2M5SA

High-resolution nmr structure and cryo-em imaging support multiple functional roles for the accessory i-domain of phage p22 coat protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple Functional Roles of the Accessory I-Domain of Bacteriophage P22 Coat Protein Revealed by NMR Structure and CryoEM Modeling.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Viral protein
molecule keywords Coat protein
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.240 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2m5sA00
2M5SA
chains in the Genus database with same CATH superfamily
2XOKA 3MMPA 1GVHA 3D26A 2X53S 1WTHD 2BF4A 4DNTB 1QUFA 4P9SA 3Q6RA 2YWEA 2ZL7A 4HIZA 3CC7B 2DCUA 2ZBVA 2YWGA 4ZV4A 5FA6A 3I1FA 1N0UA 2AHOA 3GVLA 2HCJB 3NE5B 1IJEA 3JQPA 2WJVA 3BC9A 2F1LA 1W34A 4RD0A 1YJWB 1OGIA 4OPSA 1VJSA 2V7WA 5IK2A 3LVBA 3U2QA 2X6YA 3ZBTA 2Q6LA 1Q81D 3OW7A 4YELA 4YAWA 2BSAA 2X85A 4B3XA 4RD3A 1OB2A 1PJ6A 1T5EA 4R71A 2CBXA 3BY1A 5TV2A 1VHOA 3CTAA 5EMNA 3CCEB 4PGOA 4AC9A 3AGQA 2KVOA 4TMVA 2X6XA 3QFTA 2Q6OA 3PUMA 1VF7A 3OZUA 4QVAA 1W87A 4XORA 1VQNB 3R6JA 4WZTA 2V7UA 2GJKA 2VYQA 4TMZA 4P22A 2VNKA 2V7XA 2BPOA 1V5VA 2VJJA 2C77A 3OFNA 4E0FA 5IYRA 4XQFA 1P4MA 2OYNA 4Z4SA 2RC6A 1QGYA 4X07A 1H8EA 3ASTA 2LZJA 2ZL5A 3V76A 1K9MD 4XLCA 1N8RD 2VBTA 4P1VA 1W0JA 2QGGA 3B8HA 1QGZA 2V7QA 3T53B 1VQ6B 4Z4RA 2NPFA 4XKWA 2R9VA 1R5OA 4QFMA 3Q3AA 2GK7A 3BH4A 2BV3A 1S4MA 1XB2A 3A35A 1D2EA 2B7CA 2V31A 4ASUA 2HLDA 5HKKA 5F4OA 4OP7A 1B2RA 1V0FA 2VZLA 4Y9RA 3J81k 4XONA 4G5GA 4XOTA 4B44A 3BY2A 3GSIA 3SLDA 2GPJA 4WZEA 3ZBUA 1A8PA 4MYTA 3CRZA 4YHBA 1MRZA 4RD2A 2JJ2A 1B23P 1E1RA 1VQ5B 1OB5A 3AVTA 2ZBUA 1DARA 1KQSB 2YWHA 3VNVA 1SKQA 1T6ZA 3PA1A 4H9GA 3WNDA 5A89A 2F4NA 2VJIA 2ZZQA 3BCFA 4NNJA 2OTLB 4RDJA 3G6EB 4FK8A 1VQ8B 5FO0A 3KEWA 5F4JA 4LBZA 3G71B 3V7AA 2R6HA 3CB4A 1CNEA 4PC7A 1G7CA 3OPOA 4M1KA 4Z4ZA 1KK2A 1E64A 2C4UA 2C5BA 3P27A 2M5SA 2D74A 1H42A 4PC1A 4UAJA 3GVKA 4OPVA 1IB0A 1VLYA 1HZEA 1AIPA 5FNZA 5J3OA 3JQRA 4N3NA 3WQZA 1Q86D 4P2NA 3OW2B 4B3FX 1VQLB 3A8KA 3OJXA 2HDNB 3WYAA 2ZTNA 3W2EA 3QFSA 3OKXA 1WSVA 3QSYA 5FO1A 1ZUNB 4XOPA 