2M5TA

Solution structure of the 2a proteinase from a common cold agent, human rhinovirus rv-c02, strain w12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
142
structure length
142
Chain Sequence
GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPCVPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human rhinovirus 2A proteinase
publication title Solution Structure of the 2A Protease from a Common Cold Agent, Human Rhinovirus C2, Strain W12.
pubmed doi rcsb
source organism Rhinovirus c
molecule tags Viral protein
total genus 18
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2m5tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2m5tA01
1O5GH 3RLWH 1G3BA 1ZJKA 1V3XA 1O3BA 1ESTA 4BXSA 3GCHB 1DITH 1T4VH 2FESH 5GPIB 1AWFH 1CGJE 1A1RA 3HK3B 4UDWH 1QIXB 5F8ZA 4IC6A 4DVAU 2XRCA 1ID5H 1HAVA 2THFB 3M3VA 2VINA 4XFQA 2Z9LA 5C5NA 1GBAA 3SNCA 3RXAA 2JETC 3A7TA 3UNSA 1P2IA 5ETXA 1YPJH 2GVFA 2ZQ2A 4AFUA 1ZTLA 4U01A 1QL9A 4OGYA 3B8JA 3QUMP 4NA8A 1HAZB 5HGGA 1BZXE 3MU1A 4Q80A 1P2OA 1O5AB 1G3EA 3F9GA 1MQ6A 2VVCA 1O2HA 4WVPE 1GBEA 2A45B 1ABIH 1UTQA 5SGAE 3E6PH 2AH4X 1SPJA 3PLKA 4DIHH 1C2DA 1QBVH 1G36A 1OWHA 1TE0A 2VIWA 4YOGA 4CR5A 1F0UA 5ESTE 2ANYA 3ZV8A 3K65B 3OSYA 1LVBA 1BTXA 1EZQA 2PSXA 4Y71A 1G3CA 1O2XA 5EW2H 6CHAB 3V0XA 3KQEA 3ZVCA 3TH2H 4SGBE 4CH2B 3RXIA 1EAIA 2A2XH 2GV6A 1YCPK 1GJ5H 3NKKA 4FU8A 2F9UA 3RXCA 3RMOH 4INKA 3U8OH 1GHVH 4VGCC 1BB0B 3GDVA 1O3OA 2ALVA 1ARCA 1BITA 1O31A 4R8TB 1GGDB 2H6MA 1AVXA 2ZHQH 3D65E 1QB9A 4I8KA 3ESTA 2C90B 1EJMA 3RXPA 5FAHA 4X2VA 4FUCA 4D7GA 1FNIA 1NU7B 3SV2H 1A4WH 1Z1IA 3SV6A 2WV5A 4CRDA 1IQJA 4QT8C 2VIOA 2BDGA 2A7JA 3STJA 1W11U 3RXDA 4ABJA 3U8TH 1TNGA 6GCHG 4X1RU 1Y3YA 2GX4A 3OY6U 4NIVA 5L2YH 2ANMH 2JETB 5GIBA 1P06A 2V3OH 1E35B 3UPEA 4A1XA 1AUTC 4MNVA 3MH7A 1RXPA 5T6FA 2P8OB 2VIPA 1C5VA 1GJ4H 2A4RA 5JDUB 2AGEX 4XBCA 1GI3A 3BF6H 1IQGA 1C5NH 2VIVA 4ZHAA 3V7TA 8GCHF 2ZDMA 1EAXA 3RXOA 2J34A 3U1JB 1HYLA 1PQ8A 2UUYA 3A7ZA 1GJ6A 1C1OA 2ZI2H 1SGNE 1KXDA 1HNEE 3HK6B 1BRBE 1L4ZA 1BTWA 4ZROA 1DPOA 1K1OA 1AVWA 1TX7A 5C5OA 4B2CA 1GJ7B 2FIRH 2BD4A 1NT1A 2CF9H 2BY7X 2V6NA 2ZFQH 1S5SA 4OS2A 1AIXH 2PWXA 2A7HA 3OY5U 3QGJA 3O8CA 2P3FH 2FI4E 1AZZA 3HGPA 4JZ1A 1WV7H 1THRH 3E0PB 3H5CB 1A0LA 3MNXA 3F1SB 3NZIA 1CT4E 3KGPA 1U6QA 4OS1A 1PPFE 2BLVA 5GJ4B 3SNBA 3AW1A 1P2KA 4X1NU 1A0HB 1C9PA 3TGIE 2W7UA 3RU4E 1MTNC 1GBKA 3T5FH 1A5HA 2GZ9A 3M5MA 4MG3A 1GBBA 1D6WA 3MNSA 1BBRH 1LHDH 1KIGH 5AFZH 4ABHA 2QF0A 1Z8IB 1A5IA 1DLKB 3CS7A 5LGOA 4K8BA 1HBTH 4ISIH 1GL0E 2PSYA 5GCHF 2ESTE 1GL1A 2XBWA 1DWDH 3GY2A 4Y7BA 1SGIB 1P04A 3STIA 3UFAA 3ATKA 2VWOA 1O35A 1AB9C 1GMHF 4UFDH 2ZTYA 3BTQE 5EXNA 2Q1JA 4F4OC 2PW8H 5DP6A 2FXRA 1YPHC 3DHKH 1VZQH 2P59A 1M9UA 5A8YA 2XBVA 1HAOH 1S83A 4BANB 2F3CE 1HV7A 1KLJH 2TGTA 1BTYA 1YP9A 3SU1A 3TH4H 1K28D 2PGBB 1C5XB 2IPHA 1O3JA 2ZFFH 3SJOA 2D26C 1UVUH 1WSSH 1GCTB 4MNWA 1SSXA 2QXIA 1SGYE 3BG4C 1YGCH 4WMDA 3BN9A 2D2DA 1TRYA 1BMMH 1AQ7A 3LONA 1JRTA 2Y7XA 2AFQB 1W2KH 1OSSA 1GJ9B 3ODDA 3SU0A 2CGAA 1DY9A 3A85A 4JYTA 2F9PA 3UWIA 1C5OH 1FY8E 1AN1E 2WYJA 1UVPA 4IN1A 2BY6X 1C5TA 5EW1H 4IN2A 1NFXA 4GLYA 2AERH 3IITA 2CMYA 2BB4A 3D62A 3BTME 4KELA 2G5VA 2ZGBH 1MTNB 1JRSA 2Z7FE 1HCGA 1SR5C 4IBLH 4BAMB 2Q6GA 1GPZA 1SGQE 1XUIA 4BAQB 3P8FA 1LHEH 1FIZA 3TIUA 5JBBS 3U98H 1O3DA 3P8NA 3V13A 2GMTC 3SW2B 5HYOA 1YPMH 3SQEE 1C1RA 5A8ZA 2G5NA 2UUJB 3RXEA 1XUKA 2FOEA 5E2PA 3RC4A 2Y82A 5CMXH 5DO4H 3URCA 4ZKOU 1C2GA 5LPFA 3B9FH 1TGBA 1BBRK 1VGCC 1LVYA 3SU2A 4D9QA 1BIOA 1OX1A 3TJVA 2WPHS 4ABGA 3S0NA 4JYUH 1BQYA 1O3NA 3VXEH 3QK1A 2FOCA 1RD3B 2W5EA 3C27B 2P93A 8GCHG 2I6SA 4X6NA 2BZ6H 1P10A 1OXGA 2RA3A 4TY6A 1KDQA 2Z3DA 1TPAE 2FEQH 4X6OA 1BHXF 1HJ9A 3SGAE 5JBCS 1YKTA 4NCYA 2V3HH 5K0HA 1TA6A 5C2ZA 1S85A 1IHTH 1GI4A 1LPGB 2G4TA 3A82A 3F6UH 1ESAA 1ZHPA 3SUDA 1HXFH 5DP9A 1KXCA 4NGAH 2B7DH 1KXBA 1WOFA 3PMJA 5EXLA 1WAYB 4ZUHA 3RC6A 3TGKE 1UTOA 1ZSKA 2A4QA 1C2LA 3ELAH 2P94A 1QA7A 2J38A 3DFLA 1EP5A 2R0LA 1ZGVA 1GWAA 2OLGA 4DJZB 4WMEA 1PPHE 3SUGA 2ZCKP 2EI8A 4TWYA 1SFQB 3TNTA 4NIXA 1XUFA 3LT3A 4CHAB 3QLPH 3E0NB 1RGQA 4AG1A 3TK6A 3PYHA 4I7YH 1MZAA 1GBDA 3H7TA 4FUBA 1D9IA 2V35A 3D49H 4YZUA 3UR6A 1LVOA 2ZIQH 4GAWA 4X2WA 1GG6C 2WUCA 1ARBA 3P6ZB 2B5TB 1IHSH 5J4QA 1DE7H 5I46H 5GCHG 1ZTJA 1ABJH 1KLTA 1DM4B 2XBYA 1GBIA 4MPWA 4THNH 2EA3A 2Y6TA 1GMHG 4SGAE 3NCLA 7ESTE 2F9NA 1UTJA 4K3JA 1VGCB 2ZDLA 3R0FA 5AF9H 4JZDH 3RXMA 4MDSA 5EGMA 3F68H 2HGTH 1DOJA 1OWDA 3A8AA 1O3FA 2WPJS 1TRNA 1CGIE 1H9LB 1CVWH 3GY5A 4B71A 1LDTT 3KQBA 5B6OA 2BDAA 4E06H 2ZPSA 1T8OA 4ISLA 3FVFB 4LZ1H 1Q2WA 4ZXYH 3O8DA 3LDXH 5FPTA 1QTFA 1FXYA 1W3CA 2BLWA 3B23B 1EJAA 3SZNA 4UEHH 4JZEH 1TNKA 3LGVA 1Y3XA 4AORA 2TGPZ 3SV7A 2TGAA 1W12U 1SB1H 1C5WB 1FPCH 5TCCA 2QGRA 5F8XA 2M5TA 1SOTA 1VCWA 1V2OT 3LPRA 8KME2 2GD4B 1XUJA 3MH5A 3A81A 2BDCA 3A7XA 1J16A 3RMLH 1SI5H 4AZ2B 2VNTA 2OC7A 1BBRE 4WH8A 9ESTA 2BLQA 2GTBA 4MPUA 4OS7A 2ANWA 2ZEBA 3GYMA 1C1PA 1FN6A 3EA7A 1EPTC 1S82A 1NFYA 3RC5A 4AB8A 1TBZH 2XWBI 3MO3A 1TMUH 3A7VA 4X1QU 2D8WA 5JB8S 2QC2A 1IQKA 1XVMA 2GCTC 4NFFA 2PR3A 2SGDE 5A0CA 2GDDA 1GI1A 1RFNA 2BXTH 1C9TA 4K1SA 