2M4YA

Rubredoxin type protein from mycobacterium ulcerans
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
b'MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Structure of Rubredoxin type protein from Mycobacterium ulcerans
rcsb
source organism Mycobacterium ulcerans
molecule tags Electron transport
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m4yA00
1H7VA 1RDVA 1BE7A 1CADA 1R0GA 1RDGA 1FHHA 1S30A 1T9PA 1QCVA 2QL0A 5AI3A 1IROA 1FHMA 2GMGA 4K9FA 1LKOA 4YWLA 2PYAA 1LKMA 1RWDA 1C09A 2K2DA 4AR6A 1RB9A 1S2ZA 3KYXA 1R0JA 3RZTA 6RXNA 1QYBA 1R0HA 7RXNA 4ME3A 1R0IA 2M4YA 1DX8A 1T9OA 1BQ9A 3KYYA 1SMMA 2KN9A 3RZ6A 4AR3A 1E8JA 3MPSA 1IRNA 5AI2A 1B13A 2HR5A 1BQ8A 3A44A 5RXNA 3KYUA 4YWMA 2KKDA 1RYTA 1BRFA 2PVXA 8RXNA 4POFA 1SMWA 1JYBA 4AR4A 3KYWA 3PWFA 1IU5A 4RXNA 2RDVA 3SS2A 1R0FA 1NNQA 2PVEA 1CAAA 1B2OA 1B2JA 1YUXA 2VL6A 3RYGA 1VCXA 4TPUA 1BFYA 1S24A 4AR5A 1YK5A 5IY0A 1SMUA 1IU6A 3PZAA 1DVBA 2DSXA 4POGA 1LTLA 3QVDA 2LCQA 1YV1A 1LKPA 1YK4A 2V3BB 3KYVA 1B71A 2MS3A 1YUZA 1T9QA 1ZRPA
chains in the Genus database with same CATH superfamily
5C4JL 2A6HD 1VZGA 1T9PA 3WWNB 1P7PA 2XJUA 4BY1L 4K9FA 5JVG1 3S1NL 1R9TL 1LKMA 4LHNA 4U671 2JA6L 1K83L 2K2DA 5FJ8L 2E2IL 3P2AA 2AUSB 3KYXA 3RZTA 3J7Z1 1Z92B 7RXNA 3I4NL 5M5WL 2XJRA 2CKCA 2EY4E 2XJSA 4Y7NL 1DX8A 3HAXC 4AI0A 1OWBA 3PIP1 3H97A 1NXGA 4A93L 2A6ED 4XXBB 4YWMA 2KKDA 3HJWB 5EIOC 4AHZA 5GADc 2JI2A 5M3ML 3S15L 5IYCL 2L0ZA 3P8BA 4C3IL 1CAAA 4A3FL 3I4ML 3RZDL 4UY81 3S2HL 1WJVA 3HKZP 1QQTA 4BBSL 2C6AA 3LWVB 1YK5A 1SMUA 2PPTA 3PZAA 3LWOB 3H9BA 2M6OA 3GTQL 2DSXA 3H3VM 1I6HL 1LTLA 2XJTA 3FDJA 5C4XL 1LKPA 4AHYA 2A68D 2MS3A 3PKIA 1YUZA 2JA7L 3S1QL 5C44L 2NVXL 1H7VA 4X6AL 2AQCA 1QCVA 1TWAL 1IROA 2XJPA 5AI3A 1SFOL 1FHMA 2GMGA 4A3KL 1TWGL 1RWDA 2CKAA 4Y52L 1RB9A 1S2ZA 4A3BL 1R0JA 5GAEc 4AHXA 6RXNA 1R0HA 2HVYC 5EINC 4ME3A 2O5JD 2R7ZL 3HOXL 1T9OA 3PL5A 2R92L 4BXXL 3KYYA 1SMMA 2KN9A 4AR3A 