2I1LA 1XE1A 4P25A 4M53A 4X7CA 5L46A 4OOXA 1G7SA 4B48A 2CC2A 3DDYA 2BM1A 3WNCA 1EXMA 1W9XA 4XLHA 2PE3A 3SLNA 3W2FA 2VBUA 1HA3A 3A1PA 4G6IA 1EFUA 1T6XA 2C5HA 3W5VA 3ZZ0A 4DK0A 4YXWA 1GR1A 1OHHA 1VLOA 3Q39A 1W2BB 4TN1A 5AN9A 2ZL6A 1FDRA 2ZTGA 3CPWB 4P3YA 1XQBA 3H94A 3OE7A 4N3GA 4PABA 3SJPA 1QUEA 2QEXB 2BGJA 1K73D 3LQ6A 1N0VC 4K1XA 4YALA 1G7TA 1E79A 1W35A 3ES9A 3ISXA 4ROXA 1PKVA 4RPDA 4G1VA 3FPPA 3VR6A 3CPXA 3CCVB 2E1BA 1YX2A 4X06A 1FNDA 1IJFA 2CW5A 4LBWA 4XM3A 4XLFA 2E1RA 2PLFA 4Z4TA 4DQLA 2XZPA 2FX3A 2X3UA 3WBKA 2WJYA 4M2LA 1ZM9A 3CESA 1QGAA 4Y7CA 1N05A 3BNWA 2ZZGA 5E6TA 2JIZA 1HVXA 1CNFA 3JQQA 4KKSA 4C43A 1UD5A 3MCAA 4P6VF 1OGJA 1YI2B 1FX0A 2PMDA 4LBVA 1N08A 1U2RA 2DOGA 4L8JA 1FRQA 2B7BA 2YWFA 1E43A 2DETA 5DS0A 4X7EA 1JA1A 3VMFA 2Q6KA 1TUIA 4KKTA 4TT3A 2V7TA 3OZWA 3ASQA 2VBVA 1QFYA 4TKOB 4F7DA 1I18A 1VHEA 4ZCIA 2CNDA 1JNYA 4YEJA 4RLZA 3ZZUA 4AF6A 3CXCB 1SM4A 3U6KA 2WZNA 3PENA 1DDIA 1EP1B 1I7PA 1ZM4A 3OJWA 4RCZA 3W5UA 1K28D 4U9UA 4B43A 1TLLA 2OK7A 4C0SA 3AVWA 3W2GA 3B78A 5DSZA 1ZM2A 5KNLA 1KZLA 4G7WA 1NDHA 4PAAA 5TY0A 3CCUB 1XFOA 1SKYB 2BGIA 3QE2A 3WXMA 3CP2A 4Z4YA 1Q82D 1MABA 4P12A 5KSWB 2CK3A 4P3IA 5J35A 1W0KA 1UMKA 1COWA 4YAOA 1D1NA 1EFTA 2X6WA 2GJRA 4G1BA 2ZZFA 3CCMB 2VNHA 1VQMB 4FXUA 3OOCA 3P26A 5HXBA 3FKSA 2BN4A 4QHYA 2QDXA 2QMUA 2HMAA 3CCJB 3VNUA 3SJZA 2F43A 3CCQB 2XNDA 1NRKA 1ELOA 3AVUA 4Z4WA 2WPDA 4XN3A 1YJNB 3FPKA 4XKVA 1NJID 3AGPA 3CCLB 2OTJB 1D8TA 1KTVA 4KKUA 1R5BA 3SEJA 1FNCA 2P3MA 4QV2A 3R6KA 5CDFA 2PIAA 3G05A 1QG0A 1GAWA 5H59A 1YHQB 1G7RA 1Y0YA 4DQKA 1WOOA 4II2A 1UD2A 5BSYA 1KC8D 2QA4B 5DN6A 1H8HA 3B82A 1OB0A 5THXA 2D9RA 4DNRB 1NBMA 3A8IA 1EP2B 3GVJA 5BSXA 2DEUA 2XZLA 4AF7A 3WY9A 1NB9A 1WOSA 3GIRA 1VQOB 2CRVA 2WZPP 1QX4A 4XMYA 1TTTA 4BPRA 2V7VA 3A3GA 5FL7A 4OOVA 3A3BA 2ZITA 4EH1A 3Q38A 1KK3A 3SKBA 2WR8A 3JU4A 3CMAB 2VBSA 4X7FA 4NCNA 1E1QA 4PC6A 3E20A 3CCRB 2V4DA 4TMTA 1GO2A 2QTZA 3MHPA 4Q7JB 3W5HA 4B47A 4RD4A 3CW2A 1R5NA 1S72B 3HAGA 4XR6A 2QN6A 3BCDA 5TR9A 1FNMA 4IW3B 3OZVA 5B6IA 4RM0A 1UD4A 3PA2A 1FRNA 3U6BA 2X0KA 4B4DA 1T6YA 4WZKA 4ZGNB 3I55B 1TVCA 2DERA 2C2WA 3ASRA 2EIXA 2XNCA 4OOSA 4YAFA 2EFGA 