2M5SA

High-resolution nmr structure and cryo-em imaging support multiple functional roles for the accessory i-domain of phage p22 coat protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'GSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coat protein
molecule tags Viral protein
source organism Enterobacteria phage p22
publication title Multiple Functional Roles of the Accessory I-Domain of Bacteriophage P22 Coat Protein Revealed by NMR Structure and CryoEM Modeling.
pubmed doi rcsb
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.240 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2m5sA00
2M5SA
chains in the Genus database with same CATH superfamily
4XQFA 1VQ4B 5IYQA 2EIXA 3T53B 1WOSA 2OK7A 3NE5B 5THXA 1Y0RA 4AVZA 4ASUA 2BPOA 4XLHA 2VJIA 3MMPA 3BH4A 3CP2A 2F1MA 4B4DA 3E1YE 4G5GA 4P3YA 3A8JA 1QVFB 1FNDA 4X05A 1D8TA 4NCNA 3OJXA 4RLZA 2OTJB 1OB0A 2C4TA 2C5HA 1KC8D 3BCDA 3FJOA 4LBWA 2BM0A 1VHEA 1E1QA 4G1BA 3G6EB 2BGIA 3G71B 4Z4YA 2QTZA 3PA1A 3CC4B 2VNKA 2HLDA 4J0QA 1CNFA 3JQQA 3PVDA 1G7RA 4XLEA 1YJWB 1I18A 2VBUA 2Z6BD 1K9MD 1E79A 5BSYA 1KZLA 1F20A 4KKTA 4Y7CA 5FIUA 2YWFA 3AGPA 5B6IA 1ZM4A 2B5OA 5J35A 1WPCA 4B3FX 3CC7B 4TKOB 1DDIA 3Q6QA 1E1RA 1S4MA 4YXWA 1HZEA 1KJZA 1UD8A 2XGJA 2D3NA 2V7QA 3GVLA 2ZITA 2DYIA 2ZZQA 2JJ2A 1I7PA 4XLFA 2FVGA 4PAAA 4AF6A 1VQ7B 2BVNA 2X6XA 3SJZA 1R5NA 3SLDA 3ZZ0A 1FRNA 2X6WA 4HIZA 1EP1B 1BPLA 1H85A 2Q6LA 4E0FA 3AVXA 3W2FA 2QA4B 4RPBA 2AHOA 4XN3A 1XQBA 1VQ8B 2F4NA 1UD2A 1WSRA 1N0UA 3BC9A 3BNWA 4TSFA 4YELA 4II2A 1H8HA 1V0EA 3CCRB 3P27A 3G05A 5BSXA 4WZKA 1WORA 3FPKA 1FRQA 1QVGB 1G7CA 2QDXA 3WQZA 2BN4A 3PUMA 2JN9A 4FK8A 3J81k 1EWYA 2GJRA 1EFRA 1R5BA 3QFTA 4KKSA 4II3A 4P1VA 3B82A 4DQKA 1QGAA 3U2QA 1BMFA 2GK7A 4DQLA 4B3XA 2JJ1A 4U9UA 2BMWA 1AIPA 4XOPA 4OPSA 1GAWA 2VYQA 5HZAA 3GQBA 4X07A 3KL9A 1W2BB 3OEHA 2W6JA 2QEXB 2OYNA 3AVUA 1OHHA 2B7BA 5A8AA 3AVVA 2GJKA 3LNNA 1N05A 1QGZA 2V7VA 5E6TA 3ZZUA 5J3OA 1GJRA 4X7DA 1VQ9B 1Q9SA 3KEWA 4OP7A 1KK0A 3FKSA 4M1KA 4WZEA 3I1FA 2DCUA 4C43A 4MYTA 1YLOA 2ZBUA 3OZVA 3ZIAA 2XNJA 5KNLA 4DNRB 3ZBTA 3QFCA 2OBRA 1UD5A 5F4MA 2ZZEA 2W6IA 2FX3A 4Z4SA 2QE7A 