3MPSA 5AI2A 2HR5A 4AHWA 2JA8L 3PIO1 1PFWA 2WAQP 2NVTL 4A3JL 4POFA 1IU5A 3LNLA 3HOVL 3LWPB 1RYQA 2XJQA 3SS2A 3H0GL 2PVEA 3ZG6A 1PFVA 5MGNA 1YUXA 2VL6A 3RYGA 1VCXA 3PO2L 1S24A 4WFN1 5IY0A 1IU6A 3GTPL 3IU3I 1DVBA 3QVDA 2LCQA 1YV1A 1I50L 3S1RL 3HOYL 3H99A 1F4LA 5M3FL 4G6BA 2V3BB 3KYVA 2V0FA 2VUML 5MFZA 3GTOL 2WB1P 1Y1WL 2E2JL 3HJYB 3S17L 4AI3A 1RDVA 1CADA 1R0GA 1RDGA 1FHHA 2A69D 3CQZL 4AI1A 1S30A 2J9UB 5MF6A 1VZIA 3HOWL 5C3EL 4YWLA 5IYBL 3S14L 4BBRL 2NYDA 1C09A 1TWCL 4AYBP 3B0AB 1TWHL 3LPEB 2Z3QB 2B5ID 4LHLA 2NVQL 4C3HL 1QYBA 5IP7L 5H1Sc 1R0IA 5FLML 1PZXA 3M3YL 1ODHA 1E8JA 2E2HL 3NFPI 1B13A 3FKIL 1I3QL 2H12A 5MFPA 2JI1A 2PSMC 2B63L 3A44A 5GAGc 4BY7L 2R93L 4A3ML 1RYTA 2PVXA 4A3EL 5M5XL 5DM61 1OWCA 1SMWA 1PFUA 4AR4A 3S1ML 3PWFA 4JADA 4RXNA 3GTML 4ZN3B 1NXEA 5IYDL 1NNQA 4A3DL 5JVH1 4C2M1 3MQKB 2BE5D 3LWRB 2AYJA 3HOZL 4A3GL 4E6YA 4XGHA 4POGA 3QQCE 2V0EA 5M5YL 2Y0SP 1YK4A 4C3JL 4A3IL 2ZIXA 4TVMA 2C6BA 2RFKB 1T9QA 1BRFA 1ZRPA 4JAFA 3S16L 1BE7A 3GTKL 3K35A 1TWFL 2JI3A 2PMZP 3J7Y1 2QL0A 5IP9L 3GTJL 1LKOA 2PYAA 1WCML 2ERJA 3S2DL 4GS7D 4AR6A 3MSUA 2M4YA 2JA5L 4QIWP 1BQ9A 1VZHA 3RZ6A 3RZOL 1IRNA 2ERSA 4V196 2CR8A 1BQ8A 3K7AL 2M6PA 4A3LL 5RXNA 3H9CA 2M4VA 3KYUA 4B8CD 8RXNA 4AI2A 1JYBA 3LWQB 1Y1VL 3KYWA 4JAEA 5MLC3 3GTGL 2RDVA 4ZN1B 1R0FA 4JAGA 3HOUL 4A3CL 3VPBE 1B2OA 1B2JA 3PO3L 1PFYA 4TPUA 3B08B 5DM71 1BFYA 4AR5A 2NVYL 1IW7D 2Z3RB 5AN9H 3M4OL 3WWLA 5GAHc 2APOB 3PKJA 2YU9L 2XJVA 1B71A 5K2ME 3GTLL 3JR7A
chains in the Genus database with same CATH topology
4JAFA 1H7VA 4AI3A 1RDVA 1BE7A 1CADA 2A6HD 1VZGA 3K35A 1R0GA 1RDGA 1FHHA 2A69D 2JI3A 4AI1A 1S30A 1T9PA 1QCVA 3J7Y1 3WWNB 2J9UB 2QL0A 5MF6A 2XJUA 1VZIA 2XJPA 1IROA 5AI3A 1FHMA 2GMGA 4K9FA 1LKOA 4YWLA 5JVG1 2PYAA 1LKMA 2ERJA 2NYDA 1RWDA 4LHNA 4U671 1C09A 2CKAA 4GS7D 2K2DA 4AR6A 1RB9A 1S2ZA 3B0AB 3P2AA 3LPEB 3KYXA 2Z3QB 2B5ID 3MSUA 4LHLA 1R0JA 3RZTA 4AHXA 5GAEc 6RXNA 1QYBA 3J7Z1 1Z92B 1R0HA 