2M5ZA

Enterocin 7a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
GAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Enterocin JSA
total genus 7
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m5zA00
2M5ZA 2M60A
chains in the Genus database with same CATH superfamily
3KFUG 3LVWA 2KRUA 2DI0A 2M5ZA 2DAEA 1P3QQ 3FYCA 2QPAA 4LG2A 4I8OA 2LVOC 2JY5A 3U61B 4HL4A 5EP2A 4MB7A 2JY6B 2KRKA 3L26A 5ITRA 3J27B 2CP8A 3KP0E 1K82A 3HY5A 5ITYA 4CGYB 2C99A 4GHAA 3GRYA 3SYLA 5BR8M 2ZM6M 3W0FA 4OW0A 3BBZA 1LTMA 1JQJC 3T38A 5KPZA 2KNVA 1ORYB 1NY6A 2DHRA 3GPYA 2HL7A 4IJEA 1L2CA 2G8LA 5FSWA 2MGWA 4R3DA 1GLNA 2QQ8A 1Y8GA 2R6FA 1K3WA 1NJGA 2K9DA 2J7NA 3RE8A 3FUUA 3TWKA 3J81S 3CGWA 3GLIE 2UXBM 3EIEA 3U6OA 3U5ZA 3SAUA 1HNWM 1ZMWA 1TGUA 3DA1A 2DWLA 1SG9A 2EJSA 4QNRA 3I4YA 4GC9A 3E46A 2KNZA 4Q7JA 2DWMA 2E5LM 3TL4X 1JB0F 1QZEA 3HWSA 1WR1B 4LJ7A 3VFDA 3MHVC 3PNVA 1HNZM 3I51A 4LJ4A 3WHKA 4M0WA 2VIIA 3DFZA 4JI4M 4AKHA 2OPFA 4S12A 2C5RA 2J5YA 3UMMA 3J7AS 1XHBA 1OIPA 1TF0B 1IXSB 3HX3A 3W0LB 1OFIA 1TDZA 3JAMS 4DV0M 1NY5A 4OX9M 2LBCA 2R65A 4DR3M 2OOAA 1N36M 1XWIA 2X4AA 3RGSA 3LW5F 2FH0A 1IY2A 2O01F 2C98A 2O25A 3K2LA 4DR5M 1GJSA 3J80S 5FLXS 2DZNB 5ITUA 1QUSA 3GRRA 1IY0A 1IN8A 4II7A 3HJQA 2JA2A 2Y0QA 1TH4A 3M6AA 2Z8YM 2UUAM 4G6ZA 1CUKA 3AFHA 3FE3A 2XSZD 2JY7A 2DNAA 1D0LA 2Y21A 3R8FA 4JI5M 1N33M 2QZ4A 2KW0A 2CUZA 4B7FA 2F5QA 1ZQ9A 4JI2M 3UZUA 2RRUA 2QHOB 2CHVA 4NRVA 2XH9A 2Z4SA 2R4JA 1I94M 1XXHA 3KSXA 1JR3D 3I01M 4DR2M 2OO9A 4JN6A 3TWMA 3AOEC 3GLGE 4FCVA 2K6BA 2Y20A 3IG5A 4LRSA 4NXMM 1Q3CA 3FUWA 1XXHE 2L4FA 4MGIE 3U60A 1IFYA 2JNHA 4FVMA 4LZZA 4L8RC 5DYIA 4AKIA 4JYAM 3QYBA 3U6MA 2XZUA 4IBGA 2H1RA 4G3OA 3GLFA 2HWJA 4QHSA 1D2NA 1J7KA 4GEWA 3GPXA 2WSEF 3TPZA 1GJTA 4JV5M 1QDTA 3SYKA 4IBEA 4CIZA 3UJNA 3CTWB 3THGA 2VF8A 4BB9A 2V6ZM 4PD2A 1I4WA 1W5TA 5LMNM 2UUCM 4DR4M 2LWXA 4TUWA 4M9SA 2ZANA 1XMQM 4JI8M 1N78A 1WGNA 2HCBA 2LVPC 3AOEA 1OTRA 1SXJB 3C58A 4GRIA 4DV5M 1MU5A 2DXIA 