2M5SA

High-resolution nmr structure and cryo-em imaging support multiple functional roles for the accessory i-domain of phage p22 coat protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple Functional Roles of the Accessory I-Domain of Bacteriophage P22 Coat Protein Revealed by NMR Structure and CryoEM Modeling.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Viral protein
molecule keywords Coat protein
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.240 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2m5sA00
2M5SA
chains in the Genus database with same CATH superfamily
4TMZA 1UD5A 1VQMB 4RD2A 3AVTA 3AVXA 1CNEA 4PC2A 2XNCA 4Y9RA 2VJJA 3W2GA 1TTTA 1TLLA 2JN9A 4GQNA 4RDLA 2BN4A 5KNLA 4B44A 4II3A 1FRNA 1VQNB 1F20A 1N08A 2BPOA 4N3GA 1CQXA 4FWTA 3BNWA 2VYQA 4LC0A 4WZLA 3BQJA 2ZL7A 3W2IA 4XN0A 4YAUA 2WJYA 1B2RA 1W0KA 3NE5B 4DK1A 1Q9SA 3A8KA 2VBTA 1S72B 2HLDA 4C43A 5HXBA 3CCSB 3CCRB 1J9ZA 4XLCA 5FO1A 3ZUGA 3CXCB 3CPXA 3T51B 1Q81D 2JJ1A 1FRQA 4B3FX 3JU4A 3JQPA 4ZCLA 4C0SA 3SEJA 4II2A 1E62A 3I56B 2B7BA 3H94A 5F4OA 2WR8A 2ZZFA 3VO2A 3CMMA 3AVYA 4M4SA 1XQBA 4RCZA 4KKSA 3ASRA 4QFMA 1MRZA 3I1FA 5DS0A 3CCUB 1VQ5B 3GQBA 3OFNA 1YI2B 3CMEB 3LVBA 4RM0A 3OZWA 1BX1A 2QDXA 5A88A 4RD1A 3Q6RA 1T6ZA 4XNFA 4Z1MA 2GJRA 4J0QA 2GPJA 1JB9A 3E20A 4X06A 1PJ6A 2X3UA 5HKKA 2BF4A 3ZPNA 1UD3A 4ACAA 3A3GA 1W9XA 1VQ8B 2AHOA 2V31A 2OK7A 5FA6A 3FPPA 3ONUA 2WZPP 4OPOA 3OZVA 4PC3A 2YWHA 3LQ6A 4YELA 2DIEA 1TVCA 1QVFB 2OK8A 4XLHA 1T6XA 2XEXA 1W34A 1PJ5A 1QX4A 1DG1G 3GIRA 2C4TA 1Q7YD 2D74A 1BMFA 2ZXHA 3PA1A 1VJSA 4P6VF 4F7DA 3AVVA 2CC2A 1UD6A 4DK0A 1WSRA 4LBWA 4PAAA 2Q6OA 2J7KA 4WWVA 1WTHD 4RCYA 1P4MA 1VQ6B 2F1LA 2BV3A 2DYIA 3W2EA 3JQRA 2X85A 1YIJB 1GAWA 3QE2A 4X8IA 3G71B 1QH0A 1Y0YA 2JDIA 3LQEA 3U2QA 2Q6KA 5IK2A 2W6IA 3AVUA 2F4NA 4XLFA 2EFGA 2FX3A 3FJOA 1H8EA 4RLZA 3SLDA 1VQLB 2HCJB 3CC4B 3W5UA 1KMHA 3ZZTA 4X05A 4X7EA 1T6YA 1BX0A 1G7SA 1RQPA 1VHEA 3GVKA 1W2BB 1DDIA 4Z4ZA 1BJKA 2C4UA 3OJWA 3WNBA 1VQKB 1IJEA 1EFTA 1YJ9B 3OW7A 1W87A 4Z4WA 1JA1A 3V76A 1FNDA 1H8HA 4B47A 2C5HA 5KSWB 2ZZGA 1G7RA 2BGJA 2WPDA 2ZITA 2W6JA 5JBQA 3U6KA 