1O2GH 4YO9A 2NU3E 2BD3A 1FI8A 1TQ0B 3ZZ4A 3VPKA 2OBQA 3MMGA 4JZFH 1NY22 1TALA 2A4GA 1MTWA 3UIRA 3ZVDA 4KTCA 2AEIH 2QA9E 3RXGA 1C4V2 1EQ9A 2UUKB 3N7OA 1ZTKA 2OQUA 2ALPA 1GHXH 3SUFA 1N8OC 4A7IB 1AKSB 4WY3A 4A5TS 2O8TA 7GCHF 7KMEH 1UK2A 4RKJB 1GI2A 2OCVB 1N1LA 1O3EA 2AMDA 2BD7A 4F49A 1ZYOA 1F2SE 1CQQA 2O9QA 1SLXB 3UOPA 1SMFE 1VITG 5C1XA 2BQ7B 3ZVFA 5A0AE 3PWBA 3Q3KA 1LHFH 2ZU5A 2PKSC 3RDZA 3FP7E 1FZZA 4D76A 4YTAA 1WQSA 1Y5UT 1GBMA 1GHAF 1HJAB 1C5QA 3H7OA 4MNYA 2H9HA 2O8LA 1C1UH 4HGCA 3P8OA 2XBXA 1O32A 1MTUA 3VEQB 1TOMH 1BRCE 4UFGH 3E91A 1BJUA 4X8UH 2J95A 1SVPA 3M35A 1PPEE 1C1TA 3PMHB 1EPTB 3OU0A 5ESBA 1OP2A 1BOQA 1ZPCA 5L6NH 1LVMA 2NU0E 2GCTB 4H6TA 4CBNA 1K1LA 2FPZA 3RXQA 2UWLA 4AFZA 2R0KA 3E90B 4ESTE 1RTLA 1TYNA 4E05H 1AD8H 1GHYH 1FAXA 3SN8A 4DW2U 1P11E 1VJ9U 2FWWA 1QNJA 1F5RA 4INLA 2P8OC 1L2EA 1Z7KA 2C8XB 2XC0A 2Z94A 3T27A 1UJ1A 4PROA 1ELBA 1GHZA 2ZP0H 2ZC9H 4JK5A 2WINI 2XCFA 2A5KA 1DANH 2P95A 1W14U 2PTNA 1S6FA 2PUQH 2ZFSA 1W0ZU 5CE1A 2H5DA 1NM6A 1LQDB 3LGUA 1N6XA 3SUEA 5JB9S 1AO5A 1N8OB 3AASA 2FS9A 2GV7A 1MD7A 1YC0A 1P3EA 3UWJH 3UTUH 2OQ5A 3ZYEA 1E34B 1XKBC 2A32A 2CJIA 2Z3CA 3LGIA 4A1TA 3SJ9A 5JBAS 1B0EA 2A7CA 2XC4A 1A2CH 3MU5A 1ELVA 1YYY1 3RUOA 3L6PA 1EATA 4YESB 1TMTH 2BDBA 2VGCB 3CENA 2PKSB 1YPLH 1EJNA 1QRZA 1B5GH 5J4SA 1S6HA 1V2KT 4K2YA 1GJ8B 1S0QA 4Y8XA 2PKAB 4X8TH 1EOJA 1Y3WA 1ZMLA 4O3TA 1SLUB 3KCGH 1SHYA 1W13U 3RM2H 3TLOA 2QN5T 5FBIA 1MU6B 5F8TA 1YPEH 1TBQH 4OS6A 1UVSH 1SGEE 1GBJA 2SGEE 5DGJA 2PLXA 4D9RA 4WXVA 1ZRKA 1O3HA 3ENSB 2RCEA 4TPIZ 3MI4A 3SO3A 2ZDNA 2AGIX 4U2WA 1OP0A 3ZZDA 2HPQH 3AAUA 3GY7A 3LGYA 1C5YB 5GWZA 1LHCH 5FCKA 2ODYB 1ELCA 2AIPA 2QXHA 3A83A 1V2RT 2VJ1A 3RMMH 3SBKA 1CSOE 1C5ZB 1D6RA 2XC5A 5C1YA 4UFFH 2BY9X 4AN7A 1K22H 2VH0A 1OWIA 3GISB 3LJJA 2JH5D 3TGJE 2EEKA 4J1YA 2VWMA 3GY3A 3PMBB 1V2UT 2FODA 1TOCB 2FI5E 1H1BA 2D1JA 1A5GH 2ZGCA 3TK5A 4WF8A 1T8NA 3A7WA 1BRAA 2CF8H 1UHBB 2BDYA 2NU2E 2PV9B 4YT7H 1DFPA 3MU4A 1KXFA 1XM1A 2ZU3A 1C1NA 1GCTC 2AMPA 2WPMS 3HKJB 3BTDE 4DGJA 1ZRBA 3K6ZA 1C5PA 4TPYA 1PFXC 1P0SH 1SL3A 3SHCH 1W10U 2P3TB 2JKHA 3SJ8A 4JMYA 1YPHE 4IC5A 5DG6A 5C3NA 4ZXXH 2WPKS 5JYIA 1IOEA 3W94A 3NPSA 2SGAA 1O5BB 2DUCA 2ZDAH 1NRPH 2RG3A 1AUJA 1F0RA 1CA0C 3P17H 1GHAG 2A2QH 3K2UA 4I31A 1HLTH 1ZSLA 1GI6A 4NWKA 4B76A 1RTKA 1A61H 2F83A 4HFPB 5E0JA 3GY4A 1GJDB 4DT7B 2GKVE 1IQNA 5HM9A 1QA0A 4A1VA 1BTUA 1MTSA 2AIQA 5ABWA 1V2QT 1G30B 3KQCA 4NIWA 2H5CA 4E7RG 1BTZA 2BHGA 3A86A 1J15A 1O3KA 1FV9A 1MCTA 1OWKA 4NSVA 3SI4H 1LPZB 1RIWB 4GCHF 5E2OA 3O8RA 1SLWB 4CRGA 1ELTA 1UTMA 3RXKA 1JMOH 3MWIU 4Z6AH 2P16A 5EU8A 1C2EA 2IOTA 1H9IE 1Y59T 3MU8A 2WV4A 2R2WU 1K1PA 2Z9KA 1ETRH 2FOBA 3M5LA 1ZMJA 1Z6EA 2OD3B 2R9PA 1TB6H 3PV4A 4TYDA 3F9FA 3ATLA 2UWPA 1FONA 1OYQA 2JH0D 1O2KA 1O5CB 1DT2A 3TJNA 1BTHH 3UNRA 1HIAB 2FTMA 3RXLA 1NRSH 2BQWB 3SU3A 3MOCA 1Z8JB 1P12E 1ZZZA 1KTSB 5L2ZH 2OINA 4KTSA 5I25A 2B8OH 5DJ7A 2VIQA 4AFQA 3CS0A 3GDUA 1BA8B 1RRKA 2FM2A 4HTCH 1QCPA 2BX4A 1ANCA 4K1EA 2ZECA 5LPEA 5F6MA 1ZPBA 1SGTA 3TK9A 1BCUH 3MNBA 3A80A 3SOSA 1O38A 3S69A 3ZVEA 1DLEA 3S9AA 5A2MH 1MBQA 2TIOA 1CA0B 4I32A 1O2MA 4MPXA 1F5KU 1EB1H 1YPGH 2SNWA 3KEEA 1KXEA 2RDLA 3BEUA 4BXWA 1QRXA 4CHAC 2OBOA 5EPNA 1GMDF 5FX5A 2ZNKH 3URDA 4LXBH 1O3MA 2Y5HA 1J8AA 1V2TT 2ZDVH 2FDAA 2GZ7A 2QV1A 1H9HE 2A4OA 1LTOA 1C1MA 4E7NA 1QBOA 2Z6BD 1NROH 1O2TA 4XBBA 3PMAB 2QAAA 1XVOA 1QL8A 3T26A 4RSPA 1QR3E 3M3TA 3LGWA 1SG8B 3A88A 1AI8H 1WTGH 1TLDA 1JIRA 4TY7A 1LKBA 2H9EH 4D8NA 4FU9A 1KYNA 1GHBF 4BTUB 1NO9H 2PGQB 2ZKSA 3EA9A 3NWUA 4NWLA 5EODA 4ASHA 4IMZA 5FPYA 2O8WA 1S0RA 4AGKA 9LPRA 4YOJA 1S84A 4I8JA 1E38B 1SFIA 4K5ZA 2C4FH 4KP0A 3U1IB 1O3PB 1EZXC 2WPLS 3VB6A 4GSOA 1FY4A 2A31A 1VR1H 2FLRH 1KLIH 3I29A 1THSH 1ESBA 1O2VA 5E0HA 1BT7A 2ZF0H 3P70B 1SOZA 1AE8H 3MO6A 4NSYA 3SU6A 1ELAA 3U69H 4ZHLU 2ZTZA 4I33A 3EA8A 1O5FH 3KNXA 3L3TA 1VCPA 4CRFA 1K1JA 1JBUH 5C1UA 1FJSA 2FLBH 5C67A 3VB4A 1C5LH 3MU0A 2FMJA 1YPKH 3PWCA 3LGTA 4ABIA 2BVRH 5JPMH 4ABAA 1K1IA 2DE9A 1YM0A 1PYTD 4AFSA 1O34A 3U8RH 1AWHB 5E8EH 4K60A 3Q3YA 4GHTA 7LPRA 1GJAB 4XDEA 1JXPA 1TABE 2ZZUH 2ZG0H 5BRRE 1UVTH 1F7ZA 2Z9GA 1ZSJA 1YBWA 1G9IE 3TU7H 1QJ1B 1TGNA 2XW9A 2XWAA 3BEIB 4AG2A 1A46H 3RM0H 1AMHA 1EOLA 2AYWA 1Z6JH 4K8YA 1ZJDA 2A5IA 2BX3A 3CP7A 3SJIA 3UQVA 5TCAA 2ASUB 4CRBA 1C2FA 1INCA 4YLQH 3RU4T 4ZKSU 3SORA 1FMGA 1O2UA 3ODFA 1NESE 1W7GH 3EAJA 1FUJA 4KTUA 1AY6H 2K1QA 3UQOA 3PM3A 1SGCA 1O3IA 4FUIA 1L0ZA 4ABFA 3ATIA 1EXFA 3HATH 4FUHA 3S9BA 1V2NT 2DE8A 2Y7ZA 1TFXA 2B0FA 1O2LA 3BTWE 2LPRA 1K1MA 1IQIA 2BD9A 1C4U2 2BD5A 3S7HB 5GDSH 1QJ6B 4WMFA 2CXVA 2AGGX 2ZFTA 1ZGIA 3ATMA 1UK4A 3BTFE 1C4Y2 1MUEB 3LOXA 2QY0B 1NN6A 3GDSA 3M36A 3Q3XA 1YLCA 3PO1C 1FAKH 2WUBA 2Z9IA 1EAWA 1RJXB 4ABDA 6LPRA 3ZV9A 1T31A 1TX6A 1TGSZ 2ZCHP 5DP5A 1OWJA 2ZFPH 1BMLA 1BDAA 3FAOA 3M37A 1H8DH 1GHWH 3GCTF 2YNAA 3M3SA 3BV9B 1GI8B 1HJAC 3K9XB 1MKXK 1QB6A 2VH6A 1BUIA 1E0FD 4BTTB 2OTVA 4X2YA 3RXBA 4NZLA 3ZYDA 1CBWC 4DIIH 1GMDG 1FDPA 2Y80A 3GOVB 3DA9B 3BEFB 4NFEA 4X1PU 4CREA 2A0QB 2FZZA 2VIDA 3RXUA 2H1UA 1A0JA 1AFQC 5T6GA 1P01A 1LHGH 3FANA 1FY1A 2AMQA 3P8GA 2F9OA 1TAWA 2A5AA 3F9EA 1V2LT 1V2JT 