5HZBA 4X0CA 2GK6A 4LC0A 4RDKA 1Q7YD 1RQRA 4HE6A 4II3A 1YITB 4Z4UA 3LO8A 3A8JA 2QE7A 4YAUA 1BQEA 2RC5A 2VNJA 2Z6BD 1WORA 2XEXA 3ONUA 2J7KA 1EWYA 3PVDA 4Z1MA 2XNJA 2ZZEA 4DK1A 2NV4A 4TSFA 4PC3A 4TMWA 1UD3A 3OEHA 5A88A 4LBYA 5A8AA 1Y0RA 4Z4VA 5HZAA 2X8KA 1KMHA 2B5OA 1YJ9B 1J9ZA 3CD6B 1EFRA 4RDLA 1BMFA 2CF4A 4X7DA 1F20A 3ZPNA 3G4SB 3ASSA 2W6IA 4B3GA 1AMOA 3CMEB 1Q9SA 1VQKB 2F1MA 1S0UA 3CMMA 2GQFA 4X05A 4NBSA 5TRDA 2OK8A 2JJ1A 3H9NA 3VO1A 3W2IA 1JB9A 2WSSA 4XD7A 3ZC3A 3W2HA 3AVYA 2WYRA 4G7XA 4UZEA 2ZXIA 1DDGA 2W6JA 2XZOA 1H85A 3GQBA 4XL9A 1EFCA 3BQJA 5GV8A 1BPLA 3RY8A 1KD1D 5KW9A 1KK1A 1IHMA 4M4SA 1BX0A 4RPBA 4M0LA 1QFJA 4RJLA 1K8AD 5IYNA 3CCSB 5LMZA 3AVVA 4J0QA 1VQPB 5F4MA 1V0EA 1FNBA 2C4TA 1WU8A 1F60A 3OP1A 3QFCA 2FVGA 1VQ9B 4PC2A 2D3NA 1WPCA 1N07A 2Q6IA 4P26A 3ZUGA 4RCYA 2GJPA 4WWVA 2DY1A 1EP3B 4HE5A 1YIJB 1GJRA 4WZLA 2VNIA 3LNNA 4UZUA 1BJKA 4UZFA 1E62A 3AVXA 4JMQA 4XLEA 1JJ2B 1NB0A 2JDIA 3T56B 3Q6QA 3VO2A 1QFZA 3ASPA 2QTLA 1E3XA 2OBTA 1WSRA 1YLOA 4ZCMA 3FJOA 3WNBA 3CP8A 5IYQA 2OBSA 4ZCLA 1PJ5A 2BM0A 4FWTA 1UD8A 2BVNA 1JA0A 3ONYA 5H5JA 1N06A 4QVJA 4WQMA 1QVGB 4RD1A 2BMWA 1QVFB 4ZGQB 3OAAA 1GAQA 4CQJA 3T51B 3I56B 5IYWA 1BX1A 4AVZA 2ZXHA 4X8IA 3E1YE 3PUNA 1KK0A 1E3ZA 1KJZA 2JN9A 1WP6A 1ZM3A 4GQNA 1M1KD 1WDTA 3ZZTA 2DYIA 4MYUA 4ACBA 1CQXA 2C78A 4XNFA 2XGJA 2D3LA 5JBQA 1M90D 4TMXA 4ACAA 4RD6A 1RQPA 3WBJA 5IYPA 1DG1G 1QH0A 1E63A 3LQEA 1VQ7B 1UD6A 4XN0A 4Y9UA 1KRHA 5GV7A 4P6YA 1PJ7A 2GREA 2OBRA 1I8DA 1BLIA 2DIEA 4XLAA 4FN5A 3ZIAA 3QFRA 4QUZA 5FIUA 1VQ4B 1WOPA 3OEEA 4OPOA 3CC2B 3CC4B 3KL9A
chains in the Genus database with same CATH topology
1KZLA 2W6IA 2XOKA 1VLYA 2X53S 1HZEA 1WTHD 4G7WA 1SKYB 4DNTB 3WQZA 2F1MA 3CP2A 1MABA 3CMMA 2CK3A 4B3FX 4HIZA 2JJ1A 2WSSA 4XD7A 1W0KA 2ZTNA 1COWA 2X6WA 3GVLA 4G7XA 3NE5B 2GJRA 2ZXIA 2WJVA 3BC9A 2XZOA 2W6JA 2ZZFA 3GQBA 4XL9A 4FXUA 3OOCA 3FKSA 4XOPA 5IK2A 1VJSA 1BPLA 2X6YA 2F43A 2XNDA 1NRKA 3OW7A 4YELA 2WPDA 4XN3A 2X85A 4XKVA 3DDYA 1T5EA 1W9XA 4XLHA 4KKUA 2KVOA 5CDFA 3G05A 1V0EA 4G6IA 2X6XA 4II2A 1UD2A 4DK0A 4YXWA 1VF7A 5DN6A 1H8HA 1OHHA 2D3NA 1WPCA 1OB0A 4XORA 2ZTGA 4DNRB 1NBMA 