4LJAA 4LFCM 2J7OA 3T1HM 3FUVA 2V1CA 4B7HA 2A5YB 3H4MA 3PXGA 4KLNA 4DUZM 4P17A 1OIZA 1KSFX 4L15A 1GL6A 2VQEM 1QQWA 1L8QA 4NC6A 5FTKA 1IN7A 1EFUB 1YUBA 1ZMVA 2Z3XA 3SASA 4LGMA 4RNAA 4LF6M 3A98B 1R2YA 2KHHA 3L27A 2DAKA 1HT1E 3OTOM 4LF4M 4D82A 3SARA 2Z4RA 3C3EA 1G4AE 3GQ3A 2GNOA 1XNQM 2DWZB 1A5TA 1DO0A 3GLIA 2EKFA 1SXJC 3FTEA 2M60A 2CV0A 3CF0A 1QZMA 2JZ0A 3L28A 3Q8XA 1IXSA 4B08A 2QCUA 3HHYA 1PJIA 1TR8A 2VDBB 3B7NA 2R18A 5EP4A 3HZJA 1YLAA 4JI7M 3NBIA 4DV3M 3KOXE 1HNXM 4LFBM 2D7EA 2UU9M 2VF7A 1XNRM 2LH0A 5ITXE 1Q39A 2JP7A 3GLHE 2OQ4A 3V76A 3SC3A 1Z6TA 5IT9S 1DO2A 4K0KM 2C96A 5C18A 2XZFA 5E26A 2XFSA 2O5RA 4NSOB 2CEAA 3W68A 5JI2E 3KS4A 4KODA 1NHWC 1SXJD 1LV7A 5DNYA 4HEOA 2KDLA 2F5SA 2EKKA 3DOAA 4LCBA 3IG8A 2CE7A 3B7QA 5KQ8A 5EJCA 4MM3B 2V1UA 4AKGA 2QNJA 2VQFM 4FWHA 2X8AA 1VDDA 2C9OA 3IECA 1MN3A 4CJ6A 4CISA 4PDGA 4LF8M 4MGHA 5C1BA 2JWSA 1D0KA 1Z5AA 1OQYA 2DAGA 4X62M 3GO8A 4AG5A 4B3RM 2XFTA 4IBBA 8CATA 2R0IA 1NSFA 3GRUA 4IJFA 1SXJE 4LJ5A 3GQ5A 4NOOB 3BOSA 1YE9A 1TH3A 1QDRA 1OAOC 2APLA 4FW9A 1VEKA 1QAOA 4G4QA 3HKPA 4PCZA 2FS1A 3AOGA 4DUYM 3U6SA 1VG5A 5BPVA 3L2AA 1VQ1A 2FOIC 4FCTA 2N35A 2CWBA 3LQRA 4QHTA 4WURA 1TTEA 1E9RA 4QNMA 2XLJA 1E94E 2ZTDA 1PGYA 3R9XB 3LQQA 1WIVA 3A42A 4Y28F 1DGHA 4EIWA 4DV6M 3K9PA 1N32M 4GH9A 2D7HA 2ERCA 4DV2M 4X66M 2BJVA 3FUTA 2F4VM 2C9CA 2OOBA 2K0BX 5EQTA 3AKZA 1N75A 1PJTA 1T6OA 2CHGA 5H37D 1G71A 2CFOA 1DGHB 4WP2A 2RGOA 1OJLA 3K1JA 3SHFA 3VDUA 4YHHM 1C7YA 4LF7M 1XC8A 1MJGM 3LMMA 1DV0A 1X37A 3M0EA 3E9SA 3NWLA 4LFAM 4G4RA 1V33A 3HGIA 3SBJA 1GKIA 4RF0A 1N34M 3FTFA 3M7GA 1NV8A 5ITXA 1H6UA 4DV4M 2X49A 5KPTA 1IM2A 1OKSA 2KZSA 2LXEA 2DWNA 4KHPM 4ZPXA 4KT0F 4QOSA 4MGZE 2F5NA 4X64M 2ZAOA 3FTCA 1TDHA 3ZH9B 3LCVB 5FTMA 3VLFB 1VEGA 2XEPA 3FUXA 5IZ7D 2LHCA 2R62A 2GQFA 3ZQJA 1WGLA 4LRTA 5DYGA 4R7GA 2YQZA 3FRHA 2CRUA 4JI1M 2UXDM 1YSYA 4AI6A 3E21A 3KOZE 1NHGC 1NO1A 1AIPC 4G4NA 1WHCA 2XGNA 3SAVA 4D80A 3T1YM 1KFVA 4ANRA 3TQSA 4NRWA 3B9PA 2H5XA 5KPRA 