5BP 5D78A 4RR5A 2I8EA 3HSZA 4LF6J 3JTNA 1HQ2A 3UN5A 2M70A 2D74B 1NEEA 1CJVB 3GYXB 4B3TJ 2NREA 4KTQA 1IKVB 3HHLD 5GAHI 4KGZB 3GZ7A 1V3RA 3EM1A 5A8RB 2EKYA 3I0SA 2CG4A 2UXDJ 2DY1A 5DDQC 4DLGA 3BKTA 1KBRA 3HHDA 3WIVA 3SSSA 3CJKB 1RTIB 4M5DB 5FLXY 1IN0A 5KFUA 4FP9A 2G0JA 4ETXA 2CPZA 4DR7F 1V3SA 1OO0B 1LK5A 2YPZA 4K4YA 3BQ0A 5C42B 1FJEB 4QQBA 4IG3B 3VAJA 2MY8A 4OYZA 2R8KA 3PKMA 5J2MB 2OELA 1VRTA 2M2BA 2BOAA 1U2FA 1S99A 2MQMA 4ZVHA 1PILA 1HLWA 2LU2A 4UUXA 1JWWA 2Y3YA 3Q8SB 3U7JA 4R25A 2UU9F 4ZK7M 3GIIA 2OMLA 2ZH6A 1NH8A 2WB1D 3TVKA 1QLNA 3DM2B 2HSEB 3A1YG 4EI2A 4FVMA 5D15A 2RDJA 2AGPA 3MOJB 2Z58B 1Z1ZA 4NRUA 2HHHJ 3P5TL 1WEXA 1DLOB 1U7LA 2RT3A 1NMEB 4FXVA 1PYOB 4CTAB 4J9VA 2GJFA 3ZNUA 1S6QB 2KG1A 2XWYA 5DJBA 1X4AA 5J1PA 3HSJA 5HQ8A 1TL7B 5B7WA 3ET6B 3NOGA 2NS1B 5HMZA 1NDPA 1U47A 2CJBA 2QA4S 2ZUGA 4YHHJ 4ZA1A 2OPQB 1ULRA 4YN3B 2CKWA 2PMHA 1NJXA 2M5YA 3CTRA 1ZM2A 1KR4A 3D1HA 4DZDA 1GTEA 2XTJP 1LWCA 3HVWA 3K5PA 2A1BA 2HFSA 3NMAA 3QJPA 2R9LA 4YB7A 4DR5J 1DAXA 5E33A 1TL3A 4RUBA 2AMCB 4OI6A 1HW9A 2UVVA 3I9ZA 5KOXA 2G2OA 4ED2A 5IFMA 1VQ4S 4DV4J 1S0OA 2LQ9A 4CNYA 4RPFA 3MDFA 4K59A 1U1LA 5CYQB 3Q89A 2ZZTA 3W2VA 5F9LA 2ZEJA 1EQMA 5IT0A 2ZH3A 4IFVA 1LOUA 3I9V9 4YS2A 4QIGA 2Y9HA 2VDIA 2N7CA 1JIHA 4ZVFA 3CCRS 4DSFA 2C2NA 1FNOA 2Z2MA 2FJDB 2YWGA 3D2WA 4EO8A 1N0UA 3H7HB 3C16B 5D3GB 2AX0A 2Y1LB 5J2QA 1CJUA 1NK5A 1KQFB 1Q8BA 2JFKA 5ETOA 2CFXA 3LANA 2PA8D 2YQ3A 4ZCMA 2EPIA 3VF0B 3KLVA 4B17A 3IS9A 4JI5J 2CXEA 5C25B 3V6JA 1FKOB 4B9UA 1VJWA 4LF8J 4C2MA 1TL4A 4ZPCA 4YDXA 2FHJD 4HYKA 1GMWD 4HH0A 1FEHA 4E8UA 2R7SA 4K4SA 1FDBA 1REGX 3BGRA 3EUNA 4JI1F 5KFXA 3HJVA 1S10A 2C2DA 4IRKA 3MURP 2XNRA 