1VQNB 1B23P 2DETA 1NJID 3CCEB 4TMTA 1K8AD 2QTLA 3Q38A 3CPWB 3CCSB 4EH1A 1GVHA 2CBXA 1ELOA 1E64A 1TLLA 2ZXIA 1BLIA 5HXBA 2YWEA 1NB9A 2M5SA 1F60A 1ZM3A 3SLNA 5GV8A 4Z1MA 1E3XA 1KMHA 3ASPA 3OJWA 3CCUB 1VJSA 3LQEA 4ZCIA 5TRDA 5HZBA 1W34A 1J9ZA 4UAJA 4XM3A 2BM1A 2BF4A 2XNDA 4RDJA 2PIAA 1E3ZA 2GQFA 1TVCA 3OZWA 4Q7JB 3VO2A 2XEXA 1VQLB 1QUFA 4P6VF 2BV3A 2OBTA 4GQNA 3RY8A 4XOTA 1BJKA 1K28D 2CRVA 4XLCA 5FNZA 2XZLA 5DSZA 3ZZTA 2C5BA 3ONUA 1KTVA 3OFNA 4NNJA 3CMMA 1WDTA 2V7TA 3BQJA 4TMWA 5L46A 4B47A 1E43A 5DN6A 1VLYA 1T6XA 2WPDA 5TR9A 4AC9A 4NBSA 2HCJB 4WQMA 3D26A 1KRHA 2WJYA 1D1NA 1NRKA 2F43A 4HE6A 1RQRA 1EP2B 5FO0A 3W5VA 2YWGA 2NPFA 2XOKA 3Q39A 3WXMA 1G7SA 3HAGA 1FNCA 3Q3AA 4OOVA 2HDNB 3A3BA 3BCFA 4WZTA 5TY0A 3DDYA 5CDFA 4Z4UA 4B43A 3ZUGA 1D2EA 1G7TA 1NB0A 1EFTA 4B48A 3JQRA 4P2NA 1VQKB 4RD4A 3CCMB 3W5UA 2QMUA 4XLAA 1ZM9A 4C0SA 1PJ5A 1YJNB 2NV4A 1YJ9B 4XKWA 1XB2A 2ZBVA 2C77A 4WZLA 4ACAA 1OGJA 3WY9A 3GVKA 2RC6A 1DDGA 4ROXA 5F4JA 1EFCA 1SM4A 3ES9A 5KSWB 3CD6B 1YX2A 1VF7A 1YHQB 4OPVA 1FNMA 1MABA 1W0JA 1ZM2A 3VNUA 1V0FA 3A3GA 3ASRA 3JQPA 1RQPA 1GO2A 3A1PA 1KK3A 3OKXA 1M90D 3I56B 1KK2A 1TTTA 1KQSB 2BGJA 4P12A 3WNBA 4M2LA 4YHBA 4TN1A 1A8PA 1W35A 2CK3A 3SEJA 1QH0A 1HVXA 5IYPA 4R71A 2ZZGA 2ZL7A 5A88A 3Q6RA 1YI2B 4XR6A 1W0KA 4G6IA 2V7UA 4WWVA 1FDRA 4OOSA 3U6BA 3W2IA 2DY1A 3W2HA 1MRZA 1IJFA 2C78A 3OEEA 1S0UA 3T56B 4M0LA 2V7XA 3CESA 4XMYA 1DG1G 4QV2A 1N8RD 2R6HA 2GPJA 4PC1A 2R9VA 2X0KA 3CCJB 3OP1A 4BPRA 3CP8A 1WU8A 3H94A 1XE1A 2PMDA 3SKBA 4X06A 2Q6KA 2P3MA 1ZUNB 4ZGQB 1KK1A 1OGIA 1PJ6A 1R5OA 4FXUA 3T51B 3AGQA 4TT3A 3U6KA 4PC3A 4RDKA 2DEUA 4Z4WA 1JJ2B 1T6ZA 2HMAA 4M53A 3VR6A 3A8IA 3R6KA 1FX0A 2GREA 2VBTA 1QGYA 3BY1A 3WNDA 2BSAA 1GR1A 5TV2A 3ZPNA 2DERA 2OBSA 2WSSA 1N0VC 2V31A 2RC5A 3CRZA 4RPDA 4UZFA 4X7CA 5IK2A 3LVBA 1YITB 1H42A 4RCYA 1T5EA 2LZJA 4X8IA 2OK8A 4LBVA 3CW2A 2XZPA 4Z4VA 1H8EA 2VBVA 2WJVA 1QUEA 5DS0A 3VO1A 1VQOB 1COWA 4XN0A 1VQ5B 3AVYA 4N3GA 3CTAA 1BQEA 2PLFA 4YAWA 4TMVA 3OW2B 4RD3A 2JIZA 3WYAA 4YAFA 3CCQB 3CMAB 4RD1A 3ASQA 4K1XA 2X6YA 1N07A 1EFUA 2CNDA 2F1LA 3ASSA 1GAQA 3CPXA 4UZUA 5HKKA 1XFOA 1IHMA 4PGOA 3PUNA 2WZPP 4ZGNB 4P26A 