4UE7H 2KAIB 4CBOA 2ODPA 1TGTA 1Z1JA 1A7SA 1IQMA 4FUJA 3A7YA 1ORFA 1PYTC 3VXFH 1GHBG 4B75A 1PJPA 1VJAU 4BNRA 1C5UA 2PFEA 1P8VC 4HZHA 3FZZA 3I77A 1L1GA 3JZ2B 1O2SA 1VITH 2OP9A 4Y8ZA 3VGCC 3E3TA 1P03A 2O8UA 4XSKU 3UR9A 4AX9H 2FP7B 1NPMA 3DFJA 2R3YA 3PTNA 3SU5A 2FS8A 2GDEH 3ZZAA 4A92A 1P2QA 4J2YB 1F0SA 1IQFA 1XMNB 3ZZBA 1V2ST 6ESTA 2FI3E 3PO1B 4OS5A 1O3CA 3BTTE 1UCYK 3JZ1B 1SQOA 4ZAEA 1TQ7B 1AZ8A 1SC8U 4GUXA 4ISOA 1HRTH 4FUGA 2VGCC 1G3DA 2STAE 1OP8A 5EQQA 1HJ8A 1TIOA 8LPRA 1FQ3A 3SGQE 1ZR0A 1QJ7B 2TGDA 1HPGA 2C8YB 4WWYA 2RA0A 3KN2A 1O2RA 2BMGB 2IN2A 3Q76A 1LO6A 1C2JA 2TRMA 2PUXB 1N6YA 2Z9JA 1CBWB 3PB1E 2ZO3H 1GI7B 1AKSA 4Y8YA 2GT8A 1HAVB 5JBTA 2VWLA 5EQRA 3QTOH 3RP2A 3ZZ8A 4ZKNU 4X6MA 3GICB 4Q2KA 1Y8TA 1B0FA 4CRCA 1AFQB 1TA2A 1GVZA 2OXSA 1QRWA 1O3GA 2ZHFH 3RXFA 3MH4A 2OC8A 1EZSC 3E16B 4ZMAH 4O97A 3RMNH 1SGRE 1EX3A 4FUDA 3LIWA 2NU4E 1ZHMA 1LPKB 4XOJA 5HXFA 2H2ZA 3RXRA 2HOBA 1HDTH 2HNTC 4FU7A 5FBEA 1MAYA 1T7CA 1PQAA 3TNSA 4INHA 3TVJB 2XTTB 5EOKA 4MLFB 3VGCB 4X6PA 1ELDE 1AHTH 3LKWA 1O39A 1C2MA 1GVKB 3TJOA 1FN8A 2J94A 1MZDA 4NZQA 2CHAC 1EPTA 1WTHD 1G2LA 4WJG2 1ZMNA 1THPB 2STBE 2YNBA 1OYTH 2FX6A 1VCQA 3WY8A 5EXMA 1MD8A 1DUAA 1WUNH 5HM2A 2SNVA 1P57B 1O3LA 3GCNA 1IQLA 3LJOA 4BTIB 2J92A 1P9SA 2EI6A 3BTKE 1GDQA 5E0GA 1O2IA 1GBTA 4B1TA 1T4UH 2ZWLH 1Y3UA 4JCNA 1DWCH 3ITIA 4XBDA 3VFEA 2C8ZB 1V2PT 4BAKB 8ESTE 1OPHB 1PPGE 1O2YA 3GCTG 3T2NA 3VB3A 3U9AH 1OKXA 3ZZ6A 4UONA 1AVGH 2BOHB 3GCOA 3LC5A 2Y81A 4DG4A 3KF2A 2IJOB 3MHWU 5FXLA 4WH6A 1OS8A 2HNTF 1GBCA 1BRUP 1HAXB 2G4UA 2FYQA 2WPIS 2FOHA 2AS9A 1WYKA 2CV3A 2BY5X 4O03A 5A8XA 2J9NA 1V6DA 5H4IB 4Y0ZE 4JK6A 3MO9A 1RIWC 2ZA5A 4ZH8A 3TPIZ 2QCYA 2PHBA 2W26A 1G37A 2QXGA 3UREA 3EYDA 1O2WA 1TNLA 1NTPA 2ZFRH 1C5SA 4B2BA 1DSTA 3QGNB 5T3HA 2PKAA 3SGBE 3RU4D 1WBGB 3ZZ3A 4Y7AA 2PTCE 3SNAA 5AFYH 3GYLB 2W7SA 1UCYE 2ODQA 2XYAA 4Y6DA 3S7KB 1C1QA 1BMAA 5IYTA 2B9LA 4Q7XA 2BXUH 2HALA 2CHAB 1EASA 1EB2A 3M61U 1DDJA 2F9VA 4LK4A 1QY6A 3TITA 2SFAA 1C2KA 3MH6A 1SGFG 1HGTH 4M7GA 7GCHG 3S9CA 1UTNA 2HVXA 1CT0E 1P02A 4FUFA 2FTLE 1RTFB 3AAVA 2W3KA 3QO6A 1D3QB 1F92A 4GPGA 3IWMA 4JYVH 3RLYH 1O37A 2GGVB 2ULLA 1H8IH 3SNDA 1UVOA 2VWNA 4NA9H 1X7AC 2BVXH 4NG9H 1ACBE 1E37B 1S81A 1OOKB 1YCPM 2QYIA 4TWWA 1UMAH 1PQ7A 4Y76A 4BAHB 4Y11E 1C2HA 4NIYA 2EC9H 1NFWA 5TJXA 1XUGA 1UHBA 3A84A 1TONA 1EAUA 3UNQA 1GBHA 3L33A 2HWLB 4IS5A 1H4WA 1NC6A 2ZHWH 4NA7A 4DOQA 2ZGXH 1RS0A 2NU1E 2ZHDA 4VGCB 3RXSA 4IGDA 1P05A 3PTBA 3MTYA 1UTKA 1AU8A 2TPIZ 2I6QA 2NWNA 2GZ8A 2W3IA 1HAYB 1ZLRA 2OC1A 4MVNA 3T25A 2BM2A 1O36A 3ZVAA 2VU8E 2UWOA 3E8LA 3QZQA 1HUTH 1DSUA 3QX5H 1D3TB 1QHRB 1F5LA 1C5RA 2ZDKA 3K6YA 1A3BH 1C1SA 3SNEA 1CA8B 2SGQE 3LU9B 2LNCA 3EGKH 5A09A 4ABEA 1FIWA 5DK1A 4CRAA 3EE0B 1O0DH 4IW4E 1ETTH 4H42U 1NU9A 1E36B 4KKDA 1P09A 1BJVA 1NRNH 1Y5AT 4Q7YA 5PTPA 3PLPA 1QL7A 5EQSA 1XXFA 5DP7A 4MQAA 2BD2A 4DURA 5K7RA 1Z8RA 4GHQA 4U32A 3A8DA 4X1SU 3HPTB 4KGAA 4O9VA 1ELGA 2SGPE 1LKAA 2GCHF 2ZU4A 3TJUA 4AOQA 3A8BA 5EG4A 2GP9B 1HB0B 2ZGHA 3M7UA 1CO7E 2JH6D 1EUFA 1PPZA 3AW0A 3DUXH 1K1NA 3ATWA 1FY5A 1MU8B 4DY7B 5AHGH 4I8LA 5EPYA 1DXPA 1HIAA 1TNHA 4Y0YE 1KY9A 1PQ5A 1O2ZA 1WCZA 4B2AA 1ANDA 3BTHE 2G52A 1DICA 3QZRA 2ILNA 3BTEE 1Q3XA 1HAIH 2G55A 2ZU1A 4RKOB 3KQDA 1GI5A 1YF4A 1T8LA 3T29A 1C1WH 4B74A 3ZVGA 1DXWA 1SQTA 1DY8A 3M7TA 1AE5A 1FY3A 2BZAA 1GCDA 3M7QA 1GDNA 2XCNA 1L1NA 2Y5FA 3FP6E 1NFUA 3BIUH 5DP4A 1QB1A 2FOGA 1K9OE 2BY8X 1Y5BT 2BQ6B 1O2OA 1AFEH 2Q6FA 1KTTB 2Y5GA 2BDIA 1KDQB 3SV9A 3T28A 1PPBH 2H9TH 5L30H 1TWXB 2R2MB 3FFGA 5FHTA 5CHAC 3UY9A 1ZHRA 3RXTA 5DP3A 1B7XB 3IG6B 1CHOF 1MAXA 1IAUA 1BMNH 1AB9B 2BD8A 3ZVBA 1QQUA 3SI3H 2J2UA 1TX8A 1O2PA 1WQVH 1MBMA 1D4PB 5A0BA 1CHGA 3LH1A 1NS3A 1DWEH 1SHHB 1OWEA 1SQAA 1AGJA 1MKWH 4O3UA 1HFDA 4X8SH 4Y79A 3ZZ7A 1MKXH 2Q6DA 2O8MA 2TBSA 1HAGE 3FZDA 3D23A 4FUEA 5GXPA 1ZPZA 1A3EH 3OTJE 3ZZCA 1GI9B 4AB9A 3GY6A 1P9UA 1KXAA 2G51A 1Z71A 1G32B 2P3UB 1QBNA 1NZQH 2HRVA 3QN7A 1MCVA 1C5MD 3MYWA 2OUAA 1PPCE 4X8VH 1P2MA 3V12A 1J17T 4ABBA 3NK8A 1O2JA 2F9BH 4BOHA 2VVVA 1W7XH 1XUHA 1GMCF 1CGHA 1TNJA 3BG4B 5IDKA 3QDZB 1UTPA 1LMWB 3UOUA 1VITF 4XE4A 1DWBH 2BYAX 1NRRH 2FO9A 4ZHMU 1BHXB 3C1KA 3HKIB 1HAHH 3SJKA 2BLOA 1TBRH 4IMQA 5C20A 1TRMA 3RXJA 1MMJN 2F91A 3BTGE 2ZHEH 2CN0H 3O8BA 4OS4A 5AVDA 2G8TA 2FOAA 1TPOA 4YT6H 4LOYH 3F9HA 4MPVA 1P3CA 1UTLM 1O33A 4MTBA 4ZKRU 3EQ0H 4GCHG 4RN6A 4WXIA 2YOLA 3VB5A 4UD9H 3SQHE 3LH3A 1GBFA 1GBLA 2HPPH 1O5DH 3R3GB 1GJBB 5CHAB 2GMTB 4U30A 1G2MA 4A6LA 3SV8A 1HAPH 1UCYH 1C2IA 2ZQ1A 1O30A 4B73A 3A8CA 1K2I1 4AYYB 2C8WB 1GDUA 3PLBA 4AGJA 3KIDU 1W8BH 1GVLA 2FYRA 1P2NA 1JOUB 1WU1A 3P95A 4I8GA 2BDHA 1V2MT 1EKBB 1O2NA 1SBWA 2ZTXA 1JWTA 2VVUA 3A89A 1ANEA 1QQ4A 3KHVA 3ZZ5A 4YLUA 1SGPE 1EP6A 4K69A 3A87A 1ELFA 3MNCA 2R3UA 4X0WU 3Q77A 5G4BA 5BPEA 2GCHG 2BVSH 3BIVH 4HI3A 3QTVH 2QF3A 5DP8A 1T8MA 3RXVA 2A1DB 4OGXA 1MKWK 4YM9A 3SHAH 4AYVB 5T6DA 1O5EH 1O2QA 3EDXB 3M5OA 1L4DA 1Q31A 1ANBA 4Z0KA 3W95A 4CR9A 2FX4A 4CH8B 2BTCE 3HGNA 4GVUA 1MQ5A 3V3MA 1FPHH 3NUMA 2C93B 3DD2H 3P92A 5FCRA 2V0BA 1ELEE 2BOKA 1QGFA 4FXGH 5DPAA 1GJCB 4Y10E 2ZPQA 3LC3A 1GI0A 1ZOMA 2HLCA 1J14A 3OYPA 4FVDA 