2BMWA 1KK2A 1N06A 4E0FA 2V7UA 2B5OA 3KL9A 3PUMA 3BY2A 1KTVA 3A1PA 1N05A 3CB4A 4TMWA 1EFUA 1V0EA 2QN6A 4LBYA 4CQJA 4Z4TA 2V4DA 2PIAA 4G1VA 3ISXA 4XLEA 2XNJA 3WYAA 1M90D 1NRKA 4AVZA 4XONA 3QFRA 1V5VA 4P2NA 1K28D 4JMQA 1NB9A 1I7PA 1FNBA 4WZKA 5TV2A 3CCLB 5AN9A 1OB5A 1EP3B 4UAJA 4WZTA 2C2WA 4AC9A 4ZGQB 1XFOA 3CESA 4Z4SA 4G7WA 2PMDA 2DEUA 2YWGA 1D8TA 1ZM2A 2V7XA 4TMVA 3CMAB 3ES9A 3CP2A 1N07A 3ZZ0A 2X6WA 3Q39A 4XMYA 1DARA 3Q38A 3OZUA 5HZBA 4L8JA 1QFYA 1IJFA 1E3XA 2BSAA 3AGQA 3I55B 2XGJA 3ONYA 2R6HA 4PC1A 1G7TA 1MABA 1ZUNB 3DDYA 2XOKA 1SKQA 5DSZA 3MMPA 2BM0A 2OBTA 5J35A 4B4DA 1WOOA 3BY1A 1BLIA 1QG0A 5F4JA 2ZBVA 4FN5A 1QVGB 2WJVA 3WXMA 3W5VA 3U6BA 1GO2A 4U9UA 1NJID 2DY1A 4TT3A 1GAQA 4B3GA 1VF7A 4ROXA 4PC7A 3CW2A 1QUEA 1K73D 1QGAA 2GK6A 2OTLB 4XKVA 2VBSA 3P26A 1DDGA 1CNFA 4HE5A 3CTAA 4DQKA 1ZM3A 2GJPA 2ZTNA 3GVLA 5B6IA 1JJ2B 2EIXA 3MCAA 2F1MA 4DQLA 1VQ9B 4AF7A 1WOSA 2VBUA 3JQQA 2JJ2A 1FNMA 3VNVA 1F60A 2CBXA 2D3LA 2PE3A 1YHQB 1KC8D 2GJKA 3AGPA 3PVDA 1N0VC 1VHOA 4G7XA 2C78A 1UD8A 4BPRA 1PKVA 3R6JA 4QVJA 5IYWA 4P12A 4P9SA 4WZEA 2OYNA 1E43A 1WDTA 5FNZA 2X6YA 3OOCA 4X7CA 1QFZA 2C5BA 4M53A 2JIZA 4OOSA 4EH1A 5GV7A 3SKBA 4Z4UA 2VBVA 1QGZA 1KD1D 1I18A 1YLOA 4MYUA 3QFTA 3RY8A 1N0UA 1E64A 4P22A 2YWEA 2QE7A 5GV8A 3CP8A 3VO1A 1AIPA 3GVJA 3WBJA 1BPLA 1VQPB 3QFSA 1VQ7B 4WQMA 1AMOA 3SJZA 4XLAA 1UMKA 5CDFA 4OOXA 2LZJA 3ZBUA 2DOGA 2Q6IA 3ASTA 1HA3A 1HVXA 1H85A 1WOPA 4XM3A 4P6YA 4ZCMA 1RQRA 1KRHA 3CCMB 2OBSA 4TSFA 4X7DA 4G5GA 5BSXA 2B7CA 2Q6LA 2V7WA 2ZTGA 4M0LA 4OP7A 4QV2A 1HZEA 2BM1A 4UZEA 5TY0A 1WPCA 2WZNA 3LO8A 4RDJA 5IYRA 4N3NA 1IB0A 2P3MA 2VJIA 4LBZA 1EP1B 4H9GA 5F4MA 3WNCA 5IYQA 3B78A 4M2LA 4TMTA 2BGIA 4ZGNB 2E1RA 1GJRA 5FL7A 1YJWB 3SJPA 4FXUA 4HIZA 1BQEA 1H42A 1COWA 4XN3A 1YX2A 2VNKA 4G1BA 4PC6A 4ZV4A 1TUIA 1K9MD 1IHMA 1JNYA 1Q86D 1I8DA 5IYNA 5KW9A 2HDNB 4TKOB 4PGOA 3MHPA 3T53B 4QVAA 1KQSB 5IYPA 1W35A 5TRDA 1FX0A 2Z6BD 1JA0A 2NPFA 4B3XA 3WQZA 1KK0A 2X6XA 4X0CA 4YAWA 1NDHA 3ZZUA 1VLOA 4B48A 4RPBA 4MYTA 3ZC3A 5E6TA 3ASQA 1NB0A 3A35A 4K1XA 5HZAA 3ZIAA 1EXMA 4RDKA 2CNDA 1VQOB 2V7QA 4XQFA 3QSYA 4P25A 2ZL5A 1S0UA 3J81k 2X53S 4XR6A 5H59A 