4YEJA 2VJJA 2D9RA 4XD7A 2WZNA 1JB9A 4XKVA 3PENA 4Z4TA 1S72B 4DNTB 1CQXA 4RD6A 1NDHA 3B78A 4MYUA 4P25A 3GSIA 3OZUA 4DK0A 2EFGA 4QHYA 3W5HA 5IYRA 1EP3B 4QFMA 3ONYA 3WBKA 1W9XA 3QFRA 1YIJB 4ACBA 3LO8A 5IYWA 2X53S 4AF7A 2CF4A 2QGGA 1WP6A 3GIRA 2D74A 4PABA 5GV7A 4RD0A 3OW7A 1WOOA 3E20A 4Z4RA 3JU4A 4IW3B 5H5JA 5LMZA 3QSYA 4P9SA 4G7WA 4KKUA 5KW9A 1M1KD 2DIEA 5FA6A 1UD4A 2YWHA 4PC6A 4X7FA 3W2GA 3ZBUA 2J7KA 1OB2A 1EXMA 1VHOA 4RM0A 4F7DA 4XONA 1QG0A 1BX1A 3CCLB 4DK1A 3CMEB 2GJPA 1JA0A 2X8KA 2ZL6A 1V5VA 4UZEA 4LBZA 3ISXA 4XNFA 2CW5A 3CC2B 5FO1A 2VNJA 2VZLA 4ZCLA 1I8DA 4OPOA 1SKQA 1E62A 4HE5A 2ZL5A 5IYNA 1Q81D 1BX0A 2KVOA 5JBQA 2XZOA 4FN5A 3ASTA 2WYRA 4P22A 1P4MA 4H9GA 2ZXHA 4X0CA 2V7WA 1JNYA 2I1LA 2E1BA 4CQJA 3CXCB 1QFJA 4G7XA 1FNBA 2VNHA 3A35A 3GVJA 4FWTA 1DARA 4P6YA 3OOCA 1Q86D 2VNIA 1E63A 2QN6A 2WR8A 4LBYA 2C2WA 4P3IA 3ZC3A 4M4SA 3CCVB 2JDIA 2X85A 2X3UA 1IJEA 4PC7A 2VBSA 4QVJA 4TMXA 1AMOA 1Q82D 2XNCA 1QX4A 1VQMB 1PJ7A 3P26A 4RCZA 1W87A 4XORA 2B7CA 5AN9A 3QFSA 1KD1D 3QE2A 4RDLA 3SJPA 4Y9UA 1QFYA 3VMFA 1CNEA 1HA3A 1IB0A 3FPPA 1Q7YD 3PA2A 3R6JA 1WTHD 2Q6IA 3H9NA 3AVWA 3LQ6A 2PE3A 3V7AA 3MHPA 2ZZFA 3AVTA 2E1RA 1PKVA 4QVAA 1N06A 4N3NA 4Y9RA 5EMNA 3G4SB 1WOPA 5A89A 1UMKA 1U2RA 4XL9A 3I55B 2ZTNA 3WNCA 4YALA 1N08A 1VLOA 3A8KA 4L8JA 4B3GA 1Y0YA 1SKYB 2D3LA 4RJLA 2V4DA 1UD6A 4TMZA 4G1VA 4ZV4A 1UD3A 2C4UA 3B8HA 3CB4A 2Q6OA 4RD2A 2ZTGA 2CC2A 2OTLB 1WSVA 1VQ6B 1TUIA 4ZCMA 4Z4ZA 1VQPB 3OPOA 4YAUA 1K73D 1NBMA 3VNVA 1JA1A 3W2EA 4JMQA 4OOXA 3BY2A 3OE7A 5H59A 1T6YA 3V76A 2GK6A 4YAOA 4PC2A 1QFZA 4X7EA 3MCAA 3OAAA 5F4OA 5FL7A 3WBJA 1OB5A 4LC0A 4QUZA 4B44A 1B2RA 2DOGA
chains in the Genus database with same CATH topology
4XQFA 1WP6A 3T53B 3NE5B 4AVZA 3ZIAA 3OW7A 5KNLA 3JU4A 4ASUA 4DNRB 4G7WA 4KKUA 2DIEA 1UD5A 4XLHA 1UD4A 2VJIA 2CK3A 2ZZEA 3BH4A 2W6IA 1HVXA 3CP2A 2F1MA 2QE7A 4XONA 2ZZGA 4DK1A 2GJPA 4XR6A 2X8KA 1W0KA 4G6IA 1OB0A 3BCDA 2ZXIA 4XNFA 1BLIA 1E1QA 2M5SA 3OEEA 3T56B 1I8DA 4Z1MA 1E3XA 1KMHA 2KVOA 3CESA 4XMYA 1VJSA 2XZOA 2HLDA 4XLEA 1I18A 4P22A 2Z6BD 2ZXHA 1E79A 2R9VA 4XM3A 3CP8A 3H94A 1KZLA 2XNDA 1E3ZA 4KKTA 2E1BA 4FXUA 4GQNA 3T51B 4G7XA 