2C3YA 4OYXA 3T9ZA 3MPUB 4DBQA 1GNKA 4USTA 2D3O1 1NLKL 4RNHA 1PKUA 5E3QA 1M5HA 1ZZFA 2B6AA 4DSKA 2QJ3A 2DGQA 2ZM6J 1E6VA 4IYQA 4YUDA 1IWAA 3MM6B 1S4FA 3N4WA 4DS4A 1QVGR 2O3DA 3OFFA 3BSCA 2WSCC 3TX8A 1TKDA 1WWHA 9RUBA 1Y5NB 4LIRA 3R97A 1MWYA 3PW4A 1O8BA 5ETKA 3CCTA 4EMDA 4RKUC 5G0RA 2LEBA 2L3MA 2WW8A 4ECZA 1ZZNA 5IZHA 2YH1A 2R2RA 2HGNA 1DBDA 4HL9A 4WIIA 1Y7PA 1H73A 1UWBB 3FSIA 1JK9B 4ZVTB 2BUNA 4ES2A 2MPUA 4DG1B 1EB0A 1RU2A 3C15B 3P45B 3GG1A 3ITHA 1RWXB 3W2WB 3OQ2A 2ASLA 1N4LA 3NMRA 4OYAA 1IUJA 4TNOA 4RU2A 3TRGA 4O44B 1NDCA 3CJ0A 2ZBIA 4ERDA 4KB7A 3NRBA 1NJIT 1S9GB 4OI4A 3MEEB 4DUYF 2HBQB 2DCUB 4NPOA 2FDNA 3CDEA 2B4VA 2DNNA 2KYZA 2HBRB 5IS2A 4PUOB 3SSRA 3QQCD 4F02A 4ZLLA 3W65A 3GIMA 4WTYA 3J7A1 1D0EA 1KLMB 4KHPF 4LVNP 3IR5B 2RH3A 2GIQA 3RW6A 4NLQA 2Y0SD 5H9EJ 1BHNA 2AIRB 1KN6A 2LQ5A 3RZAA 1X60A 5HJYA 1FRHA 3BS9A 2WRMA 2DYAA 4WYLA 2FJAB 4PXDA 3RAXA 3P3DA 1YIJS 2C22A 5BYRA 3N6NA 3DLJA 5LSRA 1CJKA 3MMBB 2VASA 3UO0A 1C1BB 5IXUA 3NNHA 4N76A 4OZ1A 1LW2B 2E5LJ 1X4FA 2A6MA 2JC1A 2FHJA 3MFHA 3PHTA 1FXLA 1GMWA 3CJSA 5IQQA 2IM3A 4X4OA 4EYIB 2QEXS 3QGHA 4RW7B 2P5VA 1FD8A 1OWXA 4LVOP 4AUKA 2R7VA 2EBEA 1YITS 1NH7A 1HW8A 4OHYA 1PCAA 4P71A 2OJ3A 3SSQA 2XYHB 2R4FA 3OSNA 5KFLA 2E66A 2QIFA 1TUWA 4NX9A 3K7RA 2KVQE 4ECTA 2R2SA 5IM0A 4AE5A 4L3KA 1RLDA 2VU5A 3PIOQ 5IT9U 1Y5IB 3NGUA 4TU9A 3U1MA 3QT7A 4EO6A 2IAJB 4U67Q 3ONQA 2RHSB 5LMUF 1RKJA 2HMIB 2M0GB 4USUA 4DX5A 2XQCA 4C6AA 5ITHA 3UCZP 3HT0A 2H9ZA 2WW4A 5I4MA 1R0AB 4NA3A 1VQ9S 4U7CA 3DRRB 4A8KA 3UN3A 2YNGA 3BYRA 5HROA 4FS1A 4TYAA 2POKA 3LP2A 5DETA 2VD3A 3DOKA 1X4CA 3AXKA 3OL7A 2KKHA 1YLXA 4PG7A 4Y0FA 2DIUA 1BQMA 3IG1B 1CJTB 2NZ4A 4K2JA 