2M5JA

Solution structure of the periplasmic signaling domain of hasr, a tonb-dependent outer membrane heme transporter
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVLGAGGNNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of a Partially Disordered Antisigma Factor with Its Partner, the Signaling Domain of the TonB-Dependent Transporter HasR
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Signaling protein
molecule keywords HasR protein
total genus 15
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07660 STN Secretin and TonB N terminus short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 2m5jA00
4G08A 1ZZVA 2M5JA 3GR5A 2W76A 4M0HA 2W77A 2W16A 2W6UA 2W75A 2A02A 2D1UA 2IAHA 3EZJA 2W6TA 2W78A 4M0NA 2O5PA 4JTMA 4AR0A
chains in the Genus database with same CATH superfamily
1ZZVA 3GS9A 3CDDA 2P5ZX 1K28D 2A02A 3OV5A 2W6TA 3EZJA 2X531 2L4WA 4AR0A 4UHVA 2M5JA 3GR5A 2W6UA 2WZPR 4M0NA 2O5PA 4M0HA 4G08A 2W76A 2W16A 3ADYA 1WRUA 2D1UA 2IAHA 2W78A 4MTKA 4JTMA 2Z6BD 2W75A 3D37A 1WTHD 2W77A
chains in the Genus database with same CATH topology
1ZZVA 3GS9A 1K28D 2A02A 3OV5A 2W6TA 3EZJA 2X531 2L4WA 4AR0A 2M5JA 3GR5A 2W6UA 2WZPR 4M0NA 2O5PA 4M0HA 4G08A 2W76A 2W16A 3ADYA 2D1UA 2IAHA 2W78A 4JTMA 2Z6BD 2W75A 1WTHD 2W77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G08 A;  1ZZV A;  2M5J A;  3GR5 A;  2W76 A;  4M0H A;  2W77 A;  2W16 A;  2W6U A;  2W75 A;  2A02 A;  2D1U A;  2IAH A;  3EZJ A;  2W6T A;  2W78 A;  4M0N A;  2O5P A;  4JTM A;  4AR0 A; 
#chains in the Genus database with same CATH topology
 1ZZV A;  3GS9 A;  3CDD A;  2P5Z X;  1K28 D;  2A02 A;  3OV5 A;  2W6T A;  3EZJ A;  2X53 1;  2L4W A;  4AR0 A;  4UHV A;  2M5J A;  3GR5 A;  2W6U A;  2WZP R;  4M0N A;  2O5P A;  4M0H A;  4G08 A;  2W76 A;  2W16 A;  3ADY A;  1WRU A;  2D1U A;  2IAH A;  2W78 A;  4MTK A;  4JTM A;  2Z6B D;  2W75 A;  3D37 A;  1WTH D;  2W77 A; 
#chains in the Genus database with same CATH homology
 1ZZV A;  3GS9 A;  1K28 D;  2A02 A;  3OV5 A;  2W6T A;  3EZJ A;  2X53 1;  2L4W A;  4AR0 A;  2M5J A;  3GR5 A;  2W6U A;  2WZP R;  4M0N A;  2O5P A;  4M0H A;  4G08 A;  2W76 A;  2W16 A;  3ADY A;  2D1U A;  2IAH A;  2W78 A;  4JTM A;  2Z6B D;  2W75 A;  1WTH D;  2W77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...