7RXNA 5EINC 4ME3A 2XJRA 2CKCA 5H1Sc 2O5JD 2XJSA 1R0IA 2M4YA 1DX8A 1T9OA 1BQ9A 1VZHA 3KYYA 1ODHA 1SMMA 2KN9A 3RZ6A 4AI0A 4AR3A 3MPSA 1E8JA 1IRNA 1OWBA 3NFPI 5AI2A 3PIP1 1B13A 2ERSA 2H12A 2HR5A 5MFPA 2JI1A 2CR8A 4V196 4AHWA 2PSMC 1BQ8A 1NXGA 3A44A 2M6PA 5RXNA 2A6ED 2M4VA 3KYUA 5GAGc 4XXBB 4YWMA 2KKDA 5EIOC 4AHZA 3PIO1 4B8CD 1RYTA 1BRFA 2PVXA 5DM61 8RXNA 4AI2A 5GADc 1OWCA 4POFA 1SMWA 1JYBA 2JI2A 4AR4A 3KYWA 3PWFA 4JAEA 1IU5A 4JADA 4RXNA 5MLC3 3LNLA 4ZN3B 1NXEA 1RYQA 2RDVA 2XJQA 3SS2A 4ZN1B 1R0FA 1NNQA 2L0ZA 4JAGA 2PVEA 3P8BA 3ZG6A 1CAAA 5MGNA 5JVH1 2BE5D 3VPBE 1B2OA 1B2JA 1YUXA 2VL6A 3RYGA 1VCXA 4TPUA 4UY81 3B08B 1WJVA 5DM71 1BFYA 1S24A 4WFN1 2C6AA 4AR5A 1YK5A 5IY0A 1SMUA 1IU6A 2PPTA 3PZAA 1IW7D 2AYJA 2Z3RB 3IU3I 2M6OA 5AN9H 1DVBA 4E6YA 2DSXA 4XGHA 3WWLA 5GAHc 4POGA 3QQCE 1LTLA 3QVDA 2LCQA 2XJTA 1YV1A 2V0EA 1LKPA 1YK4A 4G6BA 3PKJA 2V3BB 3KYVA 2XJVA 4AHYA 1B71A 2A68D 2MS3A 3PKIA 2V0FA 5K2ME 5MFZA 1YUZA 2ZIXA 4TVMA 2C6BA 1T9QA 1ZRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7V A;  1RDV A;  1BE7 A;  1CAD A;  1R0G A;  1RDG A;  1FHH A;  1S30 A;  1T9P A;  1QCV A;  2QL0 A;  5AI3 A;  1IRO A;  1FHM A;  2GMG A;  4K9F A;  1LKO A;  4YWL A;  2PYA A;  1LKM A;  1RWD A;  1C09 A;  2K2D A;  4AR6 A;  1RB9 A;  1S2Z A;  3KYX A;  1R0J A;  3RZT A;  6RXN A;  1QYB A;  1R0H A;  7RXN A;  4ME3 A;  1R0I A;  2M4Y A;  1DX8 A;  1T9O A;  1BQ9 A;  3KYY A;  1SMM A;  2KN9 A;  3RZ6 A;  4AR3 A;  1E8J A;  3MPS A;  1IRN A;  5AI2 A;  1B13 A;  2HR5 A;  1BQ8 A;  3A44 A;  5RXN A;  3KYU A;  4YWM A;  2KKD A;  1RYT A;  1BRF A;  2PVX A;  8RXN A;  4POF A;  1SMW A;  1JYB A;  4AR4 A;  3KYW A;  3PWF A;  1IU5 A;  4RXN A;  2RDV A;  3SS2 A;  1R0F A;  1NNQ A;  2PVE A;  1CAA A;  1B2O A;  1B2J A;  1YUX A;  2VL6 A;  3RYG A;  1VCX A;  4TPU A;  1BFY A;  1S24 A;  4AR5 A;  1YK5 A;  5IY0 A;  1SMU A;  1IU6 A;  3PZA A;  1DVB A;  2DSX A;  4POG A;  1LTL A;  3QVD A;  2LCQ A;  1YV1 A;  1LKP A;  1YK4 A;  2V3B B;  3KYV A;  1B71 A;  2MS3 A;  1YUZ A;  1T9Q A;  1ZRP A; 