1WPCA 3GVJA 3A35A 1K28D 4TT3A 4XOTA 4TKOB 4XLCA 4YXWA 1E1RA 2XZLA 1HZEA 1UD8A 3OOCA 3OFNA 2XGJA 2D3NA 3CMMA 4NNJA 2V7QA 3GVLA 1E43A 3VR6A 5DN6A 1VLYA 2ZZQA 1FX0A 2JJ2A 2WPDA 4XLFA 2JDIA 2X85A 3ZPNA 2X6XA 2WSSA 2WJYA 2V31A 2X6WA 4HIZA 4XORA 1BPLA 1NRKA 5IK2A 2F43A 4E0FA 1T5EA 2LZJA 4XN3A 4B3FX 1UD2A 2XOKA 3BC9A 3FPPA 4TSFA 4YELA 2XZPA 4II2A 1H8HA 3HAGA 1V0EA 1WTHD 3G05A 1H8EA 3A3BA 2WJVA 3BCFA 3WQZA 2ZZFA 3DDYA 5CDFA 1COWA 4XN0A 1PKVA 2GJRA 1EFRA 4KKSA 4II3A 4XL9A 2ZTNA 2JIZA 1BMFA 4L8JA 2GK7A 2X6YA 4B3GA 2JJ1A 4XLAA 1SKYB 2D3LA 4XOPA 2V4DA 1UD6A 3GQBA 1UD3A 4UZUA 3OEHA 2W6JA 5HKKA 4XKWA 2WZPP 2ZTGA 1OHHA 2GJKA 4YEJA 2VJJA 3GVKA 4XD7A 3LNNA 3OPOA 4XKVA 4DNTB 1NBMA 4JMQA 3OE7A 1VF7A 4DK0A 2GK6A 5FL7A 3KEWA 3OAAA 1MABA 1W0JA 1W9XA 1V0FA 3A3GA 3FKSA 2X53S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5S A; 
#chains in the Genus database with same CATH topology
 4XQF A;  1VQ4 B;  5IYQ A;  2EIX A;  3T53 B;  1WOS A;  2OK7 A;  3NE5 B;  5THX A;  1Y0R A;  4AVZ A;  4ASU A;  2BPO A;  4XLH A;  2VJI A;  3MMP A;  3BH4 A;  3CP2 A;  2F1M A;  4B4D A;  3E1Y E;  4G5G A;  4P3Y A;  3A8J A;  1QVF B;  1FND A;  4X05 A;  1D8T A;  4NCN A;  3OJX A;  4RLZ A;  2OTJ B;  1OB0 A;  2C4T A;  2C5H A;  1KC8 D;  3BCD A;  3FJO A;  4LBW A;  2BM0 A;  1VHE A;  1E1Q A;  4G1B A;  3G6E B;  2BGI A;  3G71 B;  4Z4Y A;  2QTZ A;  3PA1 A;  3CC4 B;  2VNK A;  2HLD A;  4J0Q A;  1CNF A;  3JQQ A;  3PVD A;  1G7R A;  4XLE A;  1YJW B;  1I18 A;  2VBU A;  2Z6B D;  1K9M D;  1E79 A;  5BSY A;  1KZL A;  1F20 A;  4KKT A;  4Y7C A;  5FIU A;  2YWF A;  3AGP A;  5B6I A;  1ZM4 A;  2B5O A;  5J35 A;  1WPC A;  4B3F X;  3CC7 B;  4TKO B;  1DDI A;  3Q6Q A;  1E1R A;  1S4M A;  4YXW A;  1HZE A;  1KJZ A;  1UD8 A;  2XGJ A;  2D3N A;  2V7Q A;  3GVL A;  2ZIT A;  2DYI A;  2ZZQ A;  2JJ2 A;  1I7P A;  4XLF A;  2FVG A;  4PAA A;  4AF6 A;  1VQ7 B;  2BVN A;  2X6X A;  3SJZ A;  1R5N A;  3SLD A;  3ZZ0 A;  1FRN A;  2X6W A;  4HIZ A;  1EP1 B;  1BPL A;  1H85 A;  2Q6L A;  4E0F A;  3AVX A;  3W2F A;  2QA4 B;  4RPB A;  2AHO A;  4XN3 A;  1XQB A;  1VQ8 B;  2F4N A;  1UD2 A;  1WSR A;  1N0U A;  3BC9 A;  3BNW A;  4TSF