1E3ZA 2PLFA 3G4SB 4G6IA 3E1YE 1UD4A 1OB2A 3VR6A 3W2HA 4DNTB 4X07A 2ZZQA 5A89A 1S4MA 5LMZA 1OGIA 2KVOA 4Q7JB 1E1RA 3R6KA 1R5NA 2D3NA 2QTZA 4ACBA 4RD4A 3LNNA 3BH4A 1SM4A 3Q3AA 1EWYA 2FVGA 3CC7B 1KK3A 2HMAA 3OJXA 5H5JA 3B82A 4XOTA 2XNDA 5J3OA 2VNJA 2V7TA 5TR9A 1PJ7A 4NCNA 2RC6A 1XE1A 3ASSA 4UZFA 1QUFA 4B43A 2DERA 1EFRA 4XD7A 3WBKA 1E63A 5FIUA 4QHYA 1YITB 3CCQB 2E1BA 3CCVB 2CRVA 2QGGA 2VZLA 1GVHA 5DN6A 3FKSA 2DETA 1KJZA 1R5OA 4YXWA 4RD0A 1EP2B 4KKUA 3OPOA 4HE6A 4OOVA 3CCEB 1VQ4B 4XOPA 2NV4A 1NBMA 1D2EA 4Y9UA 2QEXB 2QTLA 1B23P 4YALA 4P3IA 4UZUA 1ZM9A 1ZM4A 3FPKA 1EFCA 2XZPA 4TN1A 4RJLA 2V7VA 3OW2B 3G05A 1WU8A 2M5SA 3OP1A 3ASPA 5FO0A 1VLYA 1SKYB 1WORA 4PABA 1T5EA 3OEHA 3P27A 1QFJA 4R71A 2VNIA 2XZOA 1Y0RA 4P26A 1GR1A 2GQFA 4AF6A 2QMUA 3BCDA 4P1VA 3SLNA 1FDRA 4Z4YA 3CPWB 1E1QA 4Y7CA 1WP6A 2VNHA 3V7AA 1KK1A 1R5BA 2GK7A 1OHHA 3D26A 4YEJA 1OGJA 3OE7A 5A8AA 1E79A 2WSSA 3Q6QA 4IW3B 4QUZA 2D9RA 3HAGA 1K8AD 1YJNB 2BVNA 4TMXA 3PA2A 4YAOA 2ZZEA 3CRZA 2CW5A 1QGYA 1W0JA 4RD6A 4XORA 2XZLA 3H9NA 1XB2A 3WY9A 3AVWA 4OPSA 3QFCA 4NBSA 4ZCIA 2WYRA 1KZLA 3KEWA 4KKTA 3W2FA 3A3BA 3A8IA 5EMNA 2OTJB 1OB0A 2RC5A 1V0FA 2R9VA 4OPVA 2ZBUA 1U2RA 3GSIA 3BC9A 5THXA 2GREA 3G6EB 3VNUA 4Z4VA 3W5HA 2C77A 1N8RD 4DNRB 3OKXA 3CD6B 1D1NA 2X0KA 1FNCA 3PENA 4M1KA 2X8KA 3CC2B 3OAAA 1WSVA 2DCUA 4RD3A 4NNJA 2F43A 4P3YA 2OBRA 2QA4B 2I1LA 1G7CA 4ASUA 4X7FA 4YAFA 4YHBA 1UD2A 3B8HA 4RPDA 3BCFA 1Q82D 2YWFA 3ZBTA 1A8PA 3A8JA 2CF4A 3WNDA 3VMFA 3PUNA 5BSYA 4XL9A 1M1KD 3CCJB 4LBVA 3T56B 4XKWA 2ZL6A 2ZXIA 5L46A 4FK8A 1ELOA 3OEEA 4Z4RA 2CK3A
chains in the Genus database with same CATH topology
1I18A 3GVKA 1EFRA 1UD5A 4XD7A 2E1BA 2VJJA 5DN6A 3OW7A 3FKSA 2QE7A 4P22A 3CP8A 4GQNA 4YXWA 1H8HA 3GVJA 5KNLA 4KKUA 1BPLA 2ZZGA 2WPDA 3OPOA 2W6JA 4II3A 4XOPA 1NBMA 4E0FA 4XLAA 5CDFA 3OEEA 4UZUA 2LZJA 1V0EA 4XN0A 1HVXA 2WJYA 2XZPA 2V4DA 1W0KA 3NE5B 4XM3A 4DK1A 3G05A 2M5SA 2HLDA 1VLYA 4XLCA 1SKYB 1T5EA 3OEHA 4TSFA 3T51B 4XLEA 2XZOA 2JJ1A 1NRKA 4AVZA 4XONA 4B3FX 3JU4A 2ZTGA 1HZEA 1WPCA 4II2A 3H94A 2VJIA 2ZZFA 3CMMA 1K28D 4JMQA 3BCDA 1E1QA 4KKSA 5FL7A 1WP6A 4FXUA 4HIZA 3GQBA 2GK7A 