2M5ZA

Enterocin 7a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
GAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Enterocin JSA
total genus 7
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m5zA00
2M5ZA 2M60A
chains in the Genus database with same CATH superfamily
2DENA 1TH2A 2BNKA 4RF1A 2XEPA 3T38A 1HNWM 1OKSA 2H5XA 4FWGA 2JA2A 4R3DA 4FD2A 2FNAA 2R4EA 4NXNM 3B74A 2DNAA 2KW0A 3HHXA 2RRUA 3Q8XA 4RNAA 1ZV1A 4WURA 3GPXA 3FRHA 1QDRA 4GIPA 2L2DA 3PNYA 1E94E 3VK7A 1VDLA 1J09A 1XWIA 3J80S 2YFQA 4JYAM 1WIVA 2G3QA 1D0MA 3SHFA 4FCTA 2X49A 4LG2A 1FJGM 2QSFX 3BXWA 1L1ZA 3SAUA 4DBGB 1VEJA 5ITQA 2LXEA 2HCBA 2ZTDA 1UFZA 4KODA 3RFWA 3AFHA 2I7NA 1GL7A 4NOOB 3ZCBB 5EP1A 4MGIE 3GLIA 4NRVA 3GPUA 3FTFA 4IIWA 1GL6A 4BB9A 1CUKA 2F5OA 1N33M 2UXDM 4G4QA 2F5PA 4RKUF 3AOEC 4NC6A 1KFVA 3C3EA 1IXSB 2VF7A 5EP2A 3AV0A 3SMPA 3GPYA 4DR6M 3PXGA 4BLCA 2LVAA 3FUVA 3T15A 2E5LM 3U6CA 4JI7M 1QUSA 1JR3D 1BVSA 1XB2B 4GKJM 3K8ZA 3DA1A 1NV8A 4AQYM 2D7GA 2L7HA 1IY0A 2KRUA 4HEOA 3A46A 4PCZA 2EUCA 1G8PA 3NBIA 4LGYA 1HQCA 1XXHB 2ERCA 2WSFF 3FUTA 3KOWE 4D80A 2F5NA 1OAIA 1IN4A 1NY6A 1VG5A 3RGSA 1IY2A 4R71A 1IXSA 2KNAA 1QZMA 1G59A 3GRVA 4NL4H 3CGWA 4KO8A 1WXQA 3DZDA 3THGA 1HT2E 1XHBA 2HL7A 3GQ5A 4PT5A 1OIZA 4XBOA 3U61A 1T3TA 2Z4SA 4MGKE 2CV2A 1QAOA 3U6EA 3K9OA 3E46A 4JI0M 3SYKA 2R46A 3GLGB 1DGGA 1LV7A 4DR5M 2XF3A 3KOXE 4GRIA 4WP2A 3CF0A 5KO3A 4GHAA 1TTEA 1N32M 4AW4A 3B9PA 4F1IA 4MM3B 3KVWA 4IBKA 3U5ZB 3GP1A 2DAKA 2C5RA 1VDDA 3VKHA 1MJGM 2JNHA 4LZZA 4LFAM 4CJ6A 3KW6A 4X62M 4LF7M 2JUJA 3KDSE 3GQ3A 4G4OA 3GLHA 3U60B 1N75A 5FSWA 3FUWA 1C1KA 2EO2A 5L8RF 2GQFA 2CHGA 3KXEC 4GC9A 2EKFA 3TE6A 4QNMA 4M0DA 5FTMA 3HGIA 5F3WA 4GKKM 2HKJA 3D8BA 1SG9A 1R5LA 2R44A 2DAMA 1JR3E 3W68A 4Z8XA 1C7YA 4IBEA 1T43A 1XNQM 2Y21A 1NHWC 3L27A 3HX3A 1NVMA 2KXEA 2CP8A 3A98B 1WR1B 4LJ8A 4QHSA 5C1BA 2QBYB 1R4GA 2DWNA 4LJ5A 1V34A 2FS1A 1VEGA 2X8AA 3U6OA 4DV3M 1IBMM 4IBIA 2DXIA 4DUYM 2L6OA 2DWZB 2N35A 2Q2EB 5A2QS 2LVPC 3GLGA 2Y20A 4DR4M 1SXJA 2CHQA 3U6QA 4LY6A 4DV6M 4D81A 2O25A 1G41A 2CWBA 3LCVB 1H6UA 2HAKA 3RGPA 2X4AA 1A5TA 2QENA 4Y28F 3FTDA 3U6PA 4AKIA 1L8QA 2FOIC 2XSZD 2MH8A 3IG5A 1Q3CA 3FKEA 1PGYA 2VQFM 3CF6E 3R8FA 2C9CA 3TPZA 1OFIA 3HZJA 1VEKA 3L26A 4MGHA 1OTRA 4LF5M 2Y0TA 3IG8A 2H1RA 3U6DA 1IN7A 4JI5M 2YR0A 3MK6A 5E26A 1QAQA 2R6FA 3W0LB 4REZA 3E9SA 2QZ4A 4I4LA 4IBCA 4KLNA 4I81A 1HT1E 3LVWA 1TR8A 3CF2A 4L16A 1ZMVA 1VQ1A 2KRKA 2ZBKB 4JI2M 1QANA 4L4UA 1NY5A 2JP7A 2OOBA 3GLFA 4FVMA 1JQJC 3OTOM 3KS8A 4M9ZA 5BPVA 3AKZA 1E9SA 3JR5A 2JWSA 1R2ZA 4D82A 4ITQA 1EIJA 4OW0A 2VIIA 4R7GA 4FCVA 2LNHC 4L15A 5JI3E 4LF6M 4M9SA 2JY6B 1HJPA 3U6SA 2Z8YM 4TUWA 3J7BA 3HHZA 2O01F 1WHCA 4XGIA 4OVZB 4FW9A 2Z4RA 3J81S 3VFDA 4K0KM 2L4FA 1IY1A 4LJ7A 2WSEF 2Z3XA 3TWLA 2LBCA 1WGNA 3AJIB 3MHVC 1K3XA 2QPAA 1OJLA 3VDPA 2KZSA 3L29A 5BR8M 4QOSA 3B7ZA 4HLQA 4CIZA 3U60A 3Q8GA 5ITUA 3SARA 4UN2B 2VF8A 4JI8M 3GLHE 2JZ1A 5DFLA 1G3IA 5GKNA 1XMOM 1D0KA 2R4JA 1NJGA 2OOAA 3SATA 2UU9M 4JI1M 4FWDA 5FLXS 2LTUA 2HHHM 2UXCM 1XXHA 3LQRA 4NSOB 2ZTCA 1QVRA 4DR3M 2I7PA 5DYGA 4CGYB 5KQDA 3T1HM 2YNMD 3UZUA 4B3MM 4PDGA 3ILKA 1R6BX 4L8RC 3ZQJA 3B7NA 3M7GA 5KQ8A 2R0IA 3KP1E 2BWBA 2GNOA 1TDZA 4JI3M 2A5YB 1IXRC 2XZFA 3SC3A 3WHKA 2QCUA 4JXJA 1OFHA 1T6OA 4QOZC 1IBLM 2L09A 2VDBB 4CHTB 5FTNA 1JR3A 1Z5CA 2CE7A 3PNVA 4EIWA 4A3VB 3JAMS 1KSFX 1I4WA 2FH0A 3GPPA 2EA0A 4B3TM 1YUBA 3ZC7B 2KDLA 2Y0QA 1J5EM 4DV1M 3HHYA 1IFYA 3GO8A 1DGFA 5EP3A 4DV7M 2MROB 1XXHE 4LRSA 5DNYA 3VDUA 2CEAA 2EJSA 2L4EA 5E6JA 4G6ZA 3GLFB 4G4NA 1L2BA 