1GG6B 5DKMA 1NRQH 1SLVB 2EI7A 4K1TA 1V2WT 2SGFE 4H6SB 2J4IA 1XKAC 4ISHH 3GCHC 3SU4A 2ANKH 4D7FA 1CHOG 6GCHF 1IQEA 3MFJA 3G01A 3E1XB 5FX6A 4JZIA 3KL6A 1CU1A 1J9CH 1T32A 1FLEE 1TMBH 4I8HA 2FOMB 4R0IA 4MNXA 1YLDA 2OC0A 3AVZA 4X2XA 3T62A 1MTVA 5HMAA 2ZPRA 2GT7A 1ETSH 2G81E 1CE5A 3PROA 1MH0A 1D3DB 1CT2E 1XXDA 3VB7A 3RXHA 1UK3A 3UUZA 2VB0A 4DCDA 1SGDE 2XXLA 3BSQA 1IQHA 2QIQA 2KAIA 2ZU2A 3QWCH 1EZUC 1TGCA 4Q7ZA 1YCPH 1Z8GA 1DUEA 2QXJA 2HNTE 4H4FA 1LQEA 3I78A 3NXPA 3DT0H 3FP8E 1GMCG 4LZ4B 1V2VT 2XNIA 1K21H 3OX7U 1KSNA 1D3PB 5LPRA 3ZZ9A 2G00A 6CHAC 2ZCLP 1O3AA 1QURH 3TH3H 1C1VH 1LCYA 1DVAH 5FPSA 3GY8A 3M5NA 1QFKH 1TNIA 1TPSA 2C3SA 4FVBA 1HXEH 4UFEH 3Q00A 1Y3VA 4BAOB 5F03A 4YOIA 1TPPA 2WYGA 4ISNA 1BTPA 1JIMA 1UO6A 3BG8A 2Z3EA 2ZGJA 1F0TA 2FOFA 1GGDC 1DX5M 1DS2E 1P2JA 1L1JA 2UUFB 1W0YH 1XX9A 5LH8A 1SGFA
chains in the Genus database with same CATH superfamily
2J98B 1O5GH 3RLWH 4P00A 1G3BA 1ZJKA 1V3XA 2XNDD 1O3BA 1ESTA 4BXSA 3GCHB 1DITH 1T4VH 2FESH 5GPIB 1AWFH 1CGJE 1A1RA 3HK3B 4UDWH 1QIXB 5F8ZA 4IC6A 4DVAU 2XRCA 1ID5H 1HAVA 2THFB 3M3VA 2VINA 4XFQA 2Z9LA 5C5NA 1GBAA 3SNCA 3RXAA 2JETC 3A7TA 3UNSA 1P2IA 5ETXA 3MQKC 1YPJH 2GVFA 2ZQ2A 4AFUA 1ZTLA 4U01A 1QL9A 4OGYA 3B8JA 3QUMP 4NA8A 1HAZB 5HGGA 1BZXE 3MU1A 4Q80A 1P2OA 1O5AB 1G3EA 3F9GA 1MQ6A 2VVCA 1O2HA 4WVPE 1GBEA 4Q4LA 2A45B 1ABIH 3OE7D 1UTQA 5SGAE 3E6PH 2AH4X 1SPJA 3PLKA 4DIHH 1C2DA 1QBVH 1G36A 1OWHA 1TE0A 2VIWA 4YOGA 4CR5A 1F0UA 5ESTE 2ANYA 3ZV8A 3K65B 3OSYA 1LVBA 1BTXA 1EZQA 2PSXA 4Y71A 1G3CA 1O2XA 5EW2H 6CHAB 3V0XA 3KQEA 3ZVCA 5EJLA 3TH2H 4SGBE 4CH2B 3RXIA 1EAIA 2A2XH 2GV6A 1YCPK 1GJ5H 3NKKA 4FU8A 2F9UA 3RXCA 3RMOH 4INKA 3U8OH 1GHVH 4VGCC 1BB0B 3GDVA 1O3OA 2ALVA 1ARCA 1BITA 3F2GA 1O31A 4R8TB 1GGDB 2H6MA 1AVXA 2ZHQH 3D65E 1QB9A 4I8KA 3ESTA 2C90B 1EJMA 3RXPA 5FAHA 4X2VA 4FUCA 4D7GA 1FNIA 1NU7B 3SV2H 1A4WH 1Z1IA 3SV6A 2WV5A 4CRDA 1IQJA 4QT8C 2VIOA 2BDGA 2A7JA 3STJA 1W11U 3RXDA 4ABJA 3U8TH 1TNGA 6GCHG 4X1RU 1Y3YA 2F43B 2GX4A 3OY6U 4NIVA 5L2YH 2ANMH 2JETB 5GIBA 1P06A 2V3OH 1E35B 3UPEA 4A1XA 1AUTC 4MNVA 3MH7A 1RXPA 5T6FA 2P8OB 2VIPA 1C5VA 1GJ4H 2A4RA 1S6LA 4RI0A 5JDUB 2AGEX 4XBCA 1GI3A 3BF6H 1IQGA 1C5NH 2VIVA 4ZHAA 3V7TA 8GCHF 2ZDMA 1EAXA 3RXOA 2J34A 3U1JB 1HYLA 1PQ8A 2UUYA 3A7ZA 1GJ6A 1NBME 1C1OA 2ZI2H 1SGNE 1KXDA 1HNEE 3HK6B 1BRBE 1L4ZA 1BTWA 4ZROA 1DPOA 1K1OA 1AVWA 1TX7A 5C5OA 4B2CA 1GJ7B 2FIRH 2BD4A 1NT1A 2CF9H 2BY7X 2V6NA 2ZFQH 1S5SA 4OS2A 1AIXH 2PWXA 2A7HA 3OY5U 3QGJA 3O8CA 2P3FH 2FI4E 1AZZA 3HGPA 4JZ1A 1WV7H 1THRH 3E0PB 3H5CB 1A0LA 3MNXA 3F1SB 3NZIA 1CT4E 3KGPA 1U6QA 4OS1A 1PPFE 5CDFE 2BLVA 5GJ4B 3SNBA 3AW1A 1OHHD 1P2KA 1E1QD 4X1NU 1A0HB 1C9PA 3TGIE 2W7UA 3RU4E 1MTNC 1GBKA 3T5FH 1A5HA 2GZ9A 3M5MA 4MG3A 1GBBA 1D6WA 3MNSA 1BBRH 1LHDH 1KIGH 5AFZH 4ABHA 2QF0A 1Z8IB 1A5IA 1DLKB 3CS7A 5LGOA 4K8BA 1HBTH 4ISIH 1GL0E 2KCAA 2PSYA 5GCHF 2ESTE 1GL1A 2XBWA 1DWDH 3GY2A 4Y7BA 1SGIB 1P04A 3STIA 3UFAA 3ATKA 2VWOA 1O35A 1AB9C 1GMHF 4UFDH 2ZTYA 3BTQE 5EXNA 2Q1JA 4F4OC 2PW8H 5DP6A 2FXRA 1YPHC 3DHKH 1VZQH 2P59A 1M9UA 5A8YA 2XBVA 1HAOH 1S83A 4BANB 2F3CE 1HV7A 1KLJH 2TGTA 1BTYA 1YP9A 3SU1A 3TH4H 1K28D 2PGBB 1C5XB 2IPHA 1O3JA 2ZFFH 1E79D 3SJOA 2D26C 1UVUH 1WSSH 1GCTB 4MNWA 2L74A 1SSXA 2QXIA 1SGYE 3BG4C 1YGCH 4WMDA 3BN9A 2D2DA 1TRYA 1BMMH 1AQ7A 3LONA 1JRTA 2Y7XA 2AFQB 1W2KH 1OSSA 1GJ9B 3ODDA 3SU0A 4B6EA 2CGAA 1DY9A 3A85A 4JYTA 2F9PA 3UWIA 1C5OH 1FY8E 1AN1E 2WYJA 1UVPA 4IN1A 2BY6X 1C5TA 5EW1H 4IN2A 1NFXA 4GLYA 2V3MA 2AERH 3IITA 2CMYA 2BB4A 3D62A 3BTME 4KELA 2G5VA 2ZGBH 1MTNB 1JRSA 2Z7FE 1HCGA 1SR5C 4IBLH 4BAMB 2Q6GA 1GPZA 1SGQE 1XUIA 4BAQB 3P8FA 1LHEH 1YWUA 1MABB 3OEHD 1FIZA 3TIUA 5JBBS 3U98H 1O3DA 3P8NA 3V13A 2GMTC 3SW2B 5HYOA 1YPMH 3SQEE 1C1RA 5A8ZA 2G5NA 2UUJB 4HG6A 3RXEA 1XUKA 2FOEA 5E2PA 3RC4A 2Y82A 5CMXH 5DO4H 3URCA 4ZKOU 1C2GA 5LPFA 3B9FH 2KM0A 1TGBA 1BBRK 1VGCC 1LVYA 3SU2A 4D9QA 1BIOA 1OX1A 3TJVA 2WPHS 4ABGA 3S0NA 4JYUH 1BQYA 1O3NA 3VXEH 3QK1A 2FOCA 1RD3B 2M2AA 2W5EA 3C27B 2P93A 8GCHG 2I6SA 4X6NA 2BZ6H 1P10A 1OXGA 2RA3A 4TY6A 1KDQA 2Z3DA 1TPAE 2FEQH 4X6OA 1BHXF 3WW7A 1HJ9A 3SGAE 5JBCS 1YKTA 4NCYA 2V3HH 5K0HA 1TA6A 5C2ZA 5KECA 1S85A 1IHTH 1GI4A 1LPGB 1YLNA 2G4TA 3A82A 3F6UH 1ESAA 1ZHPA 3SUDA 1HXFH 5DP9A 1KXCA 4NGAH 2B7DH 1KXBA 1WOFA 3PMJA 5EXLA 1WAYB 4ZUHA 3RC6A 3TGKE 1UTOA 1ZSKA 2A4QA 5KEDA 1C2LA 3ELAH 2P94A 1QA7A 2J38A 3DFLA 1EP5A 2R0LA 1ZGVA 1GWAA 2OLGA 2GJGA 4DJZB 4WMEA 1PPHE 4OM9A 3SUGA 2ZCKP 2EI8A 4TWYA 1SFQB 3TNTA 4NIXA 1XUFA 3LT3A 3KQ5A 4CHAB 3QLPH 3E0NB 1RGQA 4AG1A 3TK6A 3PYHA 3UB0A 4I7YH 1MZAA 1GBDA 2QE7D 3H7TA 4FUBA 1D9IA 2V35A 3D49H 4YZUA 3UR6A 1LVOA 2ZIQH 4FOUC 4GAWA 4X2WA 5DSFA 1GG6C 2WUCA 1ARBA 2L6OA 4P02A 3P6ZB 2B5TB 1IHSH 5J4QA 1DE7H 5I46H 5GCHG 1ZTJA 1ABJH 1KLTA 5EIYA 1DM4B 2XBYA 1GBIA 4MPWA 4THNH 2EA3A 2Y6TA 4ACAA 1GMHG 4SGAE 3NCLA 7ESTE 2F9NA 1UTJA 4K3JA 1VGCB 2ZDLA 3R0FA 5AF9H 4JZDH 3RXMA 4MDSA 5EGMA 3F68H 2HGTH 1DOJA 3PV5A 1OWDA 3A8AA 1O3FA 2WPJS 1TRNA 1CGIE 1H9LB 1CVWH 3GY5A 4B71A 1LDTT 3H09A 3KQBA 5B6OA 2BDAA 4E06H 2ZPSA 2RFKC 1T8OA 4ISLA 3FVFB 4LZ1H 1Q2WA 4ZXYH 3O8DA 3LDXH 5FPTA 1QTFA 1FXYA 1W3CA 2BLWA 