1WF1A 2J6SA 1JNRB 3H5UA 4H4KC 3W66A 2VFSA 4OJ3A 3UD5A 3CCMS 2PEHA 2LEAA 2V69A 3QAUA 1UEVA 3Q8RB 2RILA 2FPHX 4WFXA 4ZCLA 1WHXA 2V68A 2YNHA 3H42A 3U27A 4Q0BB 2OSRA 4IFYA 1V9OA 3H5YA 1RWNB 1P6TA 4F0KA 1VLOA 1SC4B 4GKKF 4QWAA 4RW6B 4F26A 4AFFA 5CAAA 4I2QA 1BUXA 3OT9A 2RRNA 3VV2B 2QMXA 2U1AA 1VRQC 3POTB 2KHDA 2E1AA 3D5MA 2C28A 3DYAA 3KG4A 2YNFB 2X1BA 1ZS6A 2BXJA 5DG7A 5KFEA 3TA0A 2GO9A 2MLYA 4GMKA 4D3HA 4B9SA 3QO9A 4ZJQA 4I4BA 1U45A 4QWEA 5I3UA 2X1AA 3T5KA 4NRTA 2JC0A 3SV4A 1QY7A 4WZQA 4NA2A 1F3FA 3GCWP 2HHQA 2M52A 2R7RA 3R5DA 1WF0A 4GO7X 2PMWA 4C3LA 4X66F 1I51B 2HVDA 4F4WA 1FNMA 3K5NA 2ZH9A 3FDSA 3JYTA 1NK4A 1NHVA 4I6WA 3QIPA 2VG5A 4H4MB 2HHPA 2KN4A 4JI2J 1M90T 1HWLA 3OR2B 3G4SS 3QT5A 1B0PA 4Y2MA 1IXKA 4IH6A 3PRDA 3BBFA 2P9GA 2UVWA 3IGVA 2KT3A 2D1CA 1F2HA 1TL1A 4J9KA 2M8HA 2O5DA 3W62A 1RUSA 5B0AA 1EJ7L 4KH0B 2CPHA 4USVA 2GS8A 1RWOB 2C2MB 2NPIA 2MQQA 5KFAA 3WBZA 3ZC4A 3UD3P 4RNOA 3J81U 5KFNA 2VKZG 2FVSA 1WEZA 4NXNF 1YJ9S 2NZCA 3HF5A 3NGRA 5LXRA 1S1TB 4P6QA 3MMAA 2V8GA 2QSWA 3DHWC 3OTDA 1E6YA 3HT3A 4FYVB 2IC3B 4NLYA 2ASDA 3C6UA 1K0VA 4LQ3A 1U4BA 3LP1A 2DGTA 1ZPWX 1KFDA 4LFCJ 2M88A 1S49A 3H0PA 4N7TA 2Z4PA 4Q5VA 4DL6A 3UNGC 1KLNA 3M1VA 3NKYA 1NAQA 2ZE2A 1IQTA 1ZBTA 3SCIE 4LSZB 3P6YC 1WDDA 1X9WA 1VBYA 5D8HB 4DV6J 4XTTA 1IJEB 4C8OA 4C8MA 3CCLS 2BV3A 2BMBA 5JXSA 1M5KC 2FJVA 3DN9A 2R8GA 4QBUA 1RP5A 4MYUA 5KFRA 4UQGA 1BE4A 3L7OA 1RLCL 3VTIA 2W2NP 3H5SA 5BR8J 1VIOA 3T1HJ 2H3EB 2VG6A 3PO5A 2WHOA 1NZ8A 4M63A 2R8IA 1XK8A 3VVTA 2ZH8A 3G6XA 3SQOP 2DGUA 4X65J 2O66A 3HHNB 1MNEA 4UY85 2KXFA 1EAYC 1PYTA 3Q8VA 1NDKA 3TUJC 4M5KA 1UTAA 4LR8A 4OI2A 2XMTA 4K4UA 3ZTQA 3KNAA 5KFSA 1U0SA 2HNZB 5L1KA 2ZOMA 2RU9A 3T5JA 1WC0A 4CH7A 4NCAA 4F25A 3TP2A 3BJYA 1S1XA 1S9FA 3SCJE 4DX8H 1ZM3A 3KTQA 2R7WA 4RW8A 4X4QA 3ZZ0A 3W9HA 4KV8A 1U0HA 2DRBA 1MN9A 4ECRA 4YDDB 1WELA 2L08A 2JZ5A 3CCWA 4O4GA 4UOCA 3AOBA 1RKIA 2HS0A