#chains in the Genus database with same CATH topology
 5C4J L;  2A6H D;  1VZG A;  1T9P A;  3WWN B;  1P7P A;  2XJU A;  4BY1 L;  4K9F A;  5JVG 1;  3S1N L;  1R9T L;  1LKM A;  4LHN A;  4U67 1;  2JA6 L;  1K83 L;  2K2D A;  5FJ8 L;  2E2I L;  3P2A A;  2AUS B;  3KYX A;  3RZT A;  3J7Z 1;  1Z92 B;  7RXN A;  3I4N L;  5M5W L;  2XJR A;  2CKC A;  2EY4 E;  2XJS A;  4Y7N L;  1DX8 A;  3HAX C;  4AI0 A;  1OWB A;  3PIP 1;  3H97 A;  1NXG A;  4A93 L;  2A6E D;  4XXB B;  4YWM A;  2KKD A;  3HJW B;  5EIO C;  4AHZ A;  5GAD c;  2JI2 A;  5M3M L;  3S15 L;  5IYC L;  2L0Z A;  3P8B A;  4C3I L;  1CAA A;  4A3F L;  3I4M L;  3RZD L;  4UY8 1;  3S2H L;  1WJV A;  3HKZ P;  1QQT A;  4BBS L;  2C6A A;  3LWV B;  1YK5 A;  1SMU A;  2PPT A;  3PZA A;  3LWO B;  3H9B A;  2M6O A;  3GTQ L;  2DSX A;  3H3V M;  1I6H L;  1LTL A;  2XJT A;  3FDJ A;  5C4X L;  1LKP A;  4AHY A;  2A68 D;  2MS3 A;  3PKI A;  1YUZ A;  2JA7 L;  3S1Q L;  5C44 L;  2NVX L;  1H7V A;  4X6A L;  2AQC A;  1QCV A;  1TWA L;  1IRO A;  2XJP A;  5AI3 A;  1SFO L;  1FHM A;  2GMG A;  4A3K L;  1TWG L;  1RWD A;  2CKA A;  4Y52 L;  1RB9 A;  1S2Z A;  4A3B L;  1R0J A;  5GAE c;  4AHX A;  6RXN A;  1R0H A;  2HVY C;  5EIN C;  4ME3 A;  2O5J D;  2R7Z L;  3HOX L;  1T9O A;  3PL5 A;  2R92 L;  4BXX L;  3KYY A;  1SMM A;  2KN9 A;  4AR3 A;  3MPS A;  5AI2 A;  2HR5 A;  4AHW A;  2JA8 L;  3PIO 1;  1PFW A;  2WAQ P;  2NVT L;  4A3J L;  4POF A;  1IU5 A;  3LNL A;  3HOV L;  3LWP B;  1RYQ A;  2XJQ A;  3SS2 A;  3H0G L;  2PVE A;  3ZG6 A;  1PFV A;  5MGN A;  1YUX A;  2VL6 A;  3RYG A;  1VCX A;  3PO2 L;  1S24 A;  4WFN 1;  5IY0 A;  1IU6 A;  3GTP L;  3IU3 I;  1DVB A;  3QVD A;  2LCQ A;  1YV1 A;  1I50 L;  3S1R L;  3HOY L;  3H99 A;  1F4L A;  5M3F L;  4G6B A;  2V3B B;  3KYV A;  2V0F A;  2VUM L;  5MFZ A;  3GTO L;  2WB1 P;  1Y1W L;  2E2J L;  3HJY B;  3S17 L;  4AI3 A;  1RDV