1COWA 1OHHA 3CESA 3OFNA 4XN3A 4YEJA 3OE7A 4G7WA 1E79A 2WSSA 3HAGA 4XNFA 3CP2A 2ZZEA 2GJRA 4Z1MA 2X6WA 1W0JA 4XMYA 4XORA 1I8DA 2XZLA 4L8JA 1E3XA 5HKKA 2XGJA 4TKOB 3T53B 1UD3A 3ZPNA 3A3GA 1MABA 1W9XA 3DDYA 2V31A 2XOKA 3FPPA 1KZLA 1FX0A 2Z6BD 3KEWA 4KKTA 2WZPP 3WQZA 1BLIA 2X6XA 3A3BA 4YELA 2WJVA 1OB0A 2DIEA 1V0FA 2R9VA 4B3GA 4XLHA 3BC9A 3A35A 4TT3A 1VF7A 3ZIAA 2V7QA 1BMFA 2GK6A 4DNRB 4XQFA 4XKVA 2ZXHA 2X8KA 1VJSA 3OAAA 2X53S 4XR6A 2GJPA 1E3ZA 2ZTNA 1UD6A 3GVLA 4NNJA 4DK0A 4G6IA 2F1MA 1UD4A 2F43A 3VR6A 4DNTB 1WTHD 2JJ2A 2ZZQA 2KVOA 2X85A 4ASUA 2D3LA 1E1RA 1UD2A 2GJKA 2D3NA 2JDIA 3BCFA 5IK2A 2W6IA 3LNNA 4G7XA 3BH4A 1UD8A 4XLFA 1PKVA 1H8EA 4XL9A 4XOTA 2XNDA 1E43A 3T56B 4XKWA 2ZXIA 2X6YA 3OOCA 1KMHA 2JIZA 2CK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5S A; 
#chains in the Genus database with same CATH topology
 4TMZ A;  1UD5 A;  1VQM B;  4RD2 A;  3AVT A;  3AVX A;  1CNE A;  4PC2 A;  2XNC A;  4Y9R A;  2VJJ A;  3W2G A;  1TTT A;  1TLL A;  2JN9 A;  4GQN A;  4RDL A;  2BN4 A;  5KNL A;  4B44 A;  4II3 A;  1FRN A;  1VQN B;  1F20 A;  1N08 A;  2BPO A;  4N3G A;  1CQX A;  4FWT A;  3BNW A;  2VYQ A;  4LC0 A;  4WZL A;  3BQJ A;  2ZL7 A;  3W2I A;  4XN0 A;  4YAU A;  2WJY A;  1B2R A;  1W0K A;  3NE5 B;  4DK1 A;  1Q9S A;  3A8K A;  2VBT A;  1S72 B;  2HLD A;  4C43 A;  5HXB A;  3CCS B;  3CCR B;  1J9Z A;  4XLC A;  5FO1 A;  3ZUG A;  3CXC B;  3CPX A;  3T51 B;  1Q81 D;  2JJ1 A;  1FRQ A;  4B3F X;  3JU4 A;  3JQP A;  4ZCL A;  4C0S A;  3SEJ A;  4II2 A;  1E62 A;  3I56 B;  2B7B A;  3H94 A;  5F4O A;  2WR8 A;  2ZZF A;  3VO2 A;  3CMM A;  3AVY A;  4M4S A;  1XQB A;  4RCZ A;  4KKS A;  3ASR A;  4QFM A;  1MRZ A;  3I1F A;  5DS0 A;  3CCU B;  1VQ5 B;  3GQB A;  3OFN A;  1YI2 B;  3CME B;  3LVB A;  4RM0 A;  3OZW A;  1BX1 A;  2QDX A;  5A88 A;  4RD1 A;  3Q6R A;  1T6Z A;  4XNF A;  4Z1M A;  2GJR A;  4J0Q A;  2GPJ A;  1JB9 A;  3E20 A;  4X06 A;  1PJ6 A;  2X3U A;  5HKK A;  2BF4 A;  3ZPN A;  1UD3 A;  4ACA A;  3A3G A;  1W9X A;  1VQ8 B;  2AHO A;  2V31 A;  2OK7 A;  5FA6 A;  3FPP A;  3ONU A;  2WZP P;  4OPO A;  3OZV A;  4PC3 A;  2YWH A;  3LQ6 A;  4YEL A;  2DIE A;  