A;  4YEL A;  4II2 A;  1H8H A;  1V0E A;  3CCR B;  3P27 A;  3G05 A;  5BSX A;  4WZK A;  1WOR A;  3FPK A;  1FRQ A;  1QVG B;  1G7C A;  2QDX A;  3WQZ A;  2BN4 A;  3PUM A;  2JN9 A;  4FK8 A;  3J81 k;  1EWY A;  2GJR A;  1EFR A;  1R5B A;  3QFT A;  4KKS A;  4II3 A;  4P1V A;  3B82 A;  4DQK A;  1QGA A;  3U2Q A;  1BMF A;  2GK7 A;  4DQL A;  4B3X A;  2JJ1 A;  4U9U A;  2BMW A;  1AIP A;  4XOP A;  4OPS A;  1GAW A;  2VYQ A;  5HZA A;  3GQB A;  4X07 A;  3KL9 A;  1W2B B;  3OEH A;  2W6J A;  2QEX B;  2OYN A;  3AVU A;  1OHH A;  2B7B A;  5A8A A;  3AVV A;  2GJK A;  3LNN A;  1N05 A;  1QGZ A;  2V7V A;  5E6T A;  3ZZU A;  5J3O A;  1GJR A;  4X7D A;  1VQ9 B;  1Q9S A;  3KEW A;  4OP7 A;  1KK0 A;  3FKS A;  4M1K A;  4WZE A;  3I1F A;  2DCU A;  4C43 A;  4MYT A;  1YLO A;  2ZBU A;  3OZV A;  3ZIA A;  2XNJ A;  5KNL A;  4DNR B;  3ZBT A;  3QFC A;  2OBR A;  1UD5 A;  5F4M A;  2ZZE A;  2W6I A;  2FX3 A;  4Z4S A;  2QE7 A;  1VQN B;  1B23 P;  2DET A;  1NJI D;  3CCE B;  4TMT A;  1K8A D;  2QTL A;  3Q38 A;  3CPW B;  3CCS B;  4EH1 A;  1GVH A;  2CBX A;  1ELO A;  1E64 A;  1TLL A;  2ZXI A;  1BLI A;  5HXB A;  2YWE A;  1NB9 A;  2M5S A;  1F60 A;  1ZM3 A;  3SLN A;  5GV8 A;  4Z1M A;  1E3X A;  1KMH A;  3ASP A;  3OJW A;  3CCU B;  1VJS A;  3LQE A;  4ZCI A;  5TRD A;  5HZB A;  1W34 A;  1J9Z A;  4UAJ A;  4XM3 A;  2BM1 A;  2BF4 A;  2XND A;  4RDJ A;  2PIA A;  1E3Z A;  2GQF A;  1TVC A;  3OZW A;  4Q7J B;  3VO2 A;  2XEX A;  1VQL B;  1QUF A;  4P6V F;  2BV3 A;  2OBT A;  4GQN A;  3RY8 A;  4XOT A;  1BJK A;  1K28 D;  2CRV A;  4XLC A;  5FNZ A;  2XZL A;  5DSZ A;  3ZZT A;  2C5B A;  3ONU A;  1KTV A;  3OFN A;  4NNJ A;  3CMM A;  1WDT A;  2V7T A;  3BQJ A;  4TMW A;  5L46 A;  4B47 A;  1E43 A;  5DN6 A;  1VLY A;  1T6X A;  2WPD A;  5TR9 A;  4AC9 A;  4NBS A;  2HCJ B;  4WQM A;  3D26 A;  1KRH A;  2WJY A;  1D1N A;  1NRK A;  2F43 A;  4HE6 A;  1RQR A;  1EP2 B;  5FO0 A;  3W5V A;  2YWG A;  2NPF A;  2XOK A;  3Q39 A;  3WXM A;  1G7S A;  3HAG A;  1FNC A;  3Q3A A;  4OOV A;  2HDN B;  3A3B A;  3BCF A;  4WZT A;  5TY0 A;  3DDY A;  5CDF A;  4Z4U A;  4B43 A;  3ZUG A;  1D2E A;  1G7T A;  1NB0 A;  1EFT A;  4B48 A;  3JQR A;  4P2N A;  