3B23B 1EJAA 3SZNA 4UEHH 4JZEH 1TNKA 3LGVA 1WDIA 2J5UA 1Y3XA 4AORA 2TGPZ 3SV7A 2TGAA 1W12U 1SB1H 1C5WB 1FPCH 5TCCA 2QGRA 5F8XA 5GNDA 2M5TA 1SOTA 1VCWA 1V2OT 3LPRA 8KME2 2GD4B 1XUJA 3MH5A 3A81A 2BDCA 4ACBA 3A7XA 1J16A 3RMLH 1SI5H 4AZ2B 2VNTA 2OC7A 1BBRE 4WH8A 9ESTA 2BLQA 2GTBA 4MPUA 4OS7A 2ANWA 2ZEBA 3GYMA 1C1PA 1FN6A 3EA7A 1EPTC 1S82A 1NFYA 3RC5A 4AB8A 1TBZH 2XWBI 3MO3A 1TMUH 3A7VA 4X1QU 2D8WA 5JB8S 2QC2A 1IQKA 3U28C 1XVMA 2GCTC 4NFFA 2PR3A 2SGDE 5A0CA 2GDDA 1GI1A 1RFNA 2BXTH 1BMFD 1C9TA 4K1SA 1O2GH 4YO9A 2NU3E 2BD3A 1FI8A 1TQ0B 3ZZ4A 3VPKA 2OBQA 3MMGA 2IJD1 4JZFH 1NY22 1TALA 2A4GA 1MTWA 1SKYE 3UIRA 3ZVDA 4KTCA 2AEIH 2QA9E 3RXGA 1C4V2 1EQ9A 2UUKB 3N7OA 1ZTKA 1W0KD 2OQUA 2ALPA 1GHXH 3SUFA 1N8OC 4A7IB 1AKSB 4WY3A 4A5TS 2O8TA 7GCHF 5EJZA 7KMEH 1UK2A 4RKJB 1GI2A 2OCVB 1N1LA 1O3EA 2AMDA 2BD7A 4F49A 1ZYOA 1F2SE 2QF5A 1CQQA 2YMSD 2O9QA 3F2FA 1SLXB 3F2HA 3UOPA 1SMFE 1VITG 5C1XA 2BQ7B 3ZVFA 5A0AE 3PWBA 3Q3KA 1LHFH 2ZU5A 2PKSC 3RDZA 3FP7E 1FZZA 4D76A 4YTAA 1WQSA 1Y5UT 1GBMA 1GHAF 1HJAB 1C5QA 2KCPA 3H7OA 4MNYA 2H9HA 2O8LA 1C1UH 4HGCA 3P8OA 2XBXA 1O32A 1MTUA 3VEQB 1TOMH 1BRCE 4UFGH 3E91A 1BJUA 4X8UH 1UW7A 2J95A 1SVPA 3M35A 1PPEE 1C1TA 3PMHB 1EPTB 3OU0A 5ESBA 1OP2A 2F4LA 1BOQA 1ZPCA 5L6NH 3PRDA 1LVMA 2NU0E 2GCTB 4H6TA 5HIYA 1K1LA 2FPZA 4CBNA 3RXQA 2UWLA 4AFZA 2R0KA 3E90B 3SYJA 4ESTE 1RTLA 1TYNA 4E05H 1AD8H 1GHYH 1FAXA 3SN8A 4DW2U 1P11E 1VJ9U 2FWWA 1QNJA 1F5RA 4INLA 2P8OC 1L2EA 1Z7KA 5EJ1A 2C8XB 2XC0A 2Z94A 3T27A 1UJ1A 4PROA 1QZ8A 1ELBA 1GHZA 3SZEA 2ZP0H 2ZC9H 4JK5A 2WINI 2XCFA 2A5KA 1DANH 2P95A 1W14U 2PTNA 1S6FA 2J98A 2PUQH 1W0ZU 2ZFSA 5CE1A 2H5DA 1NM6A 1LQDB 3LGUA 1N6XA 3SUEA 5JB9S 1AO5A 1N8OB 3AASA 2FS9A 2GV7A 1MD7A 1YC0A 1P3EA 3UWJH 3UTUH 2OQ5A 2AHME 3ZYEA 1E34B 1XKBC 2A32A 2CJIA 2Z3CA 3LGIA 4A1TA 3SJ9A 5JBAS 1B0EA 2A7CA 2XC4A 1A2CH 3MU5A 1ELVA 1YYY1 3RUOA 3L6PA 1EATA 4YESB 1TMTH 2BDBA 2VGCB 3CENA 2PKSB 1YPLH 1EJNA 1QRZA 1B5GH 5J4SA 1S6HA 5HIZA 1V2KT 4K2YA 1GJ8B 1S0QA 4Y8XA 2PKAB 4X8TH 1EOJA 1Y3WA 1ZMLA 4O3TA 1SLUB 3KCGH 1SHYA 1W13U 3OAAD 3RM2H 2QN5T 5FBIA 3TLOA 1MU6B 4ASUD 5F8TA 1YPEH 1TBQH 4OS6A 1UVSH 1SGEE 1GBJA 2SGEE 5DGJA 2PLXA 4D9RA 2YMSC 4WXVA 1ZRKA 1O3HA 3ENSB 2RCEA 4TPIZ 3MI4A 3SO3A 2ZDNA 2AGIX 4U2WA 1OP0A 3ZZDA 2HPQH 3AAUA 3GY7A 4ZCNA 3LGYA 1C5YB 5GWZA 1LHCH 5FCKA 2ODYB 1ELCA 2AIPA 2QXHA 3A83A 1V2RT 2VJ1A 3RMMH 3SBKA 1CSOE 1C5ZB 1D6RA 2XC5A 5C1YA 4UFFH 2BY9X 4AN7A 1K22H 2VH0A 1OWIA 3GISB 3LJJA 2JH5D 3TGJE 2EEKA 4J1YA 2VWMA 3GY3A 3PMBB 1V2UT 2FODA 1TOCB 2FI5E 1H1BA 4I86A 2WSSD 2D1JA 1A5GH 2ZGCA 3TK5A 4WF8A 1T8NA 3A7WA 1BRAA 2CF8H 1UHBB 2BDYA 2NU2E 2PV9B 4YT7H 1DFPA 3MU4A 1KXFA 1XM1A 2ZU3A 1C1NA 1GCTC 2AMPA 2WPMS 3HKJB 3BTDE 4DGJA 1ZRBA 3K6ZA 1C5PA 4TPYA 1PFXC 1P0SH 1SL3A 3SHCH 1W10U 2P3TB 2JKHA 3SJ8A 4JMYA 1YPHE 4IC5A 5DG6A 5C3NA 4ZXXH 2WPKS 5JYIA 1IOEA 3W94A 3NPSA 2SGAA 1O5BB 2DUCA 2ZDAH 1NRPH 2RG3A 1AUJA 1F0RA 1CA0C 3PRBA 3P17H 1GHAG 2A2QH 3K2UA 4I31A 1HLTH 1ZSLA 1GI6A 4NWKA 2OK5A 4B76A 1RTKA 1A61H 2F83A 4HFPB 5E0JA 3GY4A 1GJDB 4DT7B 2GKVE 1IQNA 5HM9A 1QA0A 4A1VA 1BTUA 1MTSA 2AIQA 5ABWA 2YMSB 1V2QT 1G30B 3KQCA 4NIWA 2H5CA 4E7RG 1BTZA 2BHGA 3A86A 3AK5A 1J15A 1O3KA 3CNRA 1FV9A 1MCTA 1OWKA 4NSVA 3SI4H 4DT4A 1LPZB 1RIWB 4GCHF 5E2OA 3O8RA 1SLWB 4CRGA 1ELTA 1UTMA 3RXKA 1JMOH 3MWIU 4Z6AH 2P16A 5EU8A 1C2EA 2IOTA 1H9IE 1Y59T 3MU8A 2WV4A 2R2WU 1K1PA 2Z9KA 1ETRH 2FOBA 3M5LA 1ZMJA 1Z6EA 2OD3B 2R9PA 1TB6H 3PV4A 2JIZD 4TYDA 3F9FA 3ATLA 2UWPA 1FONA 1OYQA 2JH0D 1O2KA 1O5CB 1DT2A 3TJNA 1BTHH 3KYFA 3UNRA 1HIAB 2FTMA 3RXLA 1NRSH 2BQWB 3SU3A 3MOCA 1Z8JB 1P12E 1ZZZA 1KTSB 5L2ZH 2OINA 4KTSA 5I25A 2B8OH 5DJ7A 2VIQA 4AFQA 3CS0A 3GDUA 1BA8B 1RRKA 2FM2A 4HTCH 1QCPA 2BX4A 1ANCA 4K1EA 2ZECA 3DCLA 5LPEA 5F6MA 1ZPBA 1SGTA 3TK9A 1BCUH 3MNBA 3DSOA 3A80A 2KZ4A 3SOSA 1O38A 3S69A 3ZVEA 1DLEA 3S9AA 5A2MH 1MBQA 2TIOA 1CA0B 4I32A 1O2MA 4MPXA 3PV2A 1F5KU 1EB1H 1YPGH 2SNWA 3KEEA 1KXEA 2RDLA 3FN8A 3BEUA 4BXWA 1QRXA 4CHAC 2OBOA 5EPNA 1GMDF 5FX5A 2ZNKH 3URDA 4LXBH 1O3MA 2Y5HA 1J8AA 3OTPA 1V2TT 2ZDVH 2FDAA 2GZ7A 2QV1A 1H9HE 2A4OA 2KCYA 1LTOA 1C1MA 4E7NA 1QBOA 2Z6BD 1NROH 1O2TA 4XBBA 3PMAB 2QAAA 1XVOA 1QL8A 3T26A 4RSPA 1QR3E 3M3TA 3LGWA 1SG8B 3A88A 1AI8H 1WTGH 1TLDA 1JIRA 4TY7A 1LKBA 2H9EH 4D8NA 5B6LA 4FU9A 1KYNA 1GHBF 4BTUB 2LELA 1NO9H 2PGQB 2ZKSA 3EA9A 4B6FA 3F0PA 3NWUA 4NWLA 5EODA 4ASHA 4IMZA 5FPYA 2O8WA 1S0RA 3W1EA 4AGKA 9LPRA 4YOJA 1S84A 4I8JA 1E38B 1SFIA 2JDID 3UAIC 4FETA 4K5ZA 2C4FH 4KP0A 3U1IB 1O3PB 1EZXC 2EY4C 2WPLS 3VB6A 4GSOA 1FY4A 2A31A 1VR1H 2FLRH 1KLIH 3I29A 1THSH 1ESBA 1O2VA 5E0HA 1BT7A 2ZF0H 3P70B 1SOZA 1AE8H 3FO8D 3MO6A 4NSYA 3SU6A 1ELAA 3U69H 4ZHLU 2ZTZA 4I33A 3EA8A 1O5FH 3KNXA 3L3TA 1VCPA 4CRFA 1K1JA 1JBUH 5C1UA 1FJSA 4Q63A 2FLBH 5C67A 3VB4A 1C5LH 3MU0A 2FMJA 5FL7D 1YPKH 3PWCA 3LGTA 4ABIA 2BVRH 5JPMH 4ABAA 1K1IA 2DE9A 1YM0A 1PYTD 4AFSA 1O34A 3U8RH 1AWHB 5E8EH 4K60A 3Q3YA 4GHTA 7LPRA 1GJAB 4XDEA 1JXPA 1TABE 2ZZUH 2ZG0H 5BRRE 1UVTH 1F7ZA 2Z9GA 1ZSJA 1YBWA 1G9IE 3TU7H 1COWD 1QJ1B 1TGNA 1VKYA 1FX0B 2XW9A 2XWAA 3BEIB 4AG2A 3NRLA 1A46H 3RM0H 1AMHA 3N99A 1EOLA 2AYWA 1Z6JH 2KX4A 