5H37D 2C98A 2C99A 2XSZA 1AIPC 3HWSA 4JI6M 1G4AE 3C3DA 5EXSA 1NNUC 4W5WA 4DR7M 4LJ4A 4G4RA 3HU3A 4AG6A 1WGLA 2ZM6M 1PRBA 1Q3BA 2CUZA 3RE8A 2LWXA 4OVZA 4M0WA 3SHGB 1F4IA 1GJSA 1PJSA 2M60A 1MN3A 2KNZA 5IT9S 1DGHA 4CISA 1UM8A 2B3TA 1ORYB 1X37A 2XFTA 5EXXA 3K9PA 3GQ4A 5ITRA 2QBYA 1Z5BA 4LF9M 4Q7JA 1SXJC 4OU7A 2XLJA 5EJCA 2EKKA 5KPTA 2K47A 5FTJA 1TGUA 5IWAM 1SXJB 3LMMA 1J7KA 1QDTA 2JY7A 2L7IA 3IHPA 3C9PA 4X64M 4AZFA 3QWLA 4IJFA 1OQYA 3HU2A 2NQ8C 1NNJA 4JV5M 1DGHB 1OAOC 3J27B 1QUTA 3SMSA 2HWJA 2UXBM 2XGNA 4IJEA 3IECA 3GLGE 2FFJA 4AG5A 1V33A 5ITYA 2R45A 1L2DA 3PVSA 2BWEA 3KSJA 3HY5A 3LW5F 2O5RA 1E32A 2OPFA 4DV2M 1NSFA 3SFZA 2RGOA 5KPRA 1IBKM 1IM2A 1EE8A 1GABA 2OO9A 1R7RA 2BJVA 3QYEA 5IZ7D 2UUAM 1KYIA 3GLIE 3NBXX 4LFCM 3TWKA 5ITTA 2CHVA 4IBFA 4NXMM 3U5ZA 2XH9A 5IREB 1Z5AA 2JY8A 2YQZA 1ZMUA 5EXPA 3TL4X 1N77A 4ANRA 1DO0A 1PJQA 1JB0F 4I8OA 1GO5A 3AOGA 3GLHB 2WSCF 2KNVA 1PM5A 1GJTA 4ZPXA 4DUZM 2KA6B 3LCUA 3MJ5A 3U6LA 2P5TA 4JN6A 2LVNC 1GKIA 4IBGA 3E21A 4NSRA 5FTLA 2DZOB 4XK8F 2CFOA 3KOYE 4P17A 1DO2A 2V1UA 3SAWA 4GITA 2DWMA 3K2LA 2DZLA 2LHCA 3SASA 4LF8M 1IN5A 3I4YA 1QQWA 4RF0A 5JI2E 4B3SM 4LFBM 3FYCA 3HJSA 4KT0F 4LCBA 4G3OA 1OIPA 3H4MA 4GMQA 1XNRM 1YSYA 3VK8A 2DHRA 2LHGA 4QNRA 3FE3A 2UUCM 2G5GX 3FYDA 1Q02A 3T1YM 4GEWA 3FUXA 1HNXM 3B7QA 4PD2A 3HHWA 2QNJA 2K9DA 1NHGC 4GC5A 1YE9A 2JXNA 1E9RA 2R65A 3KOZE 1Q39A 1QYRA 2J7OA 3PFIA 4IBBA 2CV0A 3K92A 2G8LA 3HJ8A 1QZEA 2KEBA 3FRIA 1NO1A 4LZJA 1TDHA 4JI4M 1YLAA 2RKOA 4YHHM 3I01M 1G71A 2BJWA 1IN6A 2MJ5B 2V1CA 3LVVA 4KHPM 4II7A 2J5YA 1ZMWA 2F4VM 3J2PB 4DV0M 3HU1A 3A42A 3QAUA 5EQTA 2R62A 1IN8A 3HJQA 3KS4A 5ITXE 2QQ8A 3L2AA 1D2NA 2M5ZA 2W82A 4LGMA 2CV1A 5EP4A 4X66M 1MX0A 5DYIA 3GLIB 3KFUG 3L25A 3QYBA 2C9OA 2D7HA 4LF4M 1ZAEA 2ZAOA 2LVQD 1K82A 1V92A 1IQPA 1N36M 3UMMA 3DFZA 1L2CA 2K0BX 3I4VA 5EXTA 4B3RM 3GRUA 2KZUA 3W0FA 4B7HA 4MGYE 2RGHA 3GRYA 3HKPA 3A45A 3VLFB 1WJ7A 3GLFE 3J7AS 1K3WA 3H4JA 4S12A 4HL4A 1SXJE 2DAIA 2DAEA 4B7GA 3KP0E 4FCWA 3FTCA 7CATA 1HQYE 2R18A 5LMUM 4X65M 1Z6TA 1NJFA 1RU3A 2DHYA 2DKLA 2ZANA 2MR9A 4IBJA 1DGBA 3T6PA 4PDIA 5LMNM 4AI6A 2LVOC 2AHMA 3D8LA 3U6MA 4OX9M 1D0LA 3CTWB 4Z6YA 2VQEM 1R2YA 1TF0B 4F2LA 3V76A 2DVWB 4P16A 4DV5M 4L78A 1I94M 4QHTA 4LJAA 4M9XA 2F5QA 3K1JA 1HNZM 3LQQA 2KHHA 4GHLA 2K6BA 1ZQ9A 2DI0A 4L6V6 4MGZE 4DV4M 1N78A 3BBZA 4FWHA 4YY3M 3FD9A 3MMPA 3ZH9B 1PJJA 1N34M 2WZJA 8CATA 1IXZA 1MU5A 1PJTA 1HR0M 4BBAA 2F5SA 3EIEA 3NWLA 3M0EA 4AKHA 1QAMA 4B08A 3SYLA 1FNNA 3GRRA 4I5SA 3I51A 2UUBM 1NV9A 4MH0E 1P3QQ 2JZ0A 4DR1M 2J7NA 4AKGA 2Z7JA 2APLA 3JR4A 2FE8A 3DOAA 3KSXA 4WW0A 4LJ9A 2DWLA 2CRUA 3FUUA 5C18A 1XMQM 2ZAMA 2DZNB 2LH0A 2QHOB 2MGWA 3E4RA 3WHLA 4MB7A 3B89A 3BOSA 2XZUA 1LTMA 4LJ6A 3SBJA 3L28A 5ITXA 1Z59A 1SXJD 4IBDA 3W67A 3UGJA 2OQ4A 3AL0C 3SAVA 3U61B 1W5SA 2V6ZM 3UJNA 5FTKA 1L1TA 3I04M 1DV0A 3UK6A 1W5TA 3EIHA 1PJIA 1S3SA 2D7EA 5KPZA 4NRWA 1GLNA 3C58A 1XC8A 1TH4A 2C96A 2QP9X 1GVNA 2DAGA 3M6AA 4DR2M 1Y8GA 1EFUB 3VKGA 3R9XB 3FTEA 2XFSA 2JY5A 4GH9A 1TH3A 3TWMA 3AOEA 1AUAA 3TQSA 4LRTA 3F92A 4B7FA
chains in the Genus database with same CATH topology