1TVC A;  1QVF B;  2OK8 A;  4XLH A;  1T6X A;  2XEX A;  1W34 A;  1PJ5 A;  1QX4 A;  1DG1 G;  3GIR A;  2C4T A;  1Q7Y D;  2D74 A;  1BMF A;  2ZXH A;  3PA1 A;  1VJS A;  4P6V F;  4F7D A;  3AVV A;  2CC2 A;  1UD6 A;  4DK0 A;  1WSR A;  4LBW A;  4PAA A;  2Q6O A;  2J7K A;  4WWV A;  1WTH D;  4RCY A;  1P4M A;  1VQ6 B;  2F1L A;  2BV3 A;  2DYI A;  3W2E A;  3JQR A;  2X85 A;  1YIJ B;  1GAW A;  3QE2 A;  4X8I A;  3G71 B;  1QH0 A;  1Y0Y A;  2JDI A;  3LQE A;  3U2Q A;  2Q6K A;  5IK2 A;  2W6I A;  3AVU A;  2F4N A;  4XLF A;  2EFG A;  2FX3 A;  3FJO A;  1H8E A;  4RLZ A;  3SLD A;  1VQL B;  2HCJ B;  3CC4 B;  3W5U A;  1KMH A;  3ZZT A;  4X05 A;  4X7E A;  1T6Y A;  1BX0 A;  1G7S A;  1RQP A;  1VHE A;  3GVK A;  1W2B B;  1DDI A;  4Z4Z A;  1BJK A;  2C4U A;  3OJW A;  3WNB A;  1VQK B;  1IJE A;  1EFT A;  1YJ9 B;  3OW7 A;  1W87 A;  4Z4W A;  1JA1 A;  3V76 A;  1FND A;  1H8H A;  4B47 A;  2C5H A;  5KSW B;  2ZZG A;  1G7R A;  2BGJ A;  2WPD A;  2ZIT A;  2W6J A;  5JBQ A;  3U6K A;  2BMW A;  1KK2 A;  1N06 A;  4E0F A;  2V7U A;  2B5O A;  3KL9 A;  3PUM A;  3BY2 A;  1KTV A;  3A1P A;  1N05 A;  3CB4 A;  4TMW A;  1EFU A;  1V0E A;  2QN6 A;  4LBY A;  4CQJ A;  4Z4T A;  2V4D A;  2PIA A;  4G1V A;  3ISX A;  4XLE A;  2XNJ A;  3WYA A;  1M90 D;  1NRK A;  4AVZ A;  4XON A;  3QFR A;  1V5V A;  4P2N A;  1K28 D;  4JMQ A;  1NB9 A;  1I7P A;  1FNB A;  4WZK A;  5TV2 A;  3CCL B;  5AN9 A;  1OB5 A;  1EP3 B;  4UAJ A;  4WZT A;  2C2W A;  4AC9 A;  4ZGQ B;  1XFO A;  3CES A;  4Z4S A;  4G7W A;  2PMD A;  2DEU A;  2YWG A;  1D8T A;  1ZM2 A;  2V7X A;  4TMV A;  3CMA B;  3ES9 A;  3CP2 A;  1N07 A;  3ZZ0 A;  2X6W A;  3Q39 A;  4XMY A;  1DAR A;  3Q38 A;  3OZU A;  5HZB A;  4L8J A;  1QFY A;  1IJF A;  1E3X A;  2BSA A;  3AGQ A;  3I55 B;  2XGJ A;  3ONY A;  2R6H A;  4PC1 A;  1G7T A;  1MAB A;  1ZUN B;  3DDY A;  2XOK A;  1SKQ A;  5DSZ A;  3MMP A;  2BM0 A;  2OBT A;  5J35 A;  4B4D A;  1WOO A;  3BY1 A;  1BLI A;  1QG0 A;  5F4J A;  2ZBV A;  4FN5 A;  1QVG B;  2WJV A;  3WXM A;  3W5V A;  3U6B A;  1GO2 A;  4U9U A;  1NJI D;  2DY1 A;  4TT3 A;  1GAQ A;  4B3G A;  1VF7 A;  4ROX A;  4PC7 A;  3CW2 A;  1QUE A;  1K73 D;  1QGA A;  