chains in the Genus database with same CATH topology
1HL6A 1X4BA 2CPYA 5HMYA 1O0PA 1NK9A 2IM1A 3IS9B 1XNQF 3IWXA 1MMLA 2F1FA 2OPRA 4NCGA 3IAM9 3Q2SC 1O51A 2O01C 3MOZA 3W3SA 2RQ4A 4TY8B 5CYQA 1TK0A 2MXYA 1YHQS 5F8JA 1FE0A 4X65F 1VK8A 3QLHB 3M8SA 1S9EA 2UUWA 2IM2A 1DQAA 3DLGA 1LWEB 3GR0A 5CYJA 2E7XA 2GMHA 3ENQA 2B4PA 5M2UA 3EPGA 1VC5A 2E1CA 1T94A 4CH0S 1ROFA 1Y3JA 2GIRA 3UWTA 4RUHA 3BGRB 2Z8QA 1YJNS 4FXWA 2I38A 1FRIA 1ZETA 4GC6A 3KMQA 4XK8C 2EFGA 3KOAA 1YWXA 1VOMA 3HVTA 4WXWA 2LLZA 3CIZA 3RTVA 4USHA 2VFTA 3DGPA 3E3XA 1VGYA 2C3OA 4IQXA 2YWEA 3KWMA 2E7WA 3HZEA 3K5MA 3O1LA 1H98A 5DM6Q 2JVOA 5EWFA 3L09A 3L3CA 5D3GA 3C8YA 3AA9A 2ABYA 1KFSA 3QYYA 4LJMA 4QU7A 1SUQA 2W4DA 5KG1A 2HQIA 3KG1A 2J6UA 1UFWA 1SJ4P 1MMNA 4DQSA 2I9SA 3ISZA 3J7YU 2CPFA 3GV7B 4F2RA 1CPZA 4K4VA 3BB5A 4ZP9A 2FHMA 2W4CA 4ZDNA 4CO3A 3T1YF 3CCZA 2VPZB 1OSDA 5LJ5Y 1F60B 5KFGA 2CPEA 2QFJA 1E6VB 4C97A 1KQKA 4J9NA 1NK7A 1H2VZ 2BABA 2ZVSA 3CD0A 4O3PA 4M95A 1S7HA 5C25A 1G1XA 3OXGA 1FKOA 2GHPA 2AJQA 1H7XA 3C6UB 3OUYA 1KOOA 1JLQA 1R8CA 5KG4A 2ZHAA 4G1QA 3NWGA 2WONB 3S1TA 3X1LB 2MHNA 4OX6A 4BHQA 2KTQA 3CCES 5D77A 4OFZA 2JDJA 3PW7A 3N9UC 2HWTA 3THVA 1XERA 3AB4B 3M8PB 4Y6IA 1S1VA 4TU7A 5A2QY 1VI7A 4NLXA 2QYCA 3ULHA 4HI1A 2PA3A 3EXYA 5LT5A 3EXCX 1WD6A 3DLKA 4C4WA 5BYSA 5HO4A 2OPPA 4K4XA 1JKHA 5G0RB 1HYSA 4X4UA 1U6FA 1IKXA 4H4KA 4H54A 4C3KA 1TZ0A 4PWDB 1RTDB 4PQUA 2KHCA 2MMYA 1CG2A 3PV8A 1RWUA 3CJ3A 2ADCA 