1ZJDA 2A5IA 4K8YA 2BX3A 3CP7A 3SJIA 3UQVA 5TCAA 2ASUB 4CRBA 1C2FA 1INCA 4YLQH 3RU4T 4ZKSU 3SORA 1FMGA 1O2UA 3ODFA 1NESE 1W7GH 3EAJA 1FUJA 4KTUA 1AY6H 2K1QA 3KYGA 3UQOA 3PM3A 1SGCA 1O3IA 5DN6D 4FUIA 1L0ZA 4ABFA 3ATIA 1EXFA 3HATH 4FUHA 3S9BA 1V2NT 2DE8A 2Y7ZA 1TFXA 2B0FA 1O2LA 1H8HD 3BTWE 2LPRA 1K1MA 1IQIA 2BD9A 1C4U2 2BD5A 3S7HB 5GDSH 1QJ6B 4WMFA 2CXVA 2AGGX 2ZFTA 1ZGIA 3ATMA 1UK4A 3BTFE 1C4Y2 1MUEB 3LOXA 2QY0B 1NN6A 3GDSA 3M36A 3Q3XA 1YLCA 3PO1C 1FAKH 2WUBA 2Z9IA 1EAWA 1RJXB 4ABDA 6LPRA 1K0HA 5C17A 3ZV9A 1T31A 1TX6A 1TGSZ 2ZCHP 5DP5A 1OWJA 2ZFPH 1BMLA 1BDAA 2PP6A 3FAOA 3M37A 1H8DH 1GHWH 3GCTF 2YNAA 3M3SA 3BV9B 1GI8B 1HJAC 3K9XB 1MKXK 1QB6A 2VH6A 1BUIA 2WPDD 1E0FD 4BTTB 2OTVA 4X2YA 3RXBA 4NZLA 3ZYDA 1CBWC 4DIIH 1GMDG 1FDPA 2Y80A 3GOVB 3DA9B 3BEFB 4NFEA 4X1PU 4CREA 2A0QB 2FZZA 2VIDA 2W6JD 3RXUA 2H1UA 1A0JA 1AFQC 5T6GA 1P01A 1LHGH 3FANA 1FY1A 2AMQA 3P8GA 2F9OA 1TAWA 2A5AA 3F9EA 1V2LT 1V2JT 4UE7H 2KAIB 4CBOA 2ODPA 1TGTA 1Z1JA 1A7SA 1IQMA 4FUJA 3A7YA 1ORFA 1PYTC 3VXFH 1GHBG 4B75A 1PJPA 1VJAU 4BNRA 1C5UA 2PFEA 1P8VC 2W6ID 3DSGA 4HZHA 3FZZA 3I77A 1L1GA 3JZ2B 1O2SA 1VITH 3FKSD 2OP9A 4Y8ZA 3VGCC 3E3TA 1P03A 2O8UA 4XSKU 3UR9A 4AX9H 2FP7B 1NPMA 3DFJA 2R3YA 3PTNA 3SU5A 2FS8A 2GDEH 3ZZAA 4A92A 1P2QA 3N7DA 4J2YB 1F0SA 2IPQX 1IQFA 1XMNB 3ZZBA 1V2ST 6ESTA 2FI3E 3PO1B 4OS5A 1O3CA 2HLDD 3BTTE 1UCYK 3JZ1B 1SQOA 4ZAEA 1TQ7B 1AZ8A 1SC8U 4GUXA 4ISOA 1HRTH 4FUGA 1WXRA 2VGCC 1G3DA 4XD7D 2STAE 1OP8A 5EQQA 1HJ8A 2QF4A 1TIOA 8LPRA 1FQ3A 3SGQE 1ZR0A 1QJ7B 2TGDA 1HPGA 2C8YB 4WWYA 2RA0A 3KN2A 1O2RA 2BMGB 2IN2A 3Q76A 1LO6A 1C2JA 2TRMA 3F3BA 2PUXB 1N6YA 2Z9JA 1CBWB 3PB1E 2ZO3H 1GI7B 1AKSA 4Y8YA 2GT8A 1HAVB 5JBTA 2VWLA 5EQRA 3QTOH 3RP2A 3ZZ8A 4ZKNU 4X6MA 3GICB 4Q2KA 1Y8TA 1B0FA 4CRCA 1AFQB 1TA2A 1GVZA 2OXSA 1QRWA 1O3GA 2ZHFH 3RXFA 3MH4A 2OC8A 4XRNA 1EZSC 3E16B 4ZMAH 4O97A 3RMNH 1SGRE 1EX3A 4FUDA 3LIWA 4M9FA 2NU4E 1ZHMA 1LPKB 4XOJA 5HXFA 2H2ZA 3RXRA 2HOBA 1HDTH 2HNTC 4FU7A 5FBEA 1MAYA 1T7CA 1PQAA 3TNSA 4INHA 3TVJB 2XTTB 5EOKA 4MLFB 3VGCB 4X6PA 1ELDE 1AHTH 3LKWA 1O39A 1C2MA 1GVKB 3TJOA 1FN8A 2J94A 1MZDA 4NZQA 2CHAC 1EPTA 1WTHD 1G2LA 4WJG2 1ZMNA 1THPB 2STBE 2YNBA 1OYTH 2FX6A 1VCQA 3WY8A 5EXMA 1MD8A 1DUAA 1WUNH 5HM2A 2SNVA 1P57B 1O3LA 3GCNA 1IQLA 3LJOA 4BTIB 2J92A 1P9SA 2EI6A 3BTKE 1GDQA 5E0GA 1O2IA 1GBTA 4B1TA 1T4UH 2ZWLH 1Y3UA 4JCNA 1DWCH 4F55A 3ITIA 4XBDA 3VFEA 2C8ZB 1V2PT 5KGOA 4BAKB 8ESTE 1OPHB 1NBMD 1PPGE 1O2YA 3GCTG 3T2NA 3VB3A 3U9AH 1OKXA 3ZZ6A 4UONA 1AVGH 2BOHB 3GCOA 3LC5A 2Y81A 4DG4A 2K0QA 3KF2A 2IJOB 2KFWA 3MHWU 5FXLA 4WH6A 1OS8A 2HNTF 1GBCA 1BRUP 1HAXB 2G4UA 2FYQA 2WPIS 2FOHA 2WZQA 2AS9A 1WYKA 2CV3A 2BY5X 4O03A 5C94A 5A8XA 2J9NA 1V6DA 5H4IB 4Y0ZE 4JK6A 3MO9A 1RIWC 2ZA5A 4ZH8A 3TPIZ 2QCYA 2PHBA 2W26A 1G37A 2QXGA 3UREA 3EYDA 1O2WA 1TNLA 1NTPA 2ZFRH 1C5SA 4B2BA 1DSTA 3QGNB 4TT3D 2PKAA 5T3HA 3RU4D 3SGBE 1WBGB 3ZZ3A 4Y7AA 2PTCE 3SNAA 5AFYH 3OEED 3GYLB 1W0JD 2W7SA 4TSFD 1UCYE 2ODQA 2XYAA 4Y6DA 3S7KB 1C1QA 4Z1MD 1BMAA 5IYTA 2B9LA 4Q7XA 2BXUH 2HALA 2CHAB 1EASA 1EB2A 3M61U 1DDJA 2F9VA 4LK4A 1QY6A 3TITA 2SFAA 1C2KA 3MH6A 1SGFG 1HGTH 4M7GA 7GCHG 3S9CA 2V7QD 1UTNA 2HVXA 1CT0E 1P02A 4FUFA 2FTLE 1RTFB 3AAVA 2W3KA 3QO6A 1D3QB 1F92A 4GPGA 3IWMA 4JYVH 3RLYH 1O37A 2GGVB 2ULLA 1H8IH 3SNDA 1UVOA 2VWNA 4NA9H 1X7AC 3N7EA 2BVXH 4NG9H 1ACBE 1E37B 1S81A 1OOKB 1YCPM 2QYIA 4TWWA 3ZIAD 1UMAH 1PQ7A 4Y76A 4BAHB 4Y11E 1C2HA 4NIYA 4RT0A 2EC9H 1NFWA 5TJXA 1XUGA 1UHBA 3A84A 1TONA 1EAUA 3UNQA 1GBHA 3L33A 2HWLB 4IS5A 1H4WA 1NC6A 3F0OA 2ZHWH 4NA7A 4DOQA 2ZGXH 1RS0A 2NU1E 2ZHDA 5C0TA 4VGCB 3RXSA 4IGDA 1P05A 3PTBA 3MTYA 1UTKA 1AU8A 2TPIZ 2I6QA 2NWNA 2GZ8A 2W3IA 1HAYB 1ZLRA 2OC1A 4MVNA 3T25A 4F48B 2BM2A 1O36A 3ZVAA 2VU8E 2UWOA 3E8LA 3QZQA 1HUTH 1DSUA 2CK3D 3QX5H 1D3TB 1QHRB 1F5LA 1C5RA 2ZDKA 3K6YA 1A3BH 1C1SA 3SNEA 1CA8B 1EFRD 2SGQE 3LU9B 2LNCA 3EGKH 5A09A 4ABEA 1FIWA 5DK1A 4CRAA 3EE0B 1O0DH 4IW4E 1ETTH 4H42U 1NU9A 1E36B 4AC9A 4KKDA 1P09A 1BJVA 1NRNH 1Y5AT 4Q7YA 5PTPA 3PLPA 1QL7A 5EQSA 3OFND 1XXFA 5DP7A 4MQAA 2BD2A 4DURA 5K7RA 1Z8RA 4GHQA 4U32A 3A8DA 4X1SU 3HPTB 4KGAA 4O9VA 1ELGA 2SGPE 1LKAA 2GCHF 2ZU4A 3GS9A 3TJUA 4AOQA 3A8BA 5EG4A 2GP9B 1HB0B 2ZGHA 3M7UA 1CO7E 2JH6D 1EUFA 1PPZA 3AW0A 3DUXH 1K1NA 3ATWA 1FY5A 1MU8B 4DY7B 5AHGH 4I8LA 5EPYA 1DXPA 1HIAA 1TNHA 4Y0YE 2KR7A 2HVYB 2KCOA 1KY9A 1PQ5A 1O2ZA 1WCZA 4B2AA 1ANDA 3BTHE 2G52A 1DICA 3QZRA 2ILNA 3BTEE 1Q3XA 1HAIH 2K8IA 2G55A 2ZU1A 4RKOB 3KQDA 1GI5A 1YF4A 1T8LA 3T29A 1C1WH 4B74A 3ZVGA 1DXWA 1SQTA 1DY8A 3M7TA 1AE5A 1FY3A 2BZAA 1GCDA 3M7QA 1GDNA 2XCNA 1L1NA 2Y5FA 3FP6E 1NFUA 3BIUH 5DP4A 1QB1A 2FOGA 1K9OE 2BY8X 1Y5BT 2BQ6B 1O2OA 1AFEH 2Q6FA 1KTTB 1E1RD 2BDIA 2Y5GA 1KDQB 3SV9A 3T28A 1PPBH 2H9TH 5L30H 1TWXB 2R2MB 3FFGA 5FHTA 5CHAC 3UY9A 1ZHRA 3RXTA 5DP3A 1B7XB 3IG6B 1CHOF 1MAXA 5IK2D 1IAUA 1BMNH 1AB9B 2BD8A 3ZVBA 1QQUA 3SI3H 2J2UA 1TX8A 1O2PA 1WQVH 1MBMA 1D4PB 5A0BA 1CHGA 3LH1A 1NS3A 1DWEH 1SHHB 1OWEA 1SQAA 1AGJA 1MKWH 4O3UA 1HFDA 4X8SH 4Y79A 3ZZ7A 1MKXH 2Q6DA 2O8MA 2TBSA 1HAGE 3FZDA 3D23A 4FUEA 5GXPA 1ZPZA 1A3EH 3OTJE 3ZZCA 1GI9B 4AB9A 3GY6A 1P9UA 1KXAA 2G51A 1Z71A 1G32B 