2GK6 A;  2OTL B;  4XKV A;  2VBS A;  3P26 A;  1DDG A;  1CNF A;  4HE5 A;  3CTA A;  4DQK A;  1ZM3 A;  2GJP A;  2ZTN A;  3GVL A;  5B6I A;  1JJ2 B;  2EIX A;  3MCA A;  2F1M A;  4DQL A;  1VQ9 B;  4AF7 A;  1WOS A;  2VBU A;  3JQQ A;  2JJ2 A;  1FNM A;  3VNV A;  1F60 A;  2CBX A;  2D3L A;  2PE3 A;  1YHQ B;  1KC8 D;  2GJK A;  3AGP A;  3PVD A;  1N0V C;  1VHO A;  4G7X A;  2C78 A;  1UD8 A;  4BPR A;  1PKV A;  3R6J A;  4QVJ A;  5IYW A;  4P12 A;  4P9S A;  4WZE A;  2OYN A;  1E43 A;  1WDT A;  5FNZ A;  2X6Y A;  3OOC A;  4X7C A;  1QFZ A;  2C5B A;  4M53 A;  2JIZ A;  4OOS A;  4EH1 A;  5GV7 A;  3SKB A;  4Z4U A;  2VBV A;  1QGZ A;  1KD1 D;  1I18 A;  1YLO A;  4MYU A;  3QFT A;  3RY8 A;  1N0U A;  1E64 A;  4P22 A;  2YWE A;  2QE7 A;  5GV8 A;  3CP8 A;  3VO1 A;  1AIP A;  3GVJ A;  3WBJ A;  1BPL A;  1VQP B;  3QFS A;  1VQ7 B;  4WQM A;  1AMO A;  3SJZ A;  4XLA A;  1UMK A;  5CDF A;  4OOX A;  2LZJ A;  3ZBU A;  2DOG A;  2Q6I A;  3AST A;  1HA3 A;  1HVX A;  1H85 A;  1WOP A;  4XM3 A;  4P6Y A;  4ZCM A;  1RQR A;  1KRH A;  3CCM B;  2OBS A;  4TSF A;  4X7D A;  4G5G A;  5BSX A;  2B7C A;  2Q6L A;  2V7W A;  2ZTG A;  4M0L A;  4OP7 A;  4QV2 A;  1HZE A;  2BM1 A;  4UZE A;  5TY0 A;  1WPC A;  2WZN A;  3LO8 A;  4RDJ A;  5IYR A;  4N3N A;  1IB0 A;  2P3M A;  2VJI A;  4LBZ A;  1EP1 B;  4H9G A;  5F4M A;  3WNC A;  5IYQ A;  3B78 A;  4M2L A;  4TMT A;  2BGI A;  4ZGN B;  2E1R A;  1GJR A;  5FL7 A;  1YJW B;  3SJP A;  4FXU A;  4HIZ A;  1BQE A;  1H42 A;  1COW A;  4XN3 A;  1YX2 A;  2VNK A;  4G1B A;  4PC6 A;  4ZV4 A;  1TUI A;  1K9M D;  1IHM A;  1JNY A;  1Q86 D;  1I8D A;  5IYN A;  5KW9 A;  2HDN B;  4TKO B;  4PGO A;  3MHP A;  3T53 B;  4QVA A;  1KQS B;  5IYP A;  1W35 A;  5TRD A;  1FX0 A;  2Z6B D;  1JA0 A;  2NPF A;  4B3X A;  3WQZ A;  1KK0 A;  2X6X A;  4X0C A;  4YAW A;  1NDH A;  3ZZU A;  1VLO A;  4B48 A;  4RPB A;  4MYT A;  3ZC3 A;  5E6T A;  3ASQ A;  1NB0 A;  3A35 A;  4K1X A;  5HZA A;  3ZIA A;  1EXM A;  4RDK A;  2CND A;  1VQO B;  2V7Q A;  4XQF A;  3QSY A;  4P25 A;  2ZL5 A;  1S0U A;  3J81 k;  2X53 S;  4XR6 A;  5H59 A;  1E3Z A;  2PLF A;  3G4S B;  4G6I A;  3E1Y E;  1UD4 A;  1OB2 A;  3VR6 A;  