2GJKA 3H94A 3GVJA 3OE7A 4P22A 2GJPA 2XZLA 2VJJA 3OFNA 4E0FA 2WZPP 3LNNA 4XMYA 4XQFA 4UZUA 5FL7A 3A3GA 1E79A 4JMQA 4XLEA 2JDIA 3A3BA 3T56B 1PKVA 3FPPA 1H8EA 3VR6A 1E3XA 2LZJA 3JU4A 4XLCA 3CP8A 1E1QA 1W0JA 2E1BA 3T53B 2V7QA 2V4DA 1UD8A 4XM3A 4XLFA 4XKWA 2R9VA 2XZPA 2GK7A 3BH4A 2WJYA 3HAGA 3A35A 3CESA 4XR6A 4ASUA 3BCDA 2V31A 5HKKA 2HLDA 3OAAA 3T51B 1V0FA 1UD4A 2ZZGA 4XONA 4AVZA 2JIZA 1HVXA 2ZXHA 4XOTA 4KKSA 1UD5A 1FX0A 1E3ZA 4L8JA 1WP6A 4GQNA 2GK6A 2JJ2A 1E43A 1E1RA 4II3A 4KKTA 4XNFA 2XGJA 2QE7A 2D3LA 4TT3A 2VJIA 2Z6BD 2ZZQA 3BCFA 4NNJA 4B3GA 4TKOB 1I18A 4Z1MA 4YEJA 2ZZEA 3KEWA 4DK1A 4TSFA 1UD3A 3OPOA 1UD6A 3OEHA 4XN0A 2X8KA 1KMHA 1I8DA 1BLIA 1K28D 2DIEA 2M5SA 4XLAA 3ZIAA 1EFRA 3OEEA 1BMFA 3ZPNA 3GVKA 5KNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5S A; 
#chains in the Genus database with same CATH topology
 2XOK A;  3MMP A;  1GVH A;  3D26 A;  2X53 S;  1WTH D;  2BF4 A;  4DNT B;  1QUF A;  4P9S A;  3Q6R A;  2YWE A;  2ZL7 A;  4HIZ A;  3CC7 B;  2DCU A;  2ZBV A;  2YWG A;  4ZV4 A;  5FA6 A;  3I1F A;  1N0U A;  2AHO A;  3GVL A;  2HCJ B;  3NE5 B;  1IJE A;  3JQP A;  2WJV A;  3BC9 A;  2F1L A;  1W34 A;  4RD0 A;  1YJW B;  1OGI A;  4OPS A;  1VJS A;  2V7W A;  5IK2 A;  3LVB A;  3U2Q A;  2X6Y A;  3ZBT A;  2Q6L A;  1Q81 D;  3OW7 A;  4YEL A;  4YAW A;  2BSA A;  2X85 A;  4B3X A;  4RD3 A;  1OB2 A;  1PJ6 A;  1T5E A;  4R71 A;  2CBX A;  3BY1 A;  5TV2 A;  1VHO A;  3CTA A;  5EMN A;  3CCE B;  4PGO A;  4AC9 A;  3AGQ A;  2KVO A;  4TMV A;  2X6X A;  3QFT A;  2Q6O A;  3PUM A;  1VF7 A;  3OZU A;  4QVA A;  1W87 A;  4XOR A;  1VQN B;  3R6J A;  4WZT A;  2V7U A;  2GJK A;  2VYQ A;  4TMZ A;  4P22 A;  2VNK A;  2V7X A;  2BPO A;  1V5V A;  2VJJ A;  2C77 A;  3OFN A;  4E0F A;  5IYR A;  4XQF A;  1P4M A;  2OYN A;  4Z4S A;  2RC6 A;  1QGY A;  4X07 A;  1H8E A;  3AST A;  2LZJ A;  2ZL5 A;  3V76 A;  1K9M D;  4XLC A;  1N8R D;  2VBT A;  4P1V A;  1W0J A;  2QGG A;  3B8H A;  1QGZ A;  2V7Q A;  3T53 B;  1VQ6 B;  4Z4R A;  2NPF A;  4XKW A;  2R9V A;  1R5O A;  4QFM A;  3Q3A A;  2GK7 A;  3BH4 A;  2BV3 A;  1S4M A;  1XB2 A;  3A35 A;  1D2E A;  2B7C A;  2V31 A;  4ASU A;  