1TH2A 2BNKA 4RF1A 2XEPA 3T38A 1HNWM 4FWGA 2JA2A 4R3DA 4FD2A 2FNAA 2R4EA 4NXNM 2KW0A 3HHXA 3Q8XA 4WURA 4RNAA 3GPXA 4GIPA 3PNYA 3VK7A 1E94E 1XWIA 1J09A 3J80S 2YFQA 4JYAM 3SHFA 4FCTA 2X49A 4LG2A 1FJGM 1L1ZA 3SAUA 5ITQA 2LXEA 2HCBA 4KODA 3RFWA 3AFHA 2I7NA 1GL7A 4NOOB 3ZCBB 5EP1A 4MGIE 3GLIA 4NRVA 3GPUA 3FTFA 4IIWA 1GL6A 4BB9A 2F5OA 1N33M 2UXDM 4G4QA 2F5PA 3AOEC 1KFVA 1IXSB 5EP2A 3AV0A 3SMPA 3GPYA 4DR6M 3PXGA 4BLCA 3FUVA 3T15A 2E5LM 3U6CA 4JI7M 1JR3D 4GKJM 3K8ZA 3DA1A 4AQYM 2D7GA 2L7HA 1IY0A 2KRUA 3A46A 4PCZA 2EUCA 1G8PA 3NBIA 4LGYA 1HQCA 1XXHB 2ERCA 2F5NA 3FUTA 3KOWE 4D80A 1IN4A 1NY6A 3RGSA 1IY2A 1QZMA 1G59A 3GRVA 4NL4H 4KO8A 1WXQA 3DZDA 3THGA 1HT2E 1XHBA 2HL7A 3GQ5A 4PT5A 4XBOA 3U61A 1T3TA 2Z4SA 4MGKE 2CV2A 1QAOA 3U6EA 4JI0M 3SYKA 2R46A 3GLGB 1DGGA 1LV7A 4DR5M 2XF3A 3KOXE 4GRIA 4GHAA 3CF0A 5KO3A 1N32M 4AW4A 3B9PA 4MM3B 3KVWA 4IBKA 3GP1A 2C5RA 3VKHA 1VDDA 4LZZA 4LFAM 3KW6A 4X62M 4LF7M 3GQ3A 3KDSE 4G4OA 3GLHA 3U60B 1N75A 5FSWA 3FUWA 1C1KA 2EO2A 3KXEC 2CHGA 4GC9A 3TE6A 4QNMA 4M0DA 5FTMA 3HGIA 5F3WA 4GKKM 2HKJA 3D8BA 4Z8XA 4IBEA 1XNQM 2Y21A 1NHWC 3L27A 1NVMA 2KXEA 3A98B 5C1BA 4LJ8A 4QHSA 2QBYB 2DWNA 4LJ5A 2X8AA 3U6OA 4DV3M 1IBMM 4IBIA 2DXIA 4DUYM 2L6OA 2DWZB 2Q2EB 5A2QS 3GLGA 4DR4M 2Y20A 1SXJA 2CHQA 3U6QA 4LY6A 4DV6M 4D81A 1G41A 1H6UA 3RGPA 2X4AA 2QENA 3FTDA 3U6PA 4AKIA 1L8QA 2FOIC 2XSZD 3IG5A 1Q3CA 3FKEA 2VQFM 3CF6E 3R8FA 2C9CA 3TPZA 1OFIA 3L26A 4MGHA 4LF5M 2Y0TA 3IG8A 2H1RA 3U6DA 1IN7A 4JI5M 2YR0A 3MK6A 5E26A 1QAQA 3W0LB 4REZA 3E9SA 2QZ4A 4I4LA 4IBCA 4KLNA 4I81A 1HT1E 3LVWA 3CF2A 4L16A 2KRKA 2ZBKB 4JI2M 1QANA 4L4UA 1NY5A 3GLFA 4FVMA 1JQJC 3OTOM 3KS8A 4M9ZA 5BPVA 3AKZA 1E9SA 3JR5A 1R2ZA 4D82A 4ITQA 4OW0A 2VIIA 4R7GA 4FCVA 2LNHC 4L15A 5JI3E 4LF6M 4M9SA 3U6SA 4TUWA 3J7BA 3HHZA 4XGIA 4OVZB 4FW9A 2Z4RA 3J81S 3VFDA 4K0KM 4LJ7A 1IY1A 2Z3XA 3TWLA 1K3XA 3AJIB 3MHVC 4AKGA 2QPAA 1OJLA 3VDPA 2KZSA 3L29A 5BR8M 4QOSA 3U60A 4HLQA 5ITUA 3SARA 4JI8M 5GKNA 1XMOM 1G3IA 2R4JA 1NJGA 3SATA 2UU9M 4JI1M 4FWDA 5FLXS 2HHHM 2UXCM 1XXHA 3LQRA 4NSOB 1QVRA 4DR3M 2I7PA 5DYGA 4CGYB 5KQDA 3T1HM 2YNMD 3UZUA 4B3MM 4PDGA 3ILKA 1R6BX 4L8RC 3M7GA 5KQ8A 3KP1E 1TDZA 4JI3M 2A5YB 1IXRC 2XZFA 3SC3A 3WHKA 2QCUA 4JXJA 1OFHA 4QOZC 1IBLM 2L09A 4CHTB 5FTNA 1JR3A 1Z5CA 2CE7A 3PNVA 4EIWA 4A3VB 3JAMS 1KSFX 1I4WA 3GPPA 2EA0A 4B3TM 1YUBA 3ZC7B 2Y0QA 1J5EM 4DV1M 3HHYA 3GO8A 1DGFA 5EP3A 4DV7M 4LRSA 5DNYA 3VDUA 2CEAA 5E6JA 4G6ZA 3GLFB 4G4NA 1L2BA 5H37D 2C98A 2C99A 2XSZA 3HWSA 4JI6M 1G4AE 5EXSA 1NNUC 4W5WA 4DR7M 4LJ4A 4G4RA 3HU3A 4AG6A 2ZM6M 1Q3BA 2CUZA 3RE8A 2LWXA 4OVZA 4M0WA 3SHGB 2M60A 5IT9S 1DGHA 4CISA 1UM8A 1ORYB 1X37A 2XFTA 5EXXA 3GQ4A 5ITRA 2QBYA 1Z5BA 4LF9M 1SXJC 4OU7A 2XLJA 5EJCA 5KPTA 2K47A 5FTJA 1TGUA 5IWAM 1SXJB 3LMMA 1J7KA 2L7IA 4X64M 4AZFA 3QWLA 4IJFA 1NNJA 3HU2A 2NQ8C 4JV5M 1DGHB 3J27B 3SMSA 2UXBM 2XGNA 4IJEA 2FFJA 4AG5A 5ITYA 2R45A 1L2DA 3PVSA 3KSJA 2O5RA 1E32A 2OPFA 4DV2M 1NSFA 3SFZA 2RGOA 5KPRA 1IBKM 1IM2A 1EE8A 1R7RA 2BJVA 5IZ7D 2UUAM 1KYIA 4LFCM 3TWKA 5ITTA 2CHVA 4IBFA 4NXMM 3U5ZA 2XH9A 5IREB 1Z5AA 2YQZA 5EXPA 3TL4X 1N77A 1DO0A 4I8OA 3AOGA 3GLHB 1PM5A 4DUZM 4ZPXA 2KA6B 3MJ5A 3U6LA 2P5TA 4JN6A 4IBGA 1GKIA 4NSRA 5FTLA 2DZOB 2CFOA 3KOYE 1DO2A 2V1UA 3SAWA 4GITA 2DWMA 3K2LA 3SASA 4LF8M 1IN5A 3I4YA 1QQWA 4RF0A 5JI2E 4B3SM 4LFBM 3FYCA 3HJSA 4LCBA 1XNRM 3H4MA 4GMQA 1YSYA 3VK8A 2DHRA 4QNRA 2UUCM 2G5GX 3FYDA 3T1YM 3FUXA 1HNXM 4PD2A 3HHWA 1NHGC 4GC5A 1YE9A 1E9RA 2R65A 3KOZE 1Q39A 1QYRA 3PFIA 2J7OA 4IBBA 2CV0A 3K92A 2G8LA 3HJ8A 2KEBA 4LZJA 1TDHA 4JI4M 2RKOA 4YHHM 2BJWA 1IN6A 2V1CA 4KHPM 3LVVA 4II7A 2F4VM 3J2PB 4DV0M 3HU1A 3A42A 3QAUA 5EQTA 2R62A 1IN8A 3HJQA 3KS4A 5ITXE 3L2AA 1D2NA 2M5ZA 2W82A 4LGMA 2CV1A 5EP4A 4X66M 1MX0A 5DYIA 3GLIB 3KFUG 3L25A 2C9OA 2D7HA 4LF4M 1ZAEA 2ZAOA 1K82A 1IQPA 1N36M 3UMMA 3DFZA 1L2CA 3I4VA 5EXTA 4B3RM 3GRUA 2KZUA 3W0FA 4B7HA 4MGYE 2RGHA 3GRYA 3HKPA 3A45A 3VLFB 3J7AS 1K3WA 4S12A 4HL4A 1SXJE 4B7GA 3KP0E 4FCWA 3FTCA 