1VQK B;  4RD4 A;  3CCM B;  3W5U A;  2QMU A;  4XLA A;  1ZM9 A;  4C0S A;  1PJ5 A;  1YJN B;  2NV4 A;  1YJ9 B;  4XKW A;  1XB2 A;  2ZBV A;  2C77 A;  4WZL A;  4ACA A;  1OGJ A;  3WY9 A;  3GVK A;  2RC6 A;  1DDG A;  4ROX A;  5F4J A;  1EFC A;  1SM4 A;  3ES9 A;  5KSW B;  3CD6 B;  1YX2 A;  1VF7 A;  1YHQ B;  4OPV A;  1FNM A;  1MAB A;  1W0J A;  1ZM2 A;  3VNU A;  1V0F A;  3A3G A;  3ASR A;  3JQP A;  1RQP A;  1GO2 A;  3A1P A;  1KK3 A;  3OKX A;  1M90 D;  3I56 B;  1KK2 A;  1TTT A;  1KQS B;  2BGJ A;  4P12 A;  3WNB A;  4M2L A;  4YHB A;  4TN1 A;  1A8P A;  1W35 A;  2CK3 A;  3SEJ A;  1QH0 A;  1HVX A;  5IYP A;  4R71 A;  2ZZG A;  2ZL7 A;  5A88 A;  3Q6R A;  1YI2 B;  4XR6 A;  1W0K A;  4G6I A;  2V7U A;  4WWV A;  1FDR A;  4OOS A;  3U6B A;  3W2I A;  2DY1 A;  3W2H A;  1MRZ A;  1IJF A;  2C78 A;  3OEE A;  1S0U A;  3T56 B;  4M0L A;  2V7X A;  3CES A;  4XMY A;  1DG1 G;  4QV2 A;  1N8R D;  2R6H A;  2GPJ A;  4PC1 A;  2R9V A;  2X0K A;  3CCJ B;  3OP1 A;  4BPR A;  3CP8 A;  1WU8 A;  3H94 A;  1XE1 A;  2PMD A;  3SKB A;  4X06 A;  2Q6K A;  2P3M A;  1ZUN B;  4ZGQ B;  1KK1 A;  1OGI A;  1PJ6 A;  1R5O A;  4FXU A;  3T51 B;  3AGQ A;  4TT3 A;  3U6K A;  4PC3 A;  4RDK A;  2DEU A;  4Z4W A;  1JJ2 B;  1T6Z A;  2HMA A;  4M53 A;  3VR6 A;  3A8I A;  3R6K A;  1FX0 A;  2GRE A;  2VBT A;  1QGY A;  3BY1 A;  3WND A;  2BSA A;  1GR1 A;  5TV2 A;  3ZPN A;  2DER A;  2OBS A;  2WSS A;  1N0V C;  2V31 A;  2RC5 A;  3CRZ A;  4RPD A;  4UZF A;  4X7C A;  5IK2 A;  3LVB A;  1YIT B;  1H42 A;  4RCY A;  1T5E A;  2LZJ A;  4X8I A;  2OK8 A;  4LBV A;  3CW2 A;  2XZP A;  4Z4V A;  1H8E A;  2VBV A;  2WJV A;  1QUE A;  5DS0 A;  3VO1 A;  1VQO B;  1COW A;  4XN0 A;  1VQ5 B;  3AVY A;  4N3G A;  3CTA A;  1BQE A;  2PLF A;  4YAW A;  4TMV A;  3OW2 B;  4RD3 A;  2JIZ A;  3WYA A;  4YAF A;  3CCQ B;  3CMA B;  4RD1 A;  3ASQ A;  4K1X A;  2X6Y A;  1N07 A;  1EFU A;  2CND A;  2F1L A;  3ASS A;  1GAQ A;  3CPX A;  4UZU A;  5HKK A;  1XFO A;  1IHM A;  4PGO A;  3PUN A;  2WZP P;  4ZGN B;  4P26 A;  4YEJ A;  2VJJ A;  2D9R A;  4XD7 A;  2WZN A;  1JB9 A;  4XKV A;  3PEN A;  4Z4T A;  1S72 B;  4DNT B;  1CQX A;  4RD6 A;  1NDH A;  3B78 A;  4MYU A;  