2HLD A;  5HKK A;  5F4O A;  4OP7 A;  1B2R A;  1V0F A;  2VZL A;  4Y9R A;  3J81 k;  4XON A;  4G5G A;  4XOT A;  4B44 A;  3BY2 A;  3GSI A;  3SLD A;  2GPJ A;  4WZE A;  3ZBU A;  1A8P A;  4MYT A;  3CRZ A;  4YHB A;  1MRZ A;  4RD2 A;  2JJ2 A;  1B23 P;  1E1R A;  1VQ5 B;  1OB5 A;  3AVT A;  2ZBU A;  1DAR A;  1KQS B;  2YWH A;  3VNV A;  1SKQ A;  1T6Z A;  3PA1 A;  4H9G A;  3WND A;  5A89 A;  2F4N A;  2VJI A;  2ZZQ A;  3BCF A;  4NNJ A;  2OTL B;  4RDJ A;  3G6E B;  4FK8 A;  1VQ8 B;  5FO0 A;  3KEW A;  5F4J A;  4LBZ A;  3G71 B;  3V7A A;  2R6H A;  3CB4 A;  1CNE A;  4PC7 A;  1G7C A;  3OPO A;  4M1K A;  4Z4Z A;  1KK2 A;  1E64 A;  2C4U A;  2C5B A;  3P27 A;  2M5S A;  2D74 A;  1H42 A;  4PC1 A;  4UAJ A;  3GVK A;  4OPV A;  1IB0 A;  1VLY A;  1HZE A;  1AIP A;  5FNZ A;  5J3O A;  3JQR A;  4N3N A;  3WQZ A;  1Q86 D;  4P2N A;  3OW2 B;  4B3F X;  1VQL B;  3A8K A;  3OJX A;  2HDN B;  3WYA A;  2ZTN A;  3W2E A;  3QFS A;  3OKX A;  1WSV A;  3QSY A;  5FO1 A;  1ZUN B;  4XOP A;  2I1L A;  1XE1 A;  4P25 A;  4M53 A;  4X7C A;  5L46 A;  4OOX A;  1G7S A;  4B48 A;  2CC2 A;  3DDY A;  2BM1 A;  3WNC A;  1EXM A;  1W9X A;  4XLH A;  2PE3 A;  3SLN A;  3W2F A;  2VBU A;  1HA3 A;  3A1P A;  4G6I A;  1EFU A;  1T6X A;  2C5H A;  3W5V A;  3ZZ0 A;  4DK0 A;  4YXW A;  1GR1 A;  1OHH A;  1VLO A;  3Q39 A;  1W2B B;  4TN1 A;  5AN9 A;  2ZL6 A;  1FDR A;  2ZTG A;  3CPW B;  4P3Y A;  1XQB A;  3H94 A;  3OE7 A;  4N3G A;  4PAB A;  3SJP A;  1QUE A;  2QEX B;  2BGJ A;  1K73 D;  3LQ6 A;  1N0V C;  4K1X A;  4YAL A;  1G7T A;  1E79 A;  1W35 A;  3ES9 A;  3ISX A;  4ROX A;  1PKV A;  4RPD A;  4G1V A;  3FPP A;  3VR6 A;  3CPX A;  3CCV B;  2E1B A;  1YX2 A;  4X06 A;  1FND A;  1IJF A;  2CW5 A;  4LBW A;  4XM3 A;  4XLF A;  2E1R A;  2PLF A;  4Z4T A;  4DQL A;  2XZP A;  2FX3 A;  2X3U A;  3WBK A;  2WJY A;  4M2L A;  1ZM9 A;  3CES A;  1QGA A;  4Y7C A;  1N05 A;  3BNW A;  2ZZG A;  5E6T A;  2JIZ A;  1HVX A;  1CNF A;  3JQQ A;  4KKS A;  4C43 A;  1UD5 A;  3MCA A;  4P6V F;  1OGJ A;  1YI2 B;  1FX0 A;  2PMD A;  4LBV A;  1N08 A;  1U2R A;  2DOG A;  4L8J A;  1FRQ A;  2B7B A;  2YWF A;  1E43 A;  2DET A;  5DS0 A;  4X7E A;  1JA1 A;  