7CATA 1HQYE 2R18A 5LMUM 4X65M 1Z6TA 1NJFA 2ZANA 4IBJA 3U5ZB 5LMNM 4PDIA 4AI6A 1DGBA 2AHMA 3D8LA 3U6MA 4OX9M 3CTWB 4Z6YA 2VQEM 1R2YA 2DVWB 4P16A 4DV5M 4L78A 1I94M 4QHTA 4LJAA 4M9XA 2F5QA 3K1JA 1HNZM 3LQQA 4GHLA 1ZQ9A 4DV4M 1N78A 4MGZE 4FWHA 4YY3M 3FD9A 3ZH9B 1PJJA 1N34M 8CATA 1IXZA 1MU5A 1HR0M 4BBAA 2F5SA 3EIEA 3NWLA 3M0EA 4AKHA 1QAMA 4B08A 3SYLA 1FNNA 3GRRA 4I5SA 3I51A 2UUBM 4MH0E 4DR1M 2J7NA 2Z7JA 3JR4A 2FE8A 3DOAA 3KSXA 4WW0A 4LJ9A 2DWLA 3FUUA 5C18A 1XMQM 2ZAMA 2DZNB 2LH0A 3E4RA 3WHLA 4MB7A 3BOSA 2XZUA 4LJ6A 3SBJA 3L28A 5ITXA 1Z59A 1SXJD 4IBDA 2OQ4A 3UGJA 3AL0C 3SAVA 3U61B 1W5SA 2V6ZM 3UJNA 5FTKA 1L1TA 3UK6A 1W5TA 3EIHA 1PJIA 1S3SA 2D7EA 5KPZA 4NRWA 1GLNA 3C58A 1XC8A 1TH4A 2C96A 2QP9X 1GVNA 3M6AA 4DR2M 3VKGA 3R9XB 3FTEA 2XFSA 4GH9A 1TH3A 3TWMA 3AOEA 3TQSA 4LRTA 4B7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5Z A;  2M60 A; 
#chains in the Genus database with same CATH topology
 2DEN A;  1TH2 A;  2BNK A;  4RF1 A;  2XEP A;  3T38 A;  1HNW M;  1OKS A;  2H5X A;  4FWG A;  2JA2 A;  4R3D A;  4FD2 A;  2FNA A;  2R4E A;  4NXN M;  3B74 A;  2DNA A;  2KW0 A;  3HHX A;  2RRU A;  3Q8X A;  4RNA A;  1ZV1 A;  4WUR A;  3GPX A;  3FRH A;  1QDR A;  4GIP A;  2L2D A;  3PNY A;  1E94 E;  3VK7 A;  1VDL A;  1J09 A;  1XWI A;  3J80 S;  2YFQ A;  4JYA M;  1WIV A;  2G3Q A;  1D0M A;  3SHF A;  4FCT A;  2X49 A;  4LG2 A;  1FJG M;  2QSF X;  3BXW A;  1L1Z A;  3SAU A;  4DBG B;  1VEJ A;  5ITQ A;  2LXE A;  2HCB A;  2ZTD A;  1UFZ A;  4KOD A;  3RFW A;  3AFH A;  2I7N A;  1GL7 A;  4NOO B;  3ZCB B;  5EP1 A;  4MGI E;  3GLI A;  4NRV A;  3GPU A;  3FTF A;  4IIW A;  1GL6 A;  4BB9 A;  1CUK A;  2F5O A;  1N33 M;  2UXD M;  4G4Q A;  2F5P A;  4RKU F;  3AOE C;  4NC6 A;  1KFV A;  3C3E A;  1IXS B;  2VF7 A;  5EP2 A;  3AV0 A;  3SMP A;  3GPY A;  4DR6 M;  3PXG A;  4BLC A;  2LVA A;  3FUV A;  3T15 A;  2E5L M;  3U6C A;  4JI7 M;  1QUS A;  1JR3 D;  1BVS A;  1XB2 B;  4GKJ M;  3K8Z A;  3DA1 A;  1NV8 A;  4AQY M;  2D7G A;  2L7H A;  1IY0 A;  2KRU A;  4HEO A;  3A46 A;  4PCZ A;  2EUC A;  1G8P A;  3NBI A;  4LGY A;  1HQC A;  1XXH B;  2ERC A;  2WSF F;  3FUT A;  3KOW E;  4D80 A;  2F5N A;  1OAI A;  1IN4 A;  1NY6 A;  1VG5 A;  3RGS A;  1IY2 A;  4R71 A;  1IXS A;  2KNA A;  1QZM A;  1G59 A;  3GRV A;  4NL4 H;  3CGW A;  4KO8 A;  1WXQ A;  3DZD A;  3THG A;  1HT2 E;  1XHB A;  2HL7 A;  3GQ5 A;  4PT5 A;  1OIZ A;  4XBO A;  3U61 A;  1T3T A;  2Z4S A;  4MGK E;  2CV2 A;  1QAO A;  3U6E A;  3K9O A;  3E46 A;  4JI0 M;  3SYK A;  2R46 A;  3GLG B;  1DGG A;  1LV7 A;  4DR5 M;  2XF3 A;  3KOX E;  4GRI A;  4WP2 A;  3CF0 A;  5KO3 A;  4GHA A;  1TTE A;  1N32 M;  4AW4 A;  3B9P A;  4F1I A;  4MM3 B;  3KVW A;  4IBK A;  3U5Z B;  3GP1 A;  2DAK A;  2C5R A;  1VDD A;  3VKH A;  1MJG M;  2JNH A;  4LZZ A;  4LFA M;  4CJ6 A;  3KW6 A;  4X62 M;  4LF7 M;  2JUJ A;  3KDS E;  3GQ3 A;  4G4O A;  3GLH A;  3U60 B;  1N75 A;  5FSW A;  3FUW A;  1C1K A;  2EO2 A;  5L8R F;  2GQF A;  2CHG A;  3KXE C;  4GC9 A;  2EKF A;  3TE6 A;  4QNM A;  4M0D A;  5FTM A;  3HGI A;  5F3W A;  4GKK M;  2HKJ A;  3D8B A;  1SG9 A;  1R5L A;  2R44 A;  2DAM A;  1JR3 E;  3W68 A;  4Z8X A;  1C7Y A;  4IBE A;  1T43 A;  1XNQ M;  2Y21 A;  1NHW C;  3L27 A;  3HX3 A;  1NVM A;  2KXE A;  2CP8 A;  3A98 B;  1WR1 B;  4LJ8 A;  4QHS A;  5C1B A;  2QBY B;  1R4G A;  2DWN A;  4LJ5 A;  1V34 A;  2FS1 A;  1VEG A;  2X8A A;  3U6O A;  4DV3 M;  1IBM M;  4IBI A;  2DXI A;  4DUY M;  2L6O A;  2DWZ B;  2N35 A;  2Q2E B;  5A2Q S;  2LVP C;  3GLG A;  2Y20 A;  4DR4 M;  1SXJ A;  2CHQ A;  