2P3UB 1QBNA 1NZQH 2HRVA 3QN7A 1MCVA 1C5MD 3MYWA 2OUAA 1PPCE 4X8VH 1P2MA 3V12A 1J17T 4ABBA 3NK8A 1O2JA 2F9BH 4BOHA 2VVVA 1W7XH 1XUHA 1GMCF 1CGHA 1TNJA 3BG4B 3DSPA 5IDKA 3QDZB 1UTPA 1LMWB 2EQNA 3UOUA 1VITF 4XE4A 1DWBH 2BYAX 1NRRH 2FO9A 4ZHMU 1BHXB 3C1KA 5C0UA 3HKIB 1HAHH 3SJKA 2BLOA 1TBRH 4IMQA 5C20A 1TRMA 3RXJA 1MMJN 2F91A 3BTGE 2ZHEH 2CN0H 3O8BA 4OS4A 5AVDA 2G8TA 2FOAA 1TPOA 2JJ2D 4YT6H 4LOYH 3F9HA 4MPVA 1P3CA 1UTLM 5F53A 1O33A 4MTBA 4ZKRU 3EQ0H 4GCHG 4RN6A 4WXIA 2YOLA 3VB5A 4UD9H 3SQHE 3LH3A 1GBFA 1GBLA 2HPPH 1O5DH 3R3GB 1GJBB 5CHAB 2GMTB 4U30A 1G2MA 4A6LA 3SV8A 1HAPH 1UCYH 1C2IA 2ZQ1A 1O30A 4B73A 3A8CA 1K2I1 4AYYB 2C8WB 1GDUA 3PLBA 4AGJA 3KIDU 1W8BH 1GVLA 2FYRA 1P2NA 1JOUB 1WU1A 3P95A 4I8GA 2BDHA 1V2MT 1EKBB 1O2NA 1SBWA 2ZTXA 1JWTA 2VVUA 3A89A 2J97A 1ANEA 1QQ4A 3KHVA 3ZZ5A 4YLUA 1SGPE 1EP6A 4K69A 5T1VA 3A87A 1ELFA 3MNCA 2R3UA 4X0WU 3Q77A 5G4BA 5BPEA 2GCHG 2BVSH 3BIVH 4HI3A 3QTVH 2QF3A 5DP8A 1T8MA 3RXVA 2A1DB 4OGXA 1MKWK 4YM9A 3SHAH 4RT1A 4AYVB 5T6DA 1O5EH 1O2QA 3EDXB 3M5OA 1L4DA 3WWFA 2WV9A 1Q31A 1ANBA 5CHBA 2JJ1D 4Z0KA 3W95A 4CR9A 2FX4A 4CH8B 2BTCE 3HGNA 4GVUA 1MQ5A 3V3MA 1FPHH 3NUMA 2C93B 3DD2H 3P92A 5FCRA 2V0BA 1ELEE 2BOKA 1QGFA 4FXGH 5DPAA 1GJCB 4Y10E 2XOKD 2ZPQA 3LC3A 1H8ED 1GI0A 1ZOMA 2HLCA 1J14A 3OYPA 4FVDA 1GG6B 5DKMA 1NRQH 1SLVB 2EI7A 4K1TA 1V2WT 2SGFE 4H6SB 3WWBA 2J4IA 1XKAC 3FOAA 4ISHH 5HKKD 3GCHC 3SU4A 2VBCA 2ANKH 4D7FA 1CHOG 6GCHF 1IQEA 4YXWD 3MFJA 3G01A 3E1XB 5FX6A 4JZIA 3KL6A 1CU1A 1J9CH 1T32A 1FLEE 1TMBH 4I8HA 2FOMB 4R0IA 3VG8A 4MNXA 1YLDA 1KMHB 2OC0A 3AVZA 4X2XA 3T62A 1MTVA 5HMAA 2ZPRA 2GT7A 1ETSH 2G81E 1CE5A 3PROA 1MH0A 3EE7A 1D3DB 1CT2E 1XXDA 3VB7A 3RXHA 1UK3A 3UUZA 2VB0A 4DCDA 1SGDE 2XXLA 3BSQA 1IQHA 2QIQA 2KAIA 2ZU2A 3QWCH 1EZUC 1TGCA 4Q7ZA 1YCPH 2RDEA 1Z8GA 1DUEA 2QXJA 2HNTE 4H4FA 1LQEA 3I78A 2WHXA 3NXPA 3DT0H 3FP8E 1GMCG 4LZ4B 1V2VT 2XNIA 1K21H 3OX7U 1KSNA 1D3PB 5LPRA 3ZZ9A 2G00A 6CHAC 1YY3A 2ZCLP 1O3AA 1QURH 3TH3H 2LP6A 1C1VH 1LCYA 1DVAH 5FPSA 1SQRA 3GY8A 3M5NA 1QFKH 1TNIA 1TPSA 2C3SA 4FVBA 1HXEH 4UFEH 3Q00A 1Y3VA 4BAOB 5F03A 4YOIA 1TPPA 2WYGA 4ISNA 1BTPA 1JIMA 1UO6A 3BG8A 2Z3EA 2ZGJA 1F0TA 2FOFA 1GGDC 1DX5M 1DS2E 1P2JA 1L1JA 2UUFB 1W0YH 1XX9A 5LH8A 1SGFA
chains in the Genus database with same CATH topology
1O5GH 3RLWH 1G3BA 1ZJKA 1V3XA 1O3BA 1ESTA 4BXSA 3GCHB 1DITH 1T4VH 2FESH 5GPIB 1AWFH 1CGJE 1A1RA 3HK3B 4UDWH 1QIXB 5F8ZA 4IC6A 4DVAU 2XRCA 1ID5H 1HAVA 2THFB 3M3VA 2VINA 4XFQA 2Z9LA 5C5NA 1GBAA 3SNCA 3RXAA 2JETC 3A7TA 3UNSA 1P2IA 5ETXA 1YPJH 2GVFA 2ZQ2A 4AFUA 1ZTLA 4U01A 1QL9A 4OGYA 3B8JA 3QUMP 4NA8A 1HAZB 5HGGA 1BZXE 3MU1A 4Q80A 1P2OA 1O5AB 1G3EA 3F9GA 1MQ6A 2VVCA 1O2HA 4WVPE 1GBEA 2A45B 1ABIH 1UTQA 5SGAE 3E6PH 2AH4X 1SPJA 3PLKA 4DIHH 1C2DA 1QBVH 1G36A 1OWHA 1TE0A 2VIWA 4YOGA 4CR5A 1F0UA 5ESTE 2ANYA 3ZV8A 3K65B 3OSYA 1LVBA 1BTXA 1EZQA 2PSXA 4Y71A 1G3CA 1O2XA 5EW2H 6CHAB 3V0XA 3KQEA 3ZVCA 3TH2H 4SGBE 4CH2B 3RXIA 1EAIA 2A2XH 2GV6A 1YCPK 1GJ5H 3NKKA 4FU8A 2F9UA 3RXCA 3RMOH 4INKA 3U8OH 1GHVH 4VGCC 1BB0B 3GDVA 1O3OA 2ALVA 1ARCA 1BITA 1O31A 4R8TB 1GGDB 2H6MA 1AVXA 2ZHQH 3D65E 1QB9A 4I8KA 3ESTA 2C90B 1EJMA 3RXPA 5FAHA 4X2VA 4FUCA 4D7GA 1FNIA 1NU7B 3SV2H 1A4WH 1Z1IA 3SV6A 2WV5A 4CRDA 1IQJA 4QT8C 2VIOA 2BDGA 2A7JA 3STJA 1W11U 3RXDA 4ABJA 3U8TH 1TNGA 6GCHG 4X1RU 1Y3YA 2GX4A 3OY6U 4NIVA 5L2YH 2ANMH 2JETB 5GIBA 1P06A 2V3OH 1E35B 3UPEA 4A1XA 1AUTC 4MNVA 3MH7A 1RXPA 5T6FA 2P8OB 2VIPA 1C5VA 1GJ4H 2A4RA 5JDUB 2AGEX 4XBCA 1GI3A 3BF6H 1IQGA 1C5NH 2VIVA 4ZHAA 3V7TA 8GCHF 2ZDMA 1EAXA 3RXOA 2J34A 3U1JB 1HYLA 1PQ8A 2UUYA 3A7ZA 1GJ6A 1C1OA 2ZI2H 1SGNE 1KXDA 1HNEE 3HK6B 1BRBE 1L4ZA 1BTWA 4ZROA 1DPOA 1K1OA 1AVWA 1TX7A 5C5OA 4B2CA 1GJ7B 2FIRH 2BD4A 1NT1A 2CF9H 2BY7X 2V6NA 2ZFQH 1S5SA 4OS2A 1AIXH 2PWXA 2A7HA 3OY5U 3QGJA 3O8CA 2P3FH 2FI4E 1AZZA 3HGPA 4JZ1A 1WV7H 1THRH 3E0PB 3H5CB 1A0LA 3MNXA 3F1SB 3NZIA 1CT4E 3KGPA 1U6QA 4OS1A 1PPFE 2BLVA 5GJ4B 3SNBA 3AW1A 1P2KA 4X1NU 1A0HB 1C9PA 3TGIE 2W7UA 3RU4E 1MTNC 1GBKA 3T5FH 1A5HA 2GZ9A 3M5MA 4MG3A 1GBBA 1D6WA 3MNSA 1BBRH 1LHDH 1KIGH 5AFZH 4ABHA 2QF0A 1Z8IB 1A5IA 1DLKB 3CS7A 5LGOA 4K8BA 1HBTH 4ISIH 1GL0E 2PSYA 5GCHF 2ESTE 1GL1A 2XBWA 1DWDH 3GY2A 4Y7BA 1SGIB 1P04A 3STIA 3UFAA 3ATKA 2VWOA 1O35A 1AB9C 1GMHF 4UFDH 2ZTYA 3BTQE 5EXNA 2Q1JA 4F4OC 2PW8H 5DP6A 2FXRA 1YPHC 3DHKH 1VZQH 2P59A 1M9UA 5A8YA 2XBVA 1HAOH 1S83A 4BANB 2F3CE 1HV7A 1KLJH 2TGTA 1BTYA 1YP9A 3SU1A 3TH4H 1K28D 2PGBB 1C5XB 2IPHA 1O3JA 2ZFFH 3SJOA 2D26C 1UVUH 1WSSH 1GCTB 4MNWA 1SSXA 2QXIA 1SGYE 3BG4C 1YGCH 4WMDA 3BN9A 2D2DA 1TRYA 1BMMH 1AQ7A 3LONA 1JRTA 2Y7XA 2AFQB 1W2KH 1OSSA 1GJ9B 3ODDA 3SU0A 2CGAA 1DY9A 3A85A 4JYTA 2F9PA 3UWIA 1C5OH 1FY8E 1AN1E 2WYJA 1UVPA 4IN1A 2BY6X 1C5TA 5EW1H 4IN2A 1NFXA 4GLYA 2AERH 3IITA 2CMYA 2BB4A 3D62A 3BTME 4KELA 2G5VA 2ZGBH 1MTNB 1JRSA 2Z7FE 1HCGA 1SR5C 4IBLH 4BAMB 2Q6GA 1GPZA 1SGQE 1XUIA 4BAQB 3P8FA 1LHEH 1FIZA 3TIUA 5JBBS 3U98H 1O3DA 3P8NA 3V13A 2GMTC 3SW2B 5HYOA 1YPMH 3SQEE 1C1RA 5A8ZA 2G5NA 2UUJB 3RXEA 1XUKA 2FOEA 5E2PA 3RC4A 2Y82A 5CMXH 5DO4H 3URCA 4ZKOU 1C2GA 5LPFA 3B9FH 1TGBA 1BBRK 1VGCC 1LVYA 3SU2A 4D9QA 1BIOA 