3VMF A;  2Q6K A;  1TUI A;  4KKT A;  4TT3 A;  2V7T A;  3OZW A;  3ASQ A;  2VBV A;  1QFY A;  4TKO B;  4F7D A;  1I18 A;  1VHE A;  4ZCI A;  2CND A;  1JNY A;  4YEJ A;  4RLZ A;  3ZZU A;  4AF6 A;  3CXC B;  1SM4 A;  3U6K A;  2WZN A;  3PEN A;  1DDI A;  1EP1 B;  1I7P A;  1ZM4 A;  3OJW A;  4RCZ A;  3W5U A;  1K28 D;  4U9U A;  4B43 A;  1TLL A;  2OK7 A;  4C0S A;  3AVW A;  3W2G A;  3B78 A;  5DSZ A;  1ZM2 A;  5KNL A;  1KZL A;  4G7W A;  1NDH A;  4PAA A;  5TY0 A;  3CCU B;  1XFO A;  1SKY B;  2BGI A;  3QE2 A;  3WXM A;  3CP2 A;  4Z4Y A;  1Q82 D;  1MAB A;  4P12 A;  5KSW B;  2CK3 A;  4P3I A;  5J35 A;  1W0K A;  1UMK A;  1COW A;  4YAO A;  1D1N A;  1EFT A;  2X6W A;  2GJR A;  4G1B A;  2ZZF A;  3CCM B;  2VNH A;  1VQM B;  4FXU A;  3OOC A;  3P26 A;  5HXB A;  3FKS A;  2BN4 A;  4QHY A;  2QDX A;  2QMU A;  2HMA A;  3CCJ B;  3VNU A;  3SJZ A;  2F43 A;  3CCQ B;  2XND A;  1NRK A;  1ELO A;  3AVU A;  4Z4W A;  2WPD A;  4XN3 A;  1YJN B;  3FPK A;  4XKV A;  1NJI D;  3AGP A;  3CCL B;  2OTJ B;  1D8T A;  1KTV A;  4KKU A;  1R5B A;  3SEJ A;  1FNC A;  2P3M A;  4QV2 A;  3R6K A;  5CDF A;  2PIA A;  3G05 A;  1QG0 A;  1GAW A;  5H59 A;  1YHQ B;  1G7R A;  1Y0Y A;  4DQK A;  1WOO A;  4II2 A;  1UD2 A;  5BSY A;  1KC8 D;  2QA4 B;  5DN6 A;  1H8H A;  3B82 A;  1OB0 A;  5THX A;  2D9R A;  4DNR B;  1NBM A;  3A8I A;  1EP2 B;  3GVJ A;  5BSX A;  2DEU A;  2XZL A;  4AF7 A;  3WY9 A;  1NB9 A;  1WOS A;  3GIR A;  1VQO B;  2CRV A;  2WZP P;  1QX4 A;  4XMY A;  1TTT A;  4BPR A;  2V7V A;  3A3G A;  5FL7 A;  4OOV A;  3A3B A;  2ZIT A;  4EH1 A;  3Q38 A;  1KK3 A;  3SKB A;  2WR8 A;  3JU4 A;  3CMA B;  2VBS A;  4X7F A;  4NCN A;  1E1Q A;  4PC6 A;  3E20 A;  3CCR B;  2V4D A;  4TMT A;  1GO2 A;  2QTZ A;  3MHP A;  4Q7J B;  3W5H A;  4B47 A;  4RD4 A;  3CW2 A;  1R5N A;  1S72 B;  3HAG A;  4XR6 A;  2QN6 A;  3BCD A;  5TR9 A;  1FNM A;  4IW3 B;  3OZV A;  5B6I A;  4RM0 A;  1UD4 A;  3PA2 A;  1FRN A;  3U6B A;  2X0K A;  4B4D A;  1T6Y A;  4WZK A;  4ZGN B;  3I55 B;  1TVC A;  2DER A;  2C2W A;  3ASR A;  2EIX A;  2XNC A;  4OOS A;  4YAF A;  2EFG A;  5HZB A;  4X0C A;  2GK6 A;  4LC0 A;  4RDK A;  1Q7Y D;  1RQR A;  4HE6 A;  