3U6Q A;  4LY6 A;  4DV6 M;  4D81 A;  2O25 A;  1G41 A;  2CWB A;  3LCV B;  1H6U A;  2HAK A;  3RGP A;  2X4A A;  1A5T A;  2QEN A;  4Y28 F;  3FTD A;  3U6P A;  4AKI A;  1L8Q A;  2FOI C;  2XSZ D;  2MH8 A;  3IG5 A;  1Q3C A;  3FKE A;  1PGY A;  2VQF M;  3CF6 E;  3R8F A;  2C9C A;  3TPZ A;  1OFI A;  3HZJ A;  1VEK A;  3L26 A;  4MGH A;  1OTR A;  4LF5 M;  2Y0T A;  3IG8 A;  2H1R A;  3U6D A;  1IN7 A;  4JI5 M;  2YR0 A;  3MK6 A;  5E26 A;  1QAQ A;  2R6F A;  3W0L B;  4REZ A;  3E9S A;  2QZ4 A;  4I4L A;  4IBC A;  4KLN A;  4I81 A;  1HT1 E;  3LVW A;  1TR8 A;  3CF2 A;  4L16 A;  1ZMV A;  1VQ1 A;  2KRK A;  2ZBK B;  4JI2 M;  1QAN A;  4L4U A;  1NY5 A;  2JP7 A;  2OOB A;  3GLF A;  4FVM A;  1JQJ C;  3OTO M;  3KS8 A;  4M9Z A;  5BPV A;  3AKZ A;  1E9S A;  3JR5 A;  2JWS A;  1R2Z A;  4D82 A;  4ITQ A;  1EIJ A;  4OW0 A;  2VII A;  4R7G A;  4FCV A;  2LNH C;  4L15 A;  5JI3 E;  4LF6 M;  4M9S A;  2JY6 B;  1HJP A;  3U6S A;  2Z8Y M;  4TUW A;  3J7B A;  3HHZ A;  2O01 F;  1WHC A;  4XGI A;  4OVZ B;  4FW9 A;  2Z4R A;  3J81 S;  3VFD A;  4K0K M;  2L4F A;  1IY1 A;  4LJ7 A;  2WSE F;  2Z3X A;  3TWL A;  2LBC A;  1WGN A;  3AJI B;  3MHV C;  1K3X A;  2QPA A;  1OJL A;  3VDP A;  2KZS A;  3L29 A;  5BR8 M;  4QOS A;  3B7Z A;  4HLQ A;  4CIZ A;  3U60 A;  3Q8G A;  5ITU A;  3SAR A;  4UN2 B;  2VF8 A;  4JI8 M;  3GLH E;  2JZ1 A;  5DFL A;  1G3I A;  5GKN A;  1XMO M;  1D0K A;  2R4J A;  1NJG A;  2OOA A;  3SAT A;  2UU9 M;  4JI1 M;  4FWD A;  5FLX S;  2LTU A;  2HHH M;  2UXC M;  1XXH A;  3LQR A;  4NSO B;  2ZTC A;  1QVR A;  4DR3 M;  2I7P A;  5DYG A;  4CGY B;  5KQD A;  3T1H M;  2YNM D;  3UZU A;  4B3M M;  4PDG A;  3ILK A;  1R6B X;  4L8R C;  3ZQJ A;  3B7N A;  3M7G A;  5KQ8 A;  2R0I A;  3KP1 E;  2BWB A;  2GNO A;  1TDZ A;  4JI3 M;  2A5Y B;  1IXR C;  2XZF A;  3SC3 A;  3WHK A;  2QCU A;  4JXJ A;  1OFH A;  1T6O A;  4QOZ C;  1IBL M;  2L09 A;  2VDB B;  4CHT B;  5FTN A;  1JR3 A;  1Z5C A;  2CE7 A;  3PNV A;  4EIW A;  4A3V B;  3JAM S;  1KSF X;  1I4W A;  2FH0 A;  3GPP A;  2EA0 A;  4B3T M;  1YUB A;  3ZC7 B;  2KDL A;  2Y0Q A;  1J5E M;  4DV1 M;  3HHY A;  1IFY A;  3GO8 A;  1DGF A;  5EP3 A;  4DV7 M;  2MRO B;  1XXH E;  4LRS A;  5DNY A;  3VDU A;  2CEA A;  2EJS A;  2L4E A;  5E6J A;  4G6Z A;  3GLF B;  4G4N A;  1L2B A;  5H37 D;  2C98 A;  2C99 A;  2XSZ A;  1AIP C;  3HWS A;  4JI6 M;  1G4A E;  3C3D A;  5EXS A;  1NNU C;  4W5W A;  4DR7 M;  4LJ4 A;  4G4R A;  3HU3 A;  4AG6 A;  1WGL A;  2ZM6 M;  1PRB A;  1Q3B A;  2CUZ A;  3RE8 A;  2LWX A;  4OVZ A;  4M0W A;  3SHG B;  1F4I A;  1GJS A;  1PJS A;  2M60 A;  1MN3 A;  2KNZ A;  5IT9 S;  1DGH A;  4CIS A;  1UM8 A;  2B3T A;  1ORY B;  1X37 A;  2XFT A;  5EXX A;  3K9P A;  3GQ4 A;  5ITR A;  2QBY A;  1Z5B A;  4LF9 M;  4Q7J A;  1SXJ C;  4OU7 A;  2XLJ A;  5EJC A;  2EKK A;  5KPT A;  2K47 A;  5FTJ A;  1TGU A;  5IWA M;  1SXJ B;  3LMM A;  1J7K A;  1QDT A;  2JY7 A;  2L7I A;  3IHP A;  3C9P A;  4X64 M;  4AZF A;  3QWL A;  4IJF A;  1OQY A;  3HU2 A;  2NQ8 C;  1NNJ A;  4JV5 M;  1DGH B;  1OAO C;  3J27 B;  1QUT A;  3SMS A;  2HWJ A;  2UXB M;  2XGN A;  4IJE A;  3IEC A;  3GLG E;  2FFJ A;  4AG5 A;  1V33 A;  5ITY A;  2R45 A;  1L2D A;  3PVS A;  2BWE A;  3KSJ A;  3HY5 A;  3LW5 F;  2O5R A;  1E32 A;  2OPF A;  4DV2 M;  1NSF A;  3SFZ A;  2RGO A;  5KPR A;  1IBK M;  1IM2 A;  1EE8 A;  1GAB A;  2OO9 A;  1R7R A;  2BJV A;  3QYE A;  5IZ7 D;  2UUA M;  1KYI A;  3GLI E;  3NBX X;  4LFC M;  3TWK A;  5ITT A;  2CHV A;  4IBF A;  4NXM M;  3U5Z A;  2XH9 A;  5IRE B;  1Z5A A;  2JY8 A;  2YQZ A;  1ZMU A;  5EXP A;  