3W2H A;  4DNT B;  4X07 A;  2ZZQ A;  5A89 A;  1S4M A;  5LMZ A;  1OGI A;  2KVO A;  4Q7J B;  1E1R A;  3R6K A;  1R5N A;  2D3N A;  2QTZ A;  4ACB A;  4RD4 A;  3LNN A;  3BH4 A;  1SM4 A;  3Q3A A;  1EWY A;  2FVG A;  3CC7 B;  1KK3 A;  2HMA A;  3OJX A;  5H5J A;  3B82 A;  4XOT A;  2XND A;  5J3O A;  2VNJ A;  2V7T A;  5TR9 A;  1PJ7 A;  4NCN A;  2RC6 A;  1XE1 A;  3ASS A;  4UZF A;  1QUF A;  4B43 A;  2DER A;  1EFR A;  4XD7 A;  3WBK A;  1E63 A;  5FIU A;  4QHY A;  1YIT B;  3CCQ B;  2E1B A;  3CCV B;  2CRV A;  2QGG A;  2VZL A;  1GVH A;  5DN6 A;  3FKS A;  2DET A;  1KJZ A;  1R5O A;  4YXW A;  4RD0 A;  1EP2 B;  4KKU A;  3OPO A;  4HE6 A;  4OOV A;  3CCE B;  1VQ4 B;  4XOP A;  2NV4 A;  1NBM A;  1D2E A;  4Y9U A;  2QEX B;  2QTL A;  1B23 P;  4YAL A;  4P3I A;  4UZU A;  1ZM9 A;  1ZM4 A;  3FPK A;  1EFC A;  2XZP A;  4TN1 A;  4RJL A;  2V7V A;  3OW2 B;  3G05 A;  1WU8 A;  2M5S A;  3OP1 A;  3ASP A;  5FO0 A;  1VLY A;  1SKY B;  1WOR A;  4PAB A;  1T5E A;  3OEH A;  3P27 A;  1QFJ A;  4R71 A;  2VNI A;  2XZO A;  1Y0R A;  4P26 A;  1GR1 A;  2GQF A;  4AF6 A;  2QMU A;  3BCD A;  4P1V A;  3SLN A;  1FDR A;  4Z4Y A;  3CPW B;  1E1Q A;  4Y7C A;  1WP6 A;  2VNH A;  3V7A A;  1KK1 A;  1R5B A;  2GK7 A;  1OHH A;  3D26 A;  4YEJ A;  1OGJ A;  3OE7 A;  5A8A A;  1E79 A;  2WSS A;  3Q6Q A;  4IW3 B;  4QUZ A;  2D9R A;  3HAG A;  1K8A D;  1YJN B;  2BVN A;  4TMX A;  3PA2 A;  4YAO A;  2ZZE A;  3CRZ A;  2CW5 A;  1QGY A;  1W0J A;  4RD6 A;  4XOR A;  2XZL A;  3H9N A;  1XB2 A;  3WY9 A;  3AVW A;  4OPS A;  3QFC A;  4NBS A;  4ZCI A;  2WYR A;  1KZL A;  3KEW A;  4KKT A;  3W2F A;  3A3B A;  3A8I A;  5EMN A;  2OTJ B;  1OB0 A;  2RC5 A;  1V0F A;  2R9V A;  4OPV A;  2ZBU A;  1U2R A;  3GSI A;  3BC9 A;  5THX A;  2GRE A;  3G6E B;  3VNU A;  4Z4V A;  3W5H A;  2C77 A;  1N8R D;  4DNR B;  3OKX A;  3CD6 B;  1D1N A;  2X0K A;  1FNC A;  3PEN A;  4M1K A;  2X8K A;  3CC2 B;  3OAA A;  1WSV A;  2DCU A;  4RD3 A;  4NNJ A;  2F43 A;  4P3Y A;  2OBR A;  2QA4 B;  2I1L A;  1G7C A;  4ASU A;  4X7F A;  4YAF A;  4YHB A;  1UD2 A;  3B8H A;  4RPD A;  3BCF A;  1Q82 D;  2YWF A;  3ZBT A;  1A8P A;  3A8J A;  2CF4 A;  3WND A;  3VMF A;  3PUN A;  5BSY A;  4XL9 A;  1M1K D;  3CCJ B;  4LBV A;  3T56 B;  4XKW A;  2ZL6 A;  2ZXI A;  5L46 A;  4FK8 A;  1ELO A;  3OEE A;  4Z4R A;  2CK3 A; 