4II3 A;  1YIT B;  4Z4U A;  3LO8 A;  3A8J A;  2QE7 A;  4YAU A;  1BQE A;  2RC5 A;  2VNJ A;  2Z6B D;  1WOR A;  2XEX A;  3ONU A;  2J7K A;  1EWY A;  3PVD A;  4Z1M A;  2XNJ A;  2ZZE A;  4DK1 A;  2NV4 A;  4TSF A;  4PC3 A;  4TMW A;  1UD3 A;  3OEH A;  5A88 A;  4LBY A;  5A8A A;  1Y0R A;  4Z4V A;  5HZA A;  2X8K A;  1KMH A;  2B5O A;  1YJ9 B;  1J9Z A;  3CD6 B;  1EFR A;  4RDL A;  1BMF A;  2CF4 A;  4X7D A;  1F20 A;  3ZPN A;  3G4S B;  3ASS A;  2W6I A;  4B3G A;  1AMO A;  3CME B;  1Q9S A;  1VQK B;  2F1M A;  1S0U A;  3CMM A;  2GQF A;  4X05 A;  4NBS A;  5TRD A;  2OK8 A;  2JJ1 A;  3H9N A;  3VO1 A;  3W2I A;  1JB9 A;  2WSS A;  4XD7 A;  3ZC3 A;  3W2H A;  3AVY A;  2WYR A;  4G7X A;  4UZE A;  2ZXI A;  1DDG A;  2W6J A;  2XZO A;  1H85 A;  3GQB A;  4XL9 A;  1EFC A;  3BQJ A;  5GV8 A;  1BPL A;  3RY8 A;  1KD1 D;  5KW9 A;  1KK1 A;  1IHM A;  4M4S A;  1BX0 A;  4RPB A;  4M0L A;  1QFJ A;  4RJL A;  1K8A D;  5IYN A;  3CCS B;  5LMZ A;  3AVV A;  4J0Q A;  1VQP B;  5F4M A;  1V0E A;  1FNB A;  2C4T A;  1WU8 A;  1F60 A;  3OP1 A;  3QFC A;  2FVG A;  1VQ9 B;  4PC2 A;  2D3N A;  1WPC A;  1N07 A;  2Q6I A;  4P26 A;  3ZUG A;  4RCY A;  2GJP A;  4WWV A;  2DY1 A;  1EP3 B;  4HE5 A;  1YIJ B;  1GJR A;  4WZL A;  2VNI A;  3LNN A;  4UZU A;  1BJK A;  4UZF A;  1E62 A;  3AVX A;  4JMQ A;  4XLE A;  1JJ2 B;  1NB0 A;  2JDI A;  3T56 B;  3Q6Q A;  3VO2 A;  1QFZ A;  3ASP A;  2QTL A;  1E3X A;  2OBT A;  1WSR A;  1YLO A;  4ZCM A;  3FJO A;  3WNB A;  3CP8 A;  5IYQ A;  2OBS A;  4ZCL A;  1PJ5 A;  2BM0 A;  4FWT A;  1UD8 A;  2BVN A;  1JA0 A;  3ONY A;  5H5J A;  1N06 A;  4QVJ A;  4WQM A;  1QVG B;  4RD1 A;  2BMW A;  1QVF B;  4ZGQ B;  3OAA A;  1GAQ A;  4CQJ A;  3T51 B;  3I56 B;  5IYW A;  1BX1 A;  4AVZ A;  2ZXH A;  4X8I A;  3E1Y E;  3PUN A;  1KK0 A;  1E3Z A;  1KJZ A;  2JN9 A;  1WP6 A;  1ZM3 A;  4GQN A;  1M1K D;  1WDT A;  3ZZT A;  2DYI A;  4MYU A;  4ACB A;  1CQX A;  2C78 A;  4XNF A;  2XGJ A;  2D3L A;  5JBQ A;  1M90 D;  4TMX A;  4ACA A;  4RD6 A;  1RQP A;  3WBJ A;  5IYP A;  1DG1 G;  1QH0 A;  1E63 A;  3LQE A;  1VQ7 B;  1UD6 A;  4XN0 A;  4Y9U A;  1KRH A;  5GV7 A;  4P6Y A;  1PJ7 A;  2GRE A;  2OBR A;  1I8D A;  1BLI A;  2DIE A;  4XLA A;  4FN5 A;  3ZIA A;  3QFR A;  4QUZ A;  5FIU A;  1VQ4 B;  1WOP A;  3OEE A;  4OPO A;  3CC2 B;  3CC4 B;  3KL9 A; 