3TL4 X;  1N77 A;  4ANR A;  1DO0 A;  1PJQ A;  1JB0 F;  4I8O A;  1GO5 A;  3AOG A;  3GLH B;  2WSC F;  2KNV A;  1PM5 A;  1GJT A;  4ZPX A;  4DUZ M;  2KA6 B;  3LCU A;  3MJ5 A;  3U6L A;  2P5T A;  4JN6 A;  2LVN C;  1GKI A;  4IBG A;  3E21 A;  4NSR A;  5FTL A;  2DZO B;  4XK8 F;  2CFO A;  3KOY E;  4P17 A;  1DO2 A;  2V1U A;  3SAW A;  4GIT A;  2DWM A;  3K2L A;  2DZL A;  2LHC A;  3SAS A;  4LF8 M;  1IN5 A;  3I4Y A;  1QQW A;  4RF0 A;  5JI2 E;  4B3S M;  4LFB M;  3FYC A;  3HJS A;  4KT0 F;  4LCB A;  4G3O A;  1OIP A;  3H4M A;  4GMQ A;  1XNR M;  1YSY A;  3VK8 A;  2DHR A;  2LHG A;  4QNR A;  3FE3 A;  2UUC M;  2G5G X;  3FYD A;  1Q02 A;  3T1Y M;  4GEW A;  3FUX A;  1HNX M;  3B7Q A;  4PD2 A;  3HHW A;  2QNJ A;  2K9D A;  1NHG C;  4GC5 A;  1YE9 A;  2JXN A;  1E9R A;  2R65 A;  3KOZ E;  1Q39 A;  1QYR A;  2J7O A;  3PFI A;  4IBB A;  2CV0 A;  3K92 A;  2G8L A;  3HJ8 A;  1QZE A;  2KEB A;  3FRI A;  1NO1 A;  4LZJ A;  1TDH A;  4JI4 M;  1YLA A;  2RKO A;  4YHH M;  3I01 M;  1G71 A;  2BJW A;  1IN6 A;  2MJ5 B;  2V1C A;  3LVV A;  4KHP M;  4II7 A;  2J5Y A;  1ZMW A;  2F4V M;  3J2P B;  4DV0 M;  3HU1 A;  3A42 A;  3QAU A;  5EQT A;  2R62 A;  1IN8 A;  3HJQ A;  3KS4 A;  5ITX E;  2QQ8 A;  3L2A A;  1D2N A;  2M5Z A;  2W82 A;  4LGM A;  2CV1 A;  5EP4 A;  4X66 M;  1MX0 A;  5DYI A;  3GLI B;  3KFU G;  3L25 A;  3QYB A;  2C9O A;  2D7H A;  4LF4 M;  1ZAE A;  2ZAO A;  2LVQ D;  1K82 A;  1V92 A;  1IQP A;  1N36 M;  3UMM A;  3DFZ A;  1L2C A;  2K0B X;  3I4V A;  5EXT A;  4B3R M;  3GRU A;  2KZU A;  3W0F A;  4B7H A;  4MGY E;  2RGH A;  3GRY A;  3HKP A;  3A45 A;  3VLF B;  1WJ7 A;  3GLF E;  3J7A S;  1K3W A;  3H4J A;  4S12 A;  4HL4 A;  1SXJ E;  2DAI A;  2DAE A;  4B7G A;  3KP0 E;  4FCW A;  3FTC A;  7CAT A;  1HQY E;  2R18 A;  5LMU M;  4X65 M;  1Z6T A;  1NJF A;  1RU3 A;  2DHY A;  2DKL A;  2ZAN A;  2MR9 A;  4IBJ A;  1DGB A;  3T6P A;  4PDI A;  5LMN M;  4AI6 A;  2LVO C;  2AHM A;  3D8L A;  3U6M A;  4OX9 M;  1D0L A;  3CTW B;  4Z6Y A;  2VQE M;  1R2Y A;  1TF0 B;  4F2L A;  3V76 A;  2DVW B;  4P16 A;  4DV5 M;  4L78 A;  1I94 M;  4QHT A;  4LJA A;  4M9X A;  2F5Q A;  3K1J A;  1HNZ M;  3LQQ A;  2KHH A;  4GHL A;  2K6B A;  1ZQ9 A;  2DI0 A;  4L6V 6;  4MGZ E;  4DV4 M;  1N78 A;  3BBZ A;  4FWH A;  4YY3 M;  3FD9 A;  3MMP A;  3ZH9 B;  1PJJ A;  1N34 M;  2WZJ A;  8CAT A;  1IXZ A;  1MU5 A;  1PJT A;  1HR0 M;  4BBA A;  2F5S A;  3EIE A;  3NWL A;  3M0E A;  4AKH A;  1QAM A;  4B08 A;  3SYL A;  1FNN A;  3GRR A;  4I5S A;  3I51 A;  2UUB M;  1NV9 A;  4MH0 E;  1P3Q Q;  2JZ0 A;  4DR1 M;  2J7N A;  4AKG A;  2Z7J A;  2APL A;  3JR4 A;  2FE8 A;  3DOA A;  3KSX A;  4WW0 A;  4LJ9 A;  2DWL A;  2CRU A;  3FUU A;  5C18 A;  1XMQ M;  2ZAM A;  2DZN B;  2LH0 A;  2QHO B;  2MGW A;  3E4R A;  3WHL A;  4MB7 A;  3B89 A;  3BOS A;  2XZU A;  1LTM A;  4LJ6 A;  3SBJ A;  3L28 A;  5ITX A;  1Z59 A;  1SXJ D;  4IBD A;  3W67 A;  3UGJ A;  2OQ4 A;  3AL0 C;  3SAV A;  3U61 B;  1W5S A;  2V6Z M;  3UJN A;  5FTK A;  1L1T A;  3I04 M;  1DV0 A;  3UK6 A;  1W5T A;  3EIH A;  1PJI A;  1S3S A;  2D7E A;  5KPZ A;  4NRW A;  1GLN A;  3C58 A;  1XC8 A;  1TH4 A;  2C96 A;  2QP9 X;  1GVN A;  2DAG A;  3M6A A;  4DR2 M;  1Y8G A;  1EFU B;  3VKG A;  3R9X B;  3FTE A;  2XFS A;  2JY5 A;  4GH9 A;  1TH3 A;  3TWM A;  3AOE A;  1AUA A;  3TQS A;  4LRT A;  3F92 A;  4B7F A; 
#chains in the Genus database with same CATH homology