4P25 A;  3GSI A;  3OZU A;  4DK0 A;  2EFG A;  4QHY A;  3W5H A;  5IYR A;  1EP3 B;  4QFM A;  3ONY A;  3WBK A;  1W9X A;  3QFR A;  1YIJ B;  4ACB A;  3LO8 A;  5IYW A;  2X53 S;  4AF7 A;  2CF4 A;  2QGG A;  1WP6 A;  3GIR A;  2D74 A;  4PAB A;  5GV7 A;  4RD0 A;  3OW7 A;  1WOO A;  3E20 A;  4Z4R A;  3JU4 A;  4IW3 B;  5H5J A;  5LMZ A;  3QSY A;  4P9S A;  4G7W A;  4KKU A;  5KW9 A;  1M1K D;  2DIE A;  5FA6 A;  1UD4 A;  2YWH A;  4PC6 A;  4X7F A;  3W2G A;  3ZBU A;  2J7K A;  1OB2 A;  1EXM A;  1VHO A;  4RM0 A;  4F7D A;  4XON A;  1QG0 A;  1BX1 A;  3CCL B;  4DK1 A;  3CME B;  2GJP A;  1JA0 A;  2X8K A;  2ZL6 A;  1V5V A;  4UZE A;  4LBZ A;  3ISX A;  4XNF A;  2CW5 A;  3CC2 B;  5FO1 A;  2VNJ A;  2VZL A;  4ZCL A;  1I8D A;  4OPO A;  1SKQ A;  1E62 A;  4HE5 A;  2ZL5 A;  5IYN A;  1Q81 D;  1BX0 A;  2KVO A;  5JBQ A;  2XZO A;  4FN5 A;  3AST A;  2WYR A;  4P22 A;  1P4M A;  4H9G A;  2ZXH A;  4X0C A;  2V7W A;  1JNY A;  2I1L A;  2E1B A;  4CQJ A;  3CXC B;  1QFJ A;  4G7X A;  1FNB A;  2VNH A;  3A35 A;  3GVJ A;  4FWT A;  1DAR A;  4P6Y A;  3OOC A;  1Q86 D;  2VNI A;  1E63 A;  2QN6 A;  2WR8 A;  4LBY A;  2C2W A;  4P3I A;  3ZC3 A;  4M4S A;  3CCV B;  2JDI A;  2X85 A;  2X3U A;  1IJE A;  4PC7 A;  2VBS A;  4QVJ A;  4TMX A;  1AMO A;  1Q82 D;  2XNC A;  1QX4 A;  1VQM B;  1PJ7 A;  3P26 A;  4RCZ A;  1W87 A;  4XOR A;  2B7C A;  5AN9 A;  3QFS A;  1KD1 D;  3QE2 A;  4RDL A;  3SJP A;  4Y9U A;  1QFY A;  3VMF A;  1CNE A;  1HA3 A;  1IB0 A;  3FPP A;  1Q7Y D;  3PA2 A;  3R6J A;  1WTH D;  2Q6I A;  3H9N A;  3AVW A;  3LQ6 A;  2PE3 A;  3V7A A;  3MHP A;  2ZZF A;  3AVT A;  2E1R A;  1PKV A;  4QVA A;  1N06 A;  4N3N A;  4Y9R A;  5EMN A;  3G4S B;  1WOP A;  5A89 A;  1UMK A;  1U2R A;  4XL9 A;  3I55 B;  2ZTN A;  3WNC A;  4YAL A;  1N08 A;  1VLO A;  3A8K A;  4L8J A;  4B3G A;  1Y0Y A;  1SKY B;  2D3L A;  4RJL A;  2V4D A;  1UD6 A;  4TMZ A;  4G1V A;  4ZV4 A;  1UD3 A;  2C4U A;  3B8H A;  3CB4 A;  2Q6O A;  4RD2 A;  2ZTG A;  2CC2 A;  2OTL B;  1WSV A;  1VQ6 B;  1TUI A;  4ZCM A;  4Z4Z A;  1VQP B;  3OPO A;  4YAU A;  1K73 D;  1NBM A;  3VNV A;  1JA1 A;  3W2E A;  4JMQ A;  4OOX A;  3BY2 A;  3OE7 A;  5H59 A;  1T6Y A;  3V76 A;  2GK6 A;  4YAO A;  4PC2 A;  1QFZ A;  4X7E A;  3MCA A;  3OAA A;  5F4O A;  5FL7 A;  3WBJ A;  1OB5 A;  4LC0 A;  4QUZ A;  4B44 A;  1B2R A;  2DOG A; 