1B64A 2BRLA 3M2UA 4X4PA 4DQQA 1B0TA 1G3OA 1OSCA 2ZOFA 3BSOA 1X4HA 4NZ6A 3D54A 4WFNQ 5DS7A 4I68A 1HBUA 1R6YA 1CVJA 4C9DA 5CXTA 2ZD1A 3DRPB 4IKAA 4ED7A 5GAEU 2HHWA 3Q22A 4C0OC 1QM9A 3CJ2A 3KHLA 1RYRA 2V9WA 4IO9Q 1J5OB 4DV5F 2CJKA 2MHEA 3KK2B 1TFWA 3FMBA 3FZBA 1T8EA 1T7PA 3QIDA 1HBOA 1RISA 4YB1P 3MM6A 2ZNYA 1QUPA 2KFNA 3CJ5A 4DV1F 3KHRA 1VBZA 4QU6A 2CPJA 2HNYB 1RAJA 3BGFA 3IXQA 2KYXA 2DNZA 3M6UA 2AYMA 4K5SA 4DR3F 1UW4A 2QT7A 3HO1A 2UXBF 3ITHB 1KSPA 2VQEF 2JFDA 4N56A 5JVGQ 4O3OA 4ITSA 3SV3A 1EP4B 2HZCA 2W9CB 2AD9A 2WTFA 4PPDA 2AYBA 2DH9A 4O4RA 1JLBB 2MKIA 2YVSA 4RBTA 4I69A 1N6QB 2PC6A 2WCXA 1Q7YT 1Q86T 2F7VA 2J9DE 4JBCA 1LKZA 2IA6A 5DDOC 2J6TA 3V2UC 4O3RA 4RZRA 4CCHA 4EBDA 2HHSA 2F8MA 3D0GE 2EK6A 5M2RA 5K8NA 1YJUA 2XS2A 5KAKA 2FLNA 1NK8A 4WJBA 2G9OA 4C7QA 1N5TA 2UVUA 2ZKUA 4LF5F 4ICLB 2OIHA 1Q53A 3E01B 4N8NA 2I5JA 2A10A 3F41A 4EWTA 3SEOA 4F2SA 2W24A 3RRKA 1AFJA 3PEJA 2GQ2A 4NZ7A 3V5RA 4X64F 1SH0A 3KLEA 5GADI 4HI2A 5F8LA 1KNZA 2E5IA 2PD1A 3CIMA 5B0EA 4XPCA 1C1CA 2A3JA 1S1UB 2ASYA 4FPRA 1WHVA 4DR1F 4B02A 1SH3A 3SDEA 4C0BA 4ZHRB 4N77A 5KOWA 2FLOA 4KR0B 2YKOA 2PE8A 1ZM9A 3HHKA 4Q43A 1VK3A 1UWBA 4FZVA 4YY3F 1UMJA 2WOMB 2MSTA 4NLWA 1F5AA 3THPA 3VZIA 2HHUA 2MSSA 4DG1A 2YKPA 3BM7A 3PX6A 2F3JA 1RT1A 1LXNA 3TA1A 4F67A 1PO6A 2BDPA 2HS4A 3S8SA 3K59A 4KFBA 3CSKA 2W9BA 3T6BA 1T03B 1YRUA 2VB6A 3W2WA 4X4VA 2RQKA 3W7BA 2UP1A 5J2PB 3MECA 4UQTA 2UVRA 4KIAA 2R7TA 1NB7A 2R2TA 4DDFA 2JOQA 2MKKA 2JEFA 1Q1KA 1Q81T 2UUBF 2IVMA 4TYBA 2RS8A 2YKNB 2FY1A 1FCAA 3C46A 3UPFA 4RUAA 4O44A 2KRRA 4ELVA 2JSXA 2D3ZA 4NLDA 1CSJA 4QPTA 1K8AT 3EZUA 3H2VE 1Q79A 4KE5A 3M32A 1Q16B 4ZOSA 1JB0C 3TUZC 1FDAA 2K8GA 