 1TH2 A;  2BNK A;  4RF1 A;  2XEP A;  3T38 A;  1HNW M;  4FWG A;  2JA2 A;  4R3D A;  4FD2 A;  2FNA A;  2R4E A;  4NXN M;  2KW0 A;  3HHX A;  3Q8X A;  4WUR A;  4RNA A;  3GPX A;  4GIP A;  3PNY A;  3VK7 A;  1E94 E;  1XWI A;  1J09 A;  3J80 S;  2YFQ A;  4JYA M;  3SHF A;  4FCT A;  2X49 A;  4LG2 A;  1FJG M;  1L1Z A;  3SAU A;  5ITQ A;  2LXE A;  2HCB A;  4KOD A;  3RFW A;  3AFH A;  2I7N A;  1GL7 A;  4NOO B;  3ZCB B;  5EP1 A;  4MGI E;  3GLI A;  4NRV A;  3GPU A;  3FTF A;  4IIW A;  1GL6 A;  4BB9 A;  2F5O A;  1N33 M;  2UXD M;  4G4Q A;  2F5P A;  3AOE C;  1KFV A;  1IXS B;  5EP2 A;  3AV0 A;  3SMP A;  3GPY A;  4DR6 M;  3PXG A;  4BLC A;  3FUV A;  3T15 A;  2E5L M;  3U6C A;  4JI7 M;  1JR3 D;  4GKJ M;  3K8Z A;  3DA1 A;  4AQY M;  2D7G A;  2L7H A;  1IY0 A;  2KRU A;  3A46 A;  4PCZ A;  2EUC A;  1G8P A;  3NBI A;  4LGY A;  1HQC A;  1XXH B;  2ERC A;  2F5N A;  3FUT A;  3KOW E;  4D80 A;  1IN4 A;  1NY6 A;  3RGS A;  1IY2 A;  1QZM A;  1G59 A;  3GRV A;  4NL4 H;  4KO8 A;  1WXQ A;  3DZD A;  3THG A;  1HT2 E;  1XHB A;  2HL7 A;  3GQ5 A;  4PT5 A;  4XBO A;  3U61 A;  1T3T A;  2Z4S A;  4MGK E;  2CV2 A;  1QAO A;  3U6E A;  4JI0 M;  3SYK A;  2R46 A;  3GLG B;  1DGG A;  1LV7 A;  4DR5 M;  2XF3 A;  3KOX E;  4GRI A;  4GHA A;  3CF0 A;  5KO3 A;  1N32 M;  4AW4 A;  3B9P A;  4MM3 B;  3KVW A;  4IBK A;  3GP1 A;  2C5R A;  3VKH A;  1VDD A;  4LZZ A;  4LFA M;  3KW6 A;  4X62 M;  4LF7 M;  3GQ3 A;  3KDS E;  4G4O A;  3GLH A;  3U60 B;  1N75 A;  5FSW A;  3FUW A;  1C1K A;  2EO2 A;  3KXE C;  2CHG A;  4GC9 A;  3TE6 A;  4QNM A;  4M0D A;  5FTM A;  3HGI A;  5F3W A;  4GKK M;  2HKJ A;  3D8B A;  4Z8X A;  4IBE A;  1XNQ M;  2Y21 A;  1NHW C;  3L27 A;  1NVM A;  2KXE A;  3A98 B;  5C1B A;  4LJ8 A;  4QHS A;  2QBY B;  2DWN A;  4LJ5 A;  2X8A A;  3U6O A;  4DV3 M;  1IBM M;  4IBI A;  2DXI A;  4DUY M;  2L6O A;  2DWZ B;  2Q2E B;  5A2Q S;  3GLG A;  4DR4 M;  2Y20 A;  1SXJ A;  2CHQ A;  3U6Q A;  4LY6 A;  4DV6 M;  4D81 A;  1G41 A;  1H6U A;  3RGP A;  2X4A A;  2QEN A;  3FTD A;  3U6P A;  4AKI A;  1L8Q A;  2FOI C;  2XSZ D;  3IG5 A;  1Q3C A;  3FKE A;  2VQF M;  3CF6 E;  3R8F A;  2C9C A;  3TPZ A;  1OFI A;  3L26 A;  4MGH A;  4LF5 M;  2Y0T A;  3IG8 A;  2H1R A;  3U6D A;  1IN7 A;  4JI5 M;  2YR0 A;  3MK6 A;  5E26 A;  1QAQ A;  3W0L B;  4REZ A;  3E9S A;  2QZ4 A;  4I4L A;  4IBC A;  4KLN A;  4I81 A;  1HT1 E;  3LVW A;  3CF2 A;  4L16 A;  2KRK A;  2ZBK B;  4JI2 M;  1QAN A;  4L4U A;  1NY5 A;  3GLF A;  4FVM A;  1JQJ C;  3OTO M;  3KS8 A;  4M9Z A;  5BPV A;  3AKZ A;  1E9S A;  3JR5 A;  1R2Z A;  4D82 A;  4ITQ A;  4OW0 A;  2VII A;  4R7G A;  4FCV A;  2LNH C;  4L15 A;  5JI3 E;  4LF6 M;  4M9S A;  3U6S A;  4TUW A;  3J7B A;  3HHZ A;  4XGI A;  4OVZ B;  4FW9 A;  2Z4R A;  3J81 S;  3VFD A;  4K0K M;  4LJ7 A;  1IY1 A;  2Z3X A;  3TWL A;  1K3X A;  3AJI B;  3MHV C;  4AKG A;  2QPA A;  1OJL A;  3VDP A;  2KZS A;  3L29 A;  5BR8 M;  4QOS A;  3U60 A;  4HLQ A;  5ITU A;  3SAR A;  4JI8 M;  5GKN A;  1XMO M;  1G3I A;  2R4J A;  1NJG A;  3SAT A;  2UU9 M;  4JI1 M;  4FWD A;  5FLX S;  2HHH M;  2UXC M;  1XXH A;  3LQR A;  4NSO B;  1QVR A;  4DR3 M;  2I7P A;  5DYG A;  4CGY B;  5KQD A;  3T1H M;  2YNM D;  3UZU A;  4B3M M;  4PDG A;  3ILK A;  1R6B X;  4L8R C;  3M7G A;  5KQ8 A;  3KP1 E;  1TDZ A;  4JI3 M;  2A5Y B;  1IXR C;  2XZF A;  3SC3 A;  3WHK A;  2QCU A;  4JXJ A;  1OFH A;  4QOZ C;  1IBL M;  2L09 A;  4CHT B;  5FTN A;  1JR3 A;  1Z5C A;  2CE7 A;  3PNV A;  4EIW A;  4A3V B;  3JAM S;  1KSF X;  1I4W A;  3GPP A;  2EA0 A;  4B3T M;  1YUB A;  3ZC7 B;  2Y0Q A;  1J5E M;  4DV1 M;  3HHY A;  3GO8 A;  1DGF A;  5EP3 A;  4DV7 M;  4LRS A;  5DNY A;  3VDU A;  2CEA A;  5E6J A;  4G6Z A;  3GLF B;  4G4N A;  1L2B A;  5H37 D;  2C98 