#chains in the Genus database with same CATH homology
 4XQF A;  1WP6 A;  3T53 B;  3NE5 B;  4AVZ A;  3ZIA A;  3OW7 A;  5KNL A;  3JU4 A;  4ASU A;  4DNR B;  4G7W A;  4KKU A;  2DIE A;  1UD5 A;  4XLH A;  1UD4 A;  2VJI A;  2CK3 A;  2ZZE A;  3BH4 A;  2W6I A;  1HVX A;  3CP2 A;  2F1M A;  2QE7 A;  4XON A;  2ZZG A;  4DK1 A;  2GJP A;  4XR6 A;  2X8K A;  1W0K A;  4G6I A;  1OB0 A;  3BCD A;  2ZXI A;  4XNF A;  1BLI A;  1E1Q A;  2M5S A;  3OEE A;  3T56 B;  1I8D A;  4Z1M A;  1E3X A;  1KMH A;  2KVO A;  3CES A;  4XMY A;  1VJS A;  2XZO A;  2HLD A;  4XLE A;  1I18 A;  4P22 A;  2Z6B D;  2ZXH A;  1E79 A;  2R9V A;  4XM3 A;  3CP8 A;  3H94 A;  1KZL A;  2XND A;  1E3Z A;  4KKT A;  2E1B A;  4FXU A;  4GQN A;  3T51 B;  4G7X A;  1WPC A;  3GVJ A;  3A35 A;  1K28 D;  4TT3 A;  4XOT A;  4TKO B;  4XLC A;  4YXW A;  1E1R A;  2XZL A;  1HZE A;  1UD8 A;  3OOC A;  3OFN A;  2XGJ A;  2D3N A;  3CMM A;  4NNJ A;  2V7Q A;  3GVL A;  1E43 A;  3VR6 A;  5DN6 A;  1VLY A;  2ZZQ A;  1FX0 A;  2JJ2 A;  2WPD A;  4XLF A;  2JDI A;  2X85 A;  3ZPN A;  2X6X A;  2WSS A;  2WJY A;  2V31 A;  2X6W A;  4HIZ A;  4XOR A;  1BPL A;  1NRK A;  5IK2 A;  2F43 A;  4E0F A;  1T5E A;  2LZJ A;  4XN3 A;  4B3F X;  1UD2 A;  2XOK A;  3BC9 A;  3FPP A;  4TSF A;  4YEL A;  2XZP A;  4II2 A;  1H8H A;  3HAG A;  1V0E A;  1WTH D;  3G05 A;  1H8E A;  3A3B A;  2WJV A;  3BCF A;  3WQZ A;  2ZZF A;  3DDY A;  5CDF A;  1COW A;  4XN0 A;  1PKV A;  2GJR A;  1EFR A;  4KKS A;  4II3 A;  4XL9 A;  2ZTN A;  2JIZ A;  1BMF A;  4L8J A;  2GK7 A;  2X6Y A;  4B3G A;  2JJ1 A;  4XLA A;  1SKY B;  2D3L A;  4XOP A;  2V4D A;  1UD6 A;  3GQB A;  1UD3 A;  4UZU A;  3OEH A;  2W6J A;  5HKK A;  4XKW A;  2WZP P;  2ZTG A;  1OHH A;  2GJK A;  4YEJ A;  2VJJ A;  3GVK A;  4XD7 A;  3LNN A;  3OPO A;  4XKV A;  4DNT B;  1NBM A;  4JMQ A;  3OE7 A;  1VF7 A;  4DK0 A;  2GK6 A;  5FL7 A;  3KEW A;  3OAA A;  1MAB A;  1W0J A;  1W9X A;  1V0F A;  3A3G A;  3FKS A;  2X53 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...