#chains in the Genus database with same CATH homology
 1I18 A;  3GVK A;  1EFR A;  1UD5 A;  4XD7 A;  2E1B A;  2VJJ A;  5DN6 A;  3OW7 A;  3FKS A;  2QE7 A;  4P22 A;  3CP8 A;  4GQN A;  4YXW A;  1H8H A;  3GVJ A;  5KNL A;  4KKU A;  1BPL A;  2ZZG A;  2WPD A;  3OPO A;  2W6J A;  4II3 A;  4XOP A;  1NBM A;  4E0F A;  4XLA A;  5CDF A;  3OEE A;  4UZU A;  2LZJ A;  1V0E A;  4XN0 A;  1HVX A;  2WJY A;  2XZP A;  2V4D A;  1W0K A;  3NE5 B;  4XM3 A;  4DK1 A;  3G05 A;  2M5S A;  2HLD A;  1VLY A;  4XLC A;  1SKY B;  1T5E A;  3OEH A;  4TSF A;  3T51 B;  4XLE A;  2XZO A;  2JJ1 A;  1NRK A;  4AVZ A;  4XON A;  4B3F X;  3JU4 A;  2ZTG A;  1HZE A;  1WPC A;  4II2 A;  3H94 A;  2VJI A;  2ZZF A;  3CMM A;  1K28 D;  4JMQ A;  3BCD A;  1E1Q A;  4KKS A;  5FL7 A;  1WP6 A;  4FXU A;  4HIZ A;  3GQB A;  2GK7 A;  1COW A;  1OHH A;  3CES A;  3OFN A;  4XN3 A;  4YEJ A;  3OE7 A;  4G7W A;  1E79 A;  2WSS A;  3HAG A;  4XNF A;  3CP2 A;  2ZZE A;  2GJR A;  4Z1M A;  2X6W A;  1W0J A;  4XMY A;  4XOR A;  1I8D A;  2XZL A;  4L8J A;  1E3X A;  5HKK A;  2XGJ A;  4TKO B;  3T53 B;  1UD3 A;  3ZPN A;  3A3G A;  1MAB A;  1W9X A;  3DDY A;  2V31 A;  2XOK A;  3FPP A;  1KZL A;  1FX0 A;  2Z6B D;  3KEW A;  4KKT A;  2WZP P;  3WQZ A;  1BLI A;  2X6X A;  3A3B A;  4YEL A;  2WJV A;  1OB0 A;  2DIE A;  1V0F A;  2R9V A;  4B3G A;  4XLH A;  3BC9 A;  3A35 A;  4TT3 A;  1VF7 A;  3ZIA A;  2V7Q A;  1BMF A;  2GK6 A;  4DNR B;  4XQF A;  4XKV A;  2ZXH A;  2X8K A;  1VJS A;  3OAA A;  2X53 S;  4XR6 A;  2GJP A;  1E3Z A;  2ZTN A;  1UD6 A;  3GVL A;  4NNJ A;  4DK0 A;  4G6I A;  2F1M A;  1UD4 A;  2F43 A;  3VR6 A;  4DNT B;  1WTH D;  2JJ2 A;  2ZZQ A;  2KVO A;  2X85 A;  4ASU A;  2D3L A;  1E1R A;  1UD2 A;  2GJK A;  2D3N A;  2JDI A;  3BCF A;  5IK2 A;  2W6I A;  3LNN A;  4G7X A;  3BH4 A;  1UD8 A;  4XLF A;  1PKV A;  1H8E A;  4XL9 A;  4XOT A;  2XND A;  1E43 A;  3T56 B;  4XKW A;  2ZXI A;  2X6Y A;  3OOC A;  1KMH A;  2JIZ A;  2CK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...