A;  1CAD A;  1R0G A;  1RDG A;  1FHH A;  2A69 D;  3CQZ L;  4AI1 A;  1S30 A;  2J9U B;  5MF6 A;  1VZI A;  3HOW L;  5C3E L;  4YWL A;  5IYB L;  3S14 L;  4BBR L;  2NYD A;  1C09 A;  1TWC L;  4AYB P;  3B0A B;  1TWH L;  3LPE B;  2Z3Q B;  2B5I D;  4LHL A;  2NVQ L;  4C3H L;  1QYB A;  5IP7 L;  5H1S c;  1R0I A;  5FLM L;  1PZX A;  3M3Y L;  1ODH A;  1E8J A;  2E2H L;  3NFP I;  1B13 A;  3FKI L;  1I3Q L;  2H12 A;  5MFP A;  2JI1 A;  2PSM C;  2B63 L;  3A44 A;  5GAG c;  4BY7 L;  2R93 L;  4A3M L;  1RYT A;  2PVX A;  4A3E L;  5M5X L;  5DM6 1;  1OWC A;  1SMW A;  1PFU A;  4AR4 A;  3S1M L;  3PWF A;  4JAD A;  4RXN A;  3GTM L;  4ZN3 B;  1NXE A;  5IYD L;  1NNQ A;  4A3D L;  5JVH 1;  4C2M 1;  3MQK B;  2BE5 D;  3LWR B;  2AYJ A;  3HOZ L;  4A3G L;  4E6Y A;  4XGH A;  4POG A;  3QQC E;  2V0E A;  5M5Y L;  2Y0S P;  1YK4 A;  4C3J L;  4A3I L;  2ZIX A;  4TVM A;  2C6B A;  2RFK B;  1T9Q A;  1BRF A;  1ZRP A;  4JAF A;  3S16 L;  1BE7 A;  3GTK L;  3K35 A;  1TWF L;  2JI3 A;  2PMZ P;  3J7Y 1;  2QL0 A;  5IP9 L;  3GTJ L;  1LKO A;  2PYA A;  1WCM L;  2ERJ A;  3S2D L;  4GS7 D;  4AR6 A;  3MSU A;  2M4Y A;  2JA5 L;  4QIW P;  1BQ9 A;  1VZH A;  3RZ6 A;  3RZO L;  1IRN A;  2ERS A;  4V19 6;  2CR8 A;  1BQ8 A;  3K7A L;  2M6P A;  4A3L L;  5RXN A;  3H9C A;  2M4V A;  3KYU A;  4B8C D;  8RXN A;  4AI2 A;  1JYB A;  3LWQ B;  1Y1V L;  3KYW A;  4JAE A;  5MLC 3;  3GTG L;  2RDV A;  4ZN1 B;  1R0F A;  4JAG A;  3HOU L;  4A3C L;  3VPB E;  1B2O A;  1B2J A;  3PO3 L;  1PFY A;  4TPU A;  3B08 B;  5DM7 1;  1BFY A;  4AR5 A;  2NVY L;  1IW7 D;  2Z3R B;  5AN9 H;  3M4O L;  3WWL A;  5GAH c;  2APO B;  3PKJ A;  2YU9 L;  2XJV A;  1B71 A;  5K2M E;  3GTL L;  3JR7 A; 
#chains in the Genus database with same CATH homology