A;  2C99 A;  2XSZ A;  3HWS A;  4JI6 M;  1G4A E;  5EXS A;  1NNU C;  4W5W A;  4DR7 M;  4LJ4 A;  4G4R A;  3HU3 A;  4AG6 A;  2ZM6 M;  1Q3B A;  2CUZ A;  3RE8 A;  2LWX A;  4OVZ A;  4M0W A;  3SHG B;  2M60 A;  5IT9 S;  1DGH A;  4CIS A;  1UM8 A;  1ORY B;  1X37 A;  2XFT A;  5EXX A;  3GQ4 A;  5ITR A;  2QBY A;  1Z5B A;  4LF9 M;  1SXJ C;  4OU7 A;  2XLJ A;  5EJC A;  5KPT A;  2K47 A;  5FTJ A;  1TGU A;  5IWA M;  1SXJ B;  3LMM A;  1J7K A;  2L7I A;  4X64 M;  4AZF A;  3QWL A;  4IJF A;  1NNJ A;  3HU2 A;  2NQ8 C;  4JV5 M;  1DGH B;  3J27 B;  3SMS A;  2UXB M;  2XGN A;  4IJE A;  2FFJ A;  4AG5 A;  5ITY A;  2R45 A;  1L2D A;  3PVS A;  3KSJ A;  2O5R A;  1E32 A;  2OPF A;  4DV2 M;  1NSF A;  3SFZ A;  2RGO A;  5KPR A;  1IBK M;  1IM2 A;  1EE8 A;  1R7R A;  2BJV A;  5IZ7 D;  2UUA M;  1KYI A;  4LFC M;  3TWK A;  5ITT A;  2CHV A;  4IBF A;  4NXM M;  3U5Z A;  2XH9 A;  5IRE B;  1Z5A A;  2YQZ A;  5EXP A;  3TL4 X;  1N77 A;  1DO0 A;  4I8O A;  3AOG A;  3GLH B;  1PM5 A;  4DUZ M;  4ZPX A;  2KA6 B;  3MJ5 A;  3U6L A;  2P5T A;  4JN6 A;  4IBG A;  1GKI A;  4NSR A;  5FTL A;  2DZO B;  2CFO A;  3KOY E;  1DO2 A;  2V1U A;  3SAW A;  4GIT A;  2DWM A;  3K2L A;  3SAS A;  4LF8 M;  1IN5 A;  3I4Y A;  1QQW A;  4RF0 A;  5JI2 E;  4B3S M;  4LFB M;  3FYC A;  3HJS A;  4LCB A;  1XNR M;  3H4M A;  4GMQ A;  1YSY A;  3VK8 A;  2DHR A;  4QNR A;  2UUC M;  2G5G X;  3FYD A;  3T1Y M;  3FUX A;  1HNX M;  4PD2 A;  3HHW A;  1NHG C;  4GC5 A;  1YE9 A;  1E9R A;  2R65 A;  3KOZ E;  1Q39 A;  1QYR A;  3PFI A;  2J7O A;  4IBB A;  2CV0 A;  3K92 A;  2G8L A;  3HJ8 A;  2KEB A;  4LZJ A;  1TDH A;  4JI4 M;  2RKO A;  4YHH M;  2BJW A;  1IN6 A;  2V1C A;  4KHP M;  3LVV A;  4II7 A;  2F4V M;  3J2P B;  4DV0 M;  3HU1 A;  3A42 A;  3QAU A;  5EQT A;  2R62 A;  1IN8 A;  3HJQ A;  3KS4 A;  5ITX E;  3L2A A;  1D2N A;  2M5Z A;  2W82 A;  4LGM A;  2CV1 A;  5EP4 A;  4X66 M;  1MX0 A;  5DYI A;  3GLI B;  3KFU G;  3L25 A;  2C9O A;  2D7H A;  4LF4 M;  1ZAE A;  2ZAO A;  1K82 A;  1IQP A;  1N36 M;  3UMM A;  3DFZ A;  1L2C A;  3I4V A;  5EXT A;  4B3R M;  3GRU A;  2KZU A;  3W0F A;  4B7H A;  4MGY E;  2RGH A;  3GRY A;  3HKP A;  3A45 A;  3VLF B;  3J7A S;  1K3W A;  4S12 A;  4HL4 A;  1SXJ E;  4B7G A;  3KP0 E;  4FCW A;  3FTC A;  7CAT A;  1HQY E;  2R18 A;  5LMU M;  4X65 M;  1Z6T A;  1NJF A;  2ZAN A;  4IBJ A;  3U5Z B;  5LMN M;  4PDI A;  4AI6 A;  1DGB A;  2AHM A;  3D8L A;  3U6M A;  4OX9 M;  3CTW B;  4Z6Y A;  2VQE M;  1R2Y A;  2DVW B;  4P16 A;  4DV5 M;  4L78 A;  1I94 M;  4QHT A;  4LJA A;  4M9X A;  2F5Q A;  3K1J A;  1HNZ M;  3LQQ A;  4GHL A;  1ZQ9 A;  4DV4 M;  1N78 A;  4MGZ E;  4FWH A;  4YY3 M;  3FD9 A;  3ZH9 B;  1PJJ A;  1N34 M;  8CAT A;  1IXZ A;  1MU5 A;  1HR0 M;  4BBA A;  2F5S A;  3EIE A;  3NWL A;  3M0E A;  4AKH A;  1QAM A;  4B08 A;  3SYL A;  1FNN A;  3GRR A;  4I5S A;  3I51 A;  2UUB M;  4MH0 E;  4DR1 M;  2J7N A;  2Z7J A;  3JR4 A;  2FE8 A;  3DOA A;  3KSX A;  4WW0 A;  4LJ9 A;  2DWL A;  3FUU A;  5C18 A;  1XMQ M;  2ZAM A;  2DZN B;  2LH0 A;  3E4R A;  3WHL A;  4MB7 A;  3BOS A;  2XZU A;  4LJ6 A;  3SBJ A;  3L28 A;  5ITX A;  1Z59 A;  1SXJ D;  4IBD A;  2OQ4 A;  3UGJ A;  3AL0 C;  3SAV A;  3U61 B;  1W5S A;  2V6Z M;  3UJN A;  5FTK A;  1L1T A;  3UK6 A;  1W5T A;  3EIH A;  1PJI A;  1S3S A;  2D7E A;  5KPZ A;  4NRW A;  1GLN A;  3C58 A;  1XC8 A;  1TH4 A;  2C96 A;  2QP9 X;  1GVN A;  3M6A A;  4DR2 M;  3VKG A;  3R9X B;  3FTE A;  2XFS A;  4GH9 A;  1TH3 A;  3TWM A;  3AOE A;  3TQS A;  4LRT A;  4B7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...