#chains in the Genus database with same CATH homology
 1KZL A;  2W6I A;  2XOK A;  1VLY A;  2X53 S;  1HZE A;  1WTH D;  4G7W A;  1SKY B;  4DNT B;  3WQZ A;  2F1M A;  3CP2 A;  1MAB A;  3CMM A;  2CK3 A;  4B3F X;  4HIZ A;  2JJ1 A;  2WSS A;  4XD7 A;  1W0K A;  2ZTN A;  1COW A;  2X6W A;  3GVL A;  4G7X A;  3NE5 B;  2GJR A;  2ZXI A;  2WJV A;  3BC9 A;  2XZO A;  2W6J A;  2ZZF A;  3GQB A;  4XL9 A;  4FXU A;  3OOC A;  3FKS A;  4XOP A;  5IK2 A;  1VJS A;  1BPL A;  2X6Y A;  2F43 A;  2XND A;  1NRK A;  3OW7 A;  4YEL A;  2WPD A;  4XN3 A;  2X85 A;  4XKV A;  3DDY A;  1T5E A;  1W9X A;  4XLH A;  4KKU A;  2KVO A;  5CDF A;  3G05 A;  1V0E A;  4G6I A;  2X6X A;  4II2 A;  1UD2 A;  4DK0 A;  4YXW A;  1VF7 A;  5DN6 A;  1H8H A;  1OHH A;  2D3N A;  1WPC A;  1OB0 A;  4XOR A;  2ZTG A;  4DNR B;  1NBM A;  2GJK A;  3H94 A;  3GVJ A;  3OE7 A;  4P22 A;  2GJP A;  2XZL A;  2VJJ A;  3OFN A;  4E0F A;  2WZP P;  3LNN A;  4XMY A;  4XQF A;  4UZU A;  5FL7 A;  3A3G A;  1E79 A;  4JMQ A;  4XLE A;  2JDI A;  3A3B A;  3T56 B;  1PKV A;  3FPP A;  1H8E A;  3VR6 A;  1E3X A;  2LZJ A;  3JU4 A;  4XLC A;  3CP8 A;  1E1Q A;  1W0J A;  2E1B A;  3T53 B;  2V7Q A;  2V4D A;  1UD8 A;  4XM3 A;  4XLF A;  4XKW A;  2R9V A;  2XZP A;  2GK7 A;  3BH4 A;  2WJY A;  3HAG A;  3A35 A;  3CES A;  4XR6 A;  4ASU A;  3BCD A;  2V31 A;  5HKK A;  2HLD A;  3OAA A;  3T51 B;  1V0F A;  1UD4 A;  2ZZG A;  4XON A;  4AVZ A;  2JIZ A;  1HVX A;  2ZXH A;  4XOT A;  4KKS A;  1UD5 A;  1FX0 A;  1E3Z A;  4L8J A;  1WP6 A;  4GQN A;  2GK6 A;  2JJ2 A;  1E43 A;  1E1R A;  4II3 A;  4KKT A;  4XNF A;  2XGJ A;  2QE7 A;  2D3L A;  4TT3 A;  2VJI A;  2Z6B D;  2ZZQ A;  3BCF A;  4NNJ A;  4B3G A;  4TKO B;  1I18 A;  4Z1M A;  4YEJ A;  2ZZE A;  3KEW A;  4DK1 A;  4TSF A;  1UD3 A;  3OPO A;  1UD6 A;  3OEH A;  4XN0 A;  2X8K A;  1KMH A;  1I8D A;  1BLI A;  1K28 D;  2DIE A;  2M5S A;  4XLA A;  3ZIA A;  1EFR A;  3OEE A;  1BMF A;  3ZPN A;  3GVK A;  5KNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...