 4JAF A;  1H7V A;  4AI3 A;  1RDV A;  1BE7 A;  1CAD A;  2A6H D;  1VZG A;  3K35 A;  1R0G A;  1RDG A;  1FHH A;  2A69 D;  2JI3 A;  4AI1 A;  1S30 A;  1T9P A;  1QCV A;  3J7Y 1;  3WWN B;  2J9U B;  2QL0 A;  5MF6 A;  2XJU A;  1VZI A;  2XJP A;  1IRO A;  5AI3 A;  1FHM A;  2GMG A;  4K9F A;  1LKO A;  4YWL A;  5JVG 1;  2PYA A;  1LKM A;  2ERJ A;  2NYD A;  1RWD A;  4LHN A;  4U67 1;  1C09 A;  2CKA A;  4GS7 D;  2K2D A;  4AR6 A;  1RB9 A;  1S2Z A;  3B0A B;  3P2A A;  3LPE B;  3KYX A;  2Z3Q B;  2B5I D;  3MSU A;  4LHL A;  1R0J A;  3RZT A;  4AHX A;  5GAE c;  6RXN A;  1QYB A;  3J7Z 1;  1Z92 B;  1R0H A;  7RXN A;  5EIN C;  4ME3 A;  2XJR A;  2CKC A;  5H1S c;  2O5J D;  2XJS A;  1R0I A;  2M4Y A;  1DX8 A;  1T9O A;  1BQ9 A;  1VZH A;  3KYY A;  1ODH A;  1SMM A;  2KN9 A;  3RZ6 A;  4AI0 A;  4AR3 A;  3MPS A;  1E8J A;  1IRN A;  1OWB A;  3NFP I;  5AI2 A;  3PIP 1;  1B13 A;  2ERS A;  2H12 A;  2HR5 A;  5MFP A;  2JI1 A;  2CR8 A;  4V19 6;  4AHW A;  2PSM C;  1BQ8 A;  1NXG A;  3A44 A;  2M6P A;  5RXN A;  2A6E D;  2M4V A;  3KYU A;  5GAG c;  4XXB B;  4YWM A;  2KKD A;  5EIO C;  4AHZ A;  3PIO 1;  4B8C D;  1RYT A;  1BRF A;  2PVX A;  5DM6 1;  8RXN A;  4AI2 A;  5GAD c;  1OWC A;  4POF A;  1SMW A;  1JYB A;  2JI2 A;  4AR4 A;  3KYW A;  3PWF A;  4JAE A;  1IU5 A;  4JAD A;  4RXN A;  5MLC 3;  3LNL A;  4ZN3 B;  1NXE A;  1RYQ A;  2RDV A;  2XJQ A;  3SS2 A;  4ZN1 B;  1R0F A;  1NNQ A;  2L0Z A;  4JAG A;  2PVE A;  3P8B A;  3ZG6 A;  1CAA A;  5MGN A;  5JVH 1;  2BE5 D;  3VPB E;  1B2O A;  1B2J A;  1YUX A;  2VL6 A;  3RYG A;  1VCX A;  4TPU A;  4UY8 1;  3B08 B;  1WJV A;  5DM7 1;  1BFY A;  1S24 A;  4WFN 1;  2C6A A;  4AR5 A;  1YK5 A;  5IY0 A;  1SMU A;  1IU6 A;  2PPT A;  3PZA A;  1IW7 D;  2AYJ A;  2Z3R B;  3IU3 I;  2M6O A;  5AN9 H;  1DVB A;  4E6Y A;  2DSX A;  4XGH A;  3WWL A;  5GAH c;  4POG A;  3QQC E;  1LTL A;  3QVD A;  2LCQ A;  2XJT A;  1YV1 A;  2V0E A;  1LKP A;  1YK4 A;  4G6B A;  3PKJ A;  2V3B B;  3KYV A;  2XJV A;  4AHY A;  1B71 A;  2A68 D;  2MS3 A;  3PKI A;  2V0F A;  5K2M E;  5MFZ A;  1YUZ A;  2ZIX A;  4TVM A;  2C6B A;  1T9Q A;  1ZRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...