1JR3A 2BWBA 3J7BA 4GITA 4LF5M 3CF6E 3C3DA 3VKGA 4BLCA 1NJFA 2F5PA 1Z5BA 2FFJA 5JI3E 1HQYE 1FNNA 3ZCBB 4OVZB 4IBJA 4GC5A 4W5WA 1K3XA 3KOWE 3SATA 1QAMA 1S3SA 2MR9A 4JI3M 2WSFF 3KOYE 1ZMUA 4I4LA 2K47A 4I5SA 1IXRC 3UK6A 1NNUC 5KQDA 4JXJA 3NBXX 3LVVA 1RU3A 3HU3A 1L1TA 4HLQA 4AG6A 4LGYA 4FWDA 3UGJA 2G5GX 3HJSA 4AZFA 2UUBM 4LZJA 2YFQA 2R45A 1IBLM 2D7GA 1QVRA 3K8ZA 4GIPA 3WHLA 4ITQA 3GP1A 4MGKE 7CATA 1FJGM 5EP3A 4WW0A 3KS8A 1T3TA 3H4JA 1NV9A 2EUCA 3IHPA 3QAUA 4AW4A 3QWLA 2LHGA 4Z6YA 3GRVA 2BNKA 2QP9X 2LTUA 1PRBA 3D8LA 2R44A 3SAWA 3U6QA 5EXSA 1UM8A 2HHHM 2YNMD 4XGIA 4YY3M 3U6CA 4RF1A 5KO3A 2MJ5B 1ZAEA 3L29A 2DVWB 3GLIB 3RFWA 2Q2EB 1SXJA 4M9XA 2L2DA 2MROB 4D81A 4FWGA 3KDSE 4Z8XA 2UXCM 4PT5A 5L8RF 4G4OA 1NNJA 1KYIA 2RGHA 2DZOB 1HQCA 1R2ZA 5EXXA 3A45A 3GLHA 1N77A 3D8BA 2CHQA 2CV2A 4DV1M 1QUTA 3F92A 4B7GA 4NSRA 3B7ZA 2DENA 2Z7JA 3KVWA 4MH0E 3GPPA 1IN6A 3SHGB 1DGBA 1OFHA 1XMOM 4MGYE 3GPUA 1IXZA 3SMPA 1G41A 5EP1A 2JZ1A 2AHMA 2XSZA 1GABA 2L6OA 1T43A 2L7HA 5ITQA 2LVQD 2JUJA 3LCUA 3I4VA 2B3TA 4LY6A 4KO8A 4LJ9A 1WXQA 2P5TA 2NQ8C 1GVNA 1V34A 3Q8GA 4R71A 1IBKM 4XBOA 1TH2A 1R5LA 2QENA 4IBDA 3MK6A 2BWEA 4PDIA 3SFZA 3JR4A 3KP1E 2WZJA 3GQ4A 3T15A 4DBGB 3B74A 1J5EM 1L2DA 1QANA 1GO5A 2LVAA 3TWLA 3BXWA 4X65M 3U6DA 5F3WA 2QBYB 3EIHA 1D0MA 1HR0M 2KA6B 1W5SA 2EO2A 4IBFA 4IBCA 1R7RA 3FYDA 3RGPA 2KEBA 1MX0A 1HJPA 2RKOA 1IQPA 3HHXA 2JXNA 3HJ8A 4NL4H 3VK7A 1V92A 1PM5A 2R46A 4P16A 2MH8A 2L4EA 4L6V6 3PFIA 3PVSA 3GLGB 2QBYA 2DAIA 2LNHC 1NVMA 5FTNA 2G3QA 4L78A 1IY1A 2FNAA 2XF3A 3W67A 5EXTA 4GKJM 2DHYA 4GHLA 4JI6M 1F4IA 1JR3E 4DR7M 1GL7A 3KW6A 1J09A 3ILKA 3K92A 4I81A 4F2LA 4DV7M 4LF9M 5E6JA 3U6PA 3KSJA 5FTJA 5GKNA 3GLGA 4UN2B 1UFZA 3T6PA 2L09A 1IN4A 3J2PB 2BJWA 5LMUM 4JI0M 3A46A 4BBAA 3HHWA 3U6LA 4DR6M 1PJQA 1R4GA 4GMQA 4B3SM 1QAQA 1QYRA 1Q3BA 2YR0A 4IBIA 4A3VB 4L16A 2I7NA 4DR1M 2EA0A 3GLFE 4RKUF 5IREB 4OU7A 1Q02A 1VDLA 1WJ7A 3HHZA 4REZA 2HAKA 5EXPA 2DZLA 2ZAMA 2QSFX 3AV0A 1AUAA 