1OX1A 3TJVA 2WPHS 4ABGA 3S0NA 4JYUH 1BQYA 1O3NA 3VXEH 3QK1A 2FOCA 1RD3B 2W5EA 3C27B 2P93A 8GCHG 2I6SA 4X6NA 2BZ6H 1P10A 1OXGA 2RA3A 4TY6A 1KDQA 2Z3DA 1TPAE 2FEQH 4X6OA 1BHXF 1HJ9A 3SGAE 5JBCS 1YKTA 4NCYA 2V3HH 5K0HA 1TA6A 5C2ZA 1S85A 1IHTH 1GI4A 1LPGB 2G4TA 3A82A 3F6UH 1ESAA 1ZHPA 3SUDA 1HXFH 5DP9A 1KXCA 4NGAH 2B7DH 1KXBA 1WOFA 3PMJA 5EXLA 1WAYB 4ZUHA 3RC6A 3TGKE 1UTOA 1ZSKA 2A4QA 1C2LA 3ELAH 2P94A 1QA7A 2J38A 3DFLA 1EP5A 2R0LA 1ZGVA 1GWAA 2OLGA 4DJZB 4WMEA 1PPHE 3SUGA 2ZCKP 2EI8A 4TWYA 1SFQB 3TNTA 4NIXA 1XUFA 3LT3A 4CHAB 3QLPH 3E0NB 1RGQA 4AG1A 3TK6A 3PYHA 4I7YH 1MZAA 1GBDA 3H7TA 4FUBA 1D9IA 2V35A 3D49H 4YZUA 3UR6A 1LVOA 2ZIQH 4GAWA 4X2WA 1GG6C 2WUCA 1ARBA 3P6ZB 2B5TB 1IHSH 5J4QA 1DE7H 5I46H 5GCHG 1ZTJA 1ABJH 1KLTA 1DM4B 2XBYA 1GBIA 4MPWA 4THNH 2EA3A 2Y6TA 1GMHG 4SGAE 3NCLA 7ESTE 2F9NA 1UTJA 4K3JA 1VGCB 2ZDLA 3R0FA 5AF9H 4JZDH 3RXMA 4MDSA 5EGMA 3F68H 2HGTH 1DOJA 1OWDA 3A8AA 1O3FA 2WPJS 1TRNA 1CGIE 1H9LB 1CVWH 3GY5A 4B71A 1LDTT 3KQBA 5B6OA 2BDAA 4E06H 2ZPSA 1T8OA 4ISLA 3FVFB 4LZ1H 1Q2WA 4ZXYH 3O8DA 3LDXH 5FPTA 1QTFA 1FXYA 1W3CA 2BLWA 3B23B 1EJAA 3SZNA 4UEHH 4JZEH 1TNKA 3LGVA 1Y3XA 4AORA 2TGPZ 3SV7A 2TGAA 1W12U 1SB1H 1C5WB 1FPCH 5TCCA 2QGRA 5F8XA 2M5TA 1SOTA 1VCWA 1V2OT 3LPRA 8KME2 2GD4B 1XUJA 3MH5A 3A81A 2BDCA 3A7XA 1J16A 3RMLH 1SI5H 4AZ2B 2VNTA 2OC7A 1BBRE 4WH8A 9ESTA 2BLQA 2GTBA 4MPUA 4OS7A 2ANWA 2ZEBA 3GYMA 1C1PA 1FN6A 3EA7A 1EPTC 1S82A 1NFYA 3RC5A 4AB8A 1TBZH 2XWBI 3MO3A 1TMUH 3A7VA 4X1QU 2D8WA 5JB8S 2QC2A 1IQKA 1XVMA 2GCTC 4NFFA 2PR3A 2SGDE 5A0CA 2GDDA 1GI1A 1RFNA 2BXTH 1C9TA 4K1SA 1O2GH 4YO9A 2NU3E 2BD3A 1FI8A 1TQ0B 3ZZ4A 3VPKA 2OBQA 3MMGA 4JZFH 1NY22 1TALA 2A4GA 1MTWA 3UIRA 3ZVDA 4KTCA 2AEIH 2QA9E 3RXGA 1C4V2 1EQ9A 2UUKB 3N7OA 1ZTKA 2OQUA 2ALPA 1GHXH 3SUFA 1N8OC 4A7IB 1AKSB 4WY3A 4A5TS 2O8TA 7GCHF 7KMEH 1UK2A 4RKJB 1GI2A 2OCVB 1N1LA 1O3EA 2AMDA 2BD7A 4F49A 1ZYOA 1F2SE 1CQQA 2O9QA 1SLXB 3UOPA 1SMFE 1VITG 5C1XA 2BQ7B 3ZVFA 5A0AE 3PWBA 3Q3KA 1LHFH 2ZU5A 2PKSC 3RDZA 3FP7E 1FZZA 4D76A 4YTAA 1WQSA 1Y5UT 1GBMA 1GHAF 1HJAB 1C5QA 3H7OA 4MNYA 2H9HA 2O8LA 1C1UH 4HGCA 3P8OA 2XBXA 1O32A 1MTUA 3VEQB 1TOMH 1BRCE 4UFGH 3E91A 1BJUA 4X8UH 2J95A 1SVPA 3M35A 1PPEE 1C1TA 3PMHB 1EPTB 3OU0A 5ESBA 1OP2A 1BOQA 1ZPCA 5L6NH 1LVMA 2NU0E 2GCTB 4H6TA 4CBNA 1K1LA 2FPZA 3RXQA 2UWLA 4AFZA 2R0KA 3E90B 4ESTE 1RTLA 1TYNA 4E05H 1AD8H 1GHYH 1FAXA 3SN8A 4DW2U 1P11E 1VJ9U 2FWWA 1QNJA 1F5RA 4INLA 2P8OC 1L2EA 1Z7KA 2C8XB 2XC0A 2Z94A 3T27A 1UJ1A 4PROA 1ELBA 1GHZA 2ZP0H 2ZC9H 4JK5A 2WINI 2XCFA 2A5KA 1DANH 2P95A 1W14U 2PTNA 1S6FA 2PUQH 2ZFSA 1W0ZU 5CE1A 2H5DA 1NM6A 1LQDB 3LGUA 1N6XA 3SUEA 5JB9S 1AO5A 1N8OB 3AASA 2FS9A 2GV7A 1MD7A 1YC0A 1P3EA 3UWJH 3UTUH 2OQ5A 3ZYEA 1E34B 1XKBC 2A32A 2CJIA 2Z3CA 3LGIA 4A1TA 3SJ9A 5JBAS 1B0EA 2A7CA 2XC4A 1A2CH 3MU5A 1ELVA 1YYY1 3RUOA 3L6PA 1EATA 4YESB 1TMTH 2BDBA 2VGCB 3CENA 2PKSB 1YPLH 1EJNA 1QRZA 1B5GH 5J4SA 1S6HA 1V2KT 4K2YA 1GJ8B 1S0QA 4Y8XA 2PKAB 4X8TH 1EOJA 1Y3WA 1ZMLA 4O3TA 1SLUB 3KCGH 1SHYA 1W13U 3RM2H 3TLOA 2QN5T 5FBIA 1MU6B 5F8TA 1YPEH 1TBQH 4OS6A 1UVSH 1SGEE 1GBJA 2SGEE 5DGJA 2PLXA 4D9RA 4WXVA 1ZRKA 1O3HA 3ENSB 2RCEA 4TPIZ 3MI4A 3SO3A 2ZDNA 2AGIX 4U2WA 1OP0A 3ZZDA 2HPQH 3AAUA 3GY7A 3LGYA 1C5YB 5GWZA 1LHCH 5FCKA 2ODYB 1ELCA 2AIPA 2QXHA 3A83A 1V2RT 2VJ1A 3RMMH 3SBKA 1CSOE 1C5ZB 1D6RA 2XC5A 5C1YA 4UFFH 2BY9X 4AN7A 1K22H 2VH0A 1OWIA 3GISB 3LJJA 2JH5D 3TGJE 2EEKA 4J1YA 2VWMA 3GY3A 3PMBB 1V2UT 2FODA 1TOCB 2FI5E 1H1BA 2D1JA 1A5GH 2ZGCA 3TK5A 4WF8A 1T8NA 3A7WA 1BRAA 2CF8H 1UHBB 2BDYA 2NU2E 2PV9B 4YT7H 1DFPA 3MU4A 1KXFA 1XM1A 2ZU3A 1C1NA 1GCTC 2AMPA 2WPMS 3HKJB 3BTDE 4DGJA 1ZRBA 3K6ZA 1C5PA 4TPYA 1PFXC 1P0SH 1SL3A 3SHCH 1W10U 2P3TB 2JKHA 3SJ8A 4JMYA 1YPHE 4IC5A 5DG6A 5C3NA 4ZXXH 2WPKS 5JYIA 1IOEA 3W94A 3NPSA 2SGAA 1O5BB 2DUCA 2ZDAH 1NRPH 2RG3A 1AUJA 1F0RA 1CA0C 3P17H 1GHAG 2A2QH 3K2UA 4I31A 1HLTH 1ZSLA 1GI6A 4NWKA 4B76A 1RTKA 1A61H 2F83A 4HFPB 5E0JA 3GY4A 1GJDB 4DT7B 2GKVE 1IQNA 5HM9A 1QA0A 4A1VA 1BTUA 1MTSA 2AIQA 5ABWA 1V2QT 1G30B 3KQCA 4NIWA 2H5CA 4E7RG 1BTZA 2BHGA 3A86A 1J15A 1O3KA 1FV9A 1MCTA 1OWKA 4NSVA 3SI4H 1LPZB 1RIWB 4GCHF 5E2OA 3O8RA 1SLWB 4CRGA 1ELTA 1UTMA 3RXKA 1JMOH 3MWIU 4Z6AH 2P16A 5EU8A 1C2EA 2IOTA 1H9IE 1Y59T 3MU8A 2WV4A 2R2WU 1K1PA 2Z9KA 1ETRH 2FOBA 3M5LA 1ZMJA 1Z6EA 2OD3B 2R9PA 1TB6H 3PV4A 4TYDA 3F9FA 3ATLA 2UWPA 1FONA 1OYQA 2JH0D 1O2KA 1O5CB 1DT2A 3TJNA 1BTHH 3UNRA 1HIAB 2FTMA 3RXLA 1NRSH 2BQWB 3SU3A 3MOCA 1Z8JB 1P12E 1ZZZA 1KTSB 5L2ZH 2OINA 4KTSA 5I25A 2B8OH 5DJ7A 2VIQA 4AFQA 3CS0A 3GDUA 1BA8B 1RRKA 2FM2A 4HTCH 1QCPA 2BX4A 1ANCA 4K1EA 2ZECA 5LPEA 5F6MA 1ZPBA 1SGTA 3TK9A 1BCUH 3MNBA 3A80A 3SOSA 1O38A 3S69A 3ZVEA 1DLEA 3S9AA 5A2MH 1MBQA 2TIOA 1CA0B 4I32A 1O2MA 4MPXA 1F5KU 1EB1H 1YPGH 2SNWA 3KEEA 1KXEA 2RDLA 3BEUA 4BXWA 1QRXA 4CHAC 2OBOA 5EPNA 1GMDF 5FX5A 2ZNKH 3URDA 4LXBH 1O3MA 2Y5HA 1J8AA 1V2TT 2ZDVH 2FDAA 2GZ7A 2QV1A 1H9HE 2A4OA 1LTOA 1C1MA 4E7NA 1QBOA 2Z6BD 1NROH 1O2TA 4XBBA 3PMAB 2QAAA 1XVOA 1QL8A 3T26A 4RSPA 1QR3E 3M3TA 3LGWA 1SG8B 3A88A 1AI8H 1WTGH 1TLDA 1JIRA 4TY7A 1LKBA 2H9EH 4D8NA 4FU9A 1KYNA 1GHBF 4BTUB 1NO9H 2PGQB 2ZKSA 3EA9