5J2NB 4CH1A 1FJ7A 3CEDA 1KVJA 2FUG9 5A8WB 1S9GA 4DL7A 1K73T 1TUVA 2CQIA 1IJFB 4NLTA 1SJFA 2VKRA 3RU0A 3MEEA 3AA8A 2KXNB 3DLBA 4NXMF 3DLEB 3H98A 1N5YA 5H1SV 1IBLF 1MWZA 2OKQA 3SQGB 4B9VA 2VZ9A 4DV7F 2DCLA 3ETOA 5C24B 1N56A 1RT7B 3J80Y 4PUOA 1QE1A 4PR6A 3BO3A 2WSEC 1VQ5S 5EDWA 1H7WA 2ASJA 3L95X 3I56S 4N47A 1IKYA 1ZZNA 3MAHA 2ZBCA 2V9KA 4MIAA 3BQ2A 2XMMA 4YQWA 1RK8A 4ECSA 1JLCA 2CJAA 4YP3A 4OX9F 1S6OA 4TU8A 3HJFA 3TANA 1KLMA 3ENVA 4B9MA 2B9XA 3M2VA 2W25A 1JLGA 2YX1A 4B3RF 2D9PA 4J9OA 2XG8A 1EETA 2MQLA 1OQ6A 3BR8A 1T3OA 3ZZOA 1N32F 4RX6A 1XTZA 5EWGA 2HIQA 2JEGA 1VQSA 2B4OA 2XULA 4EEYA 4DSIA 1DJ0A 2E1MC 5DQIA 2XO7A 2E9ZA 4Q8EA 3QMQA 2V4JA 3E51A 1JXEA 1VRUB 1Q8LA 1NJWA 2RMLA 4RW9B 3VZHA 1SJRA 3I55S 3HX9A 3CDWA 3HHLA 4QIWD 3OBIA 3K5OA 3I82A 4LSNA 5DLGA 2OH2A 1SL0A 2RSQA 2CQBA 4K5RA 5AXLA 1REVA 2O1PA 5D4PA 3DXBA 3AJ1A 2MJUA 3MMBA 2GV1A 3V81A 2NSCA 1G2EA 4MJKA 2VG7B 2DPJA 2AQ4A 1FESA 1HBMB 3CDAA 3O2IA 2ZC3A 4DFKA 2BQ3A 2DBBA 1RT3A 5F41A 2OTLS 2JEIA 3FFIA 1SUQB 1C1BA 4TQSA 2CIMA 4FF1A 1UL3A 4KAIA 2AJ0A 4WKYA 2MYFA 5T7LB 2DNQA 4OHZA 3V6DB 4F4KA 2CQ4A 4EZ9A 4YR2A 5IM0B 4ID5A 4JV0A 1QAYA 2LXUA 2PI4A 1U48A 2XY6A 2CQGA 4WFAQ 1LW2A 1SI9A 2M7SA 5KFTA 3BSAA 2JL9A 5E3AA 5KFHA 2MKSA 1RGVA 2DO0A 4NLRA 3UCUP 2HWHA 4G1QB 4RUCA 6FDRA 4J9LA 2YKMB 3HKWA 1LV5A 5KT2A 1XMBA 3MM8A 1UA1A 3H5XA 2DGSA 4DJBA 5A6PA 3OJUA 4DSJA 3NCRA 3HHLC 4FBUA 2BE2B 4MKAA 1R43A 3HVAA 2F8EX 3OHBA 4YR3A 3RAMA 3GIKA 3JAMY 3VAFA 3IGNA 4C8KA 4I6YA 5F0WA 4IR9A 5KT6A 1CLFA 3DLKB 2RQMA 5IT9Y 4HT7A 4B3OB 3SCKE 1UKUA 1M5OC 3OSPA 3KYLA 3JB9k 4ZPDA 1X0FA 3TNVA 3WC2A 4BDPA 1FDNA 3EYZA 3UD4P 1IKWA 1TFYA 3CD7A 5T14A 5FDLB 2GQQA