3MMPA 5A2QS 1L2BA 4AQYM 2CV1A 2FE8A 3VKHA 1G3IA 2ZBKB 3HU1A 4CHTB 5IWAM 4IBKA 1R6BX 3B89A 3PNYA 2KNAA 1Z59A 3MJ5A 5DFLA 1DGGA 5FTLA 3SMSA 1EIJA 3C9PA 4M0DA 2ZTCA 3VDPA 1XB2B 3KXEC 1ZV1A 1E9SA 2DAMA 4IIWA 2KXEA 1HT2E 1OAIA 3DZDA 3JR5A 1Z5CA 1G59A 4M9ZA 4NXNM 3QYEA 4OVZA 1EE8A 4QOZC 2DKLA 2Y0TA 1VEJA 3U5ZB 2I7PA 3AJIB 1G8PA 3TE6A 3U6EA 1DGFA 2WSCF 1BVSA 1C1KA 4FCWA 4F1IA 3VK8A 3GLFB 1L1ZA 4LJ6A 2JY8A 3FKEA 3FD9A 3HU2A 3U61A 4B3TM 3FTDA 3U60B 4B3MM 3I04M 2L7IA 3K9OA 4XK8F 2R4EA 3ZC7B 3GLHB 3L25A 3FRIA 2LVNC 2F5OA 4FD2A 2W82A 1PJJA 1PJSA 2KZUA 1IBMM 4L4UA 1XXHB 4LJ8A 3AL0C 3CF2A 1IN5A 2HKJA 4GKKM 1E32A 3E4RA 5ITTA
chains in the Genus database with same CATH topology
3KFUG 3LVWA 2KRUA 2M5ZA 3FYCA 2QPAA 4LG2A 4I8OA 3U61B 4HL4A 5EP2A 4MB7A 2KRKA 3L26A 5ITRA 3J27B 3KP0E 1K82A 5ITYA 4CGYB 2C99A 4GHAA 3GRYA 3SYLA 5BR8M 2ZM6M 3W0FA 4OW0A 1JQJC 3T38A 5KPZA 1ORYB 1NY6A 2DHRA 3GPYA 2HL7A 4IJEA 1L2CA 2G8LA 5FSWA 4R3DA 1GLNA 1K3WA 1NJGA 2J7NA 3RE8A 3FUUA 3TWKA 3J81S 2UXBM 3EIEA 3U6OA 3U5ZA 3SAUA 1HNWM 1TGUA 3DA1A 2DWLA 4QNRA 3I4YA 4GC9A 2E5LM 3TL4X 3HWSA 4LJ7A 3VFDA 3MHVC 3PNVA 1HNZM 3I51A 4LJ4A 3WHKA 4M0WA 2VIIA 3DFZA 4JI4M 4AKHA 2OPFA 4S12A 2C5RA 3UMMA 3J7AS 1XHBA 1IXSB 3W0LB 1OFIA 1TDZA 3JAMS 4DV0M 1NY5A 4OX9M 2R65A 4DR3M 1N36M 1XWIA 2X4AA 3RGSA 3K2LA 1IY2A 2C98A 4DR5M 3J80S 5FLXS 2DZNB 5ITUA 3GRRA 1IY0A 1IN8A 4II7A 3HJQA 2JA2A 2Y0QA 1TH4A 3M6AA 2UUAM 4G6ZA 3AFHA 2XSZD 4JI5M 3R8FA 2Y21A 1N33M 2KW0A 2QZ4A 2CUZA 4B7FA 2F5QA 1ZQ9A 4JI2M 3UZUA 2CHVA 4NRVA 2XH9A 2Z4SA 2R4JA 1I94M 1XXHA 3KSXA 1JR3D 4DR2M 3TWMA 4JN6A 3AOEC 4FCVA 2Y20A 4NXMM 3IG5A 4LRSA 1Q3CA 3FUWA 4MGIE 3U60A 4FVMA 4LZZA 4L8RC 5DYIA 4AKIA 4JYAM 3U6MA 2XZUA 4IBGA 2H1RA 3GLFA 4QHSA 1D2NA 1J7KA 3GPXA 3TPZA 4JV5M 3SYKA 4IBEA 3UJNA 3CTWB 3THGA 4PD2A 4BB9A 2V6ZM 5LMNM 1I4WA 1W5TA 2UUCM 4DR4M 2LWXA 4M9SA 2ZANA 1XMQM 4JI8M 1N78A 2HCBA 3AOEA 1SXJB 3C58A 4GRIA 4DV5M 1MU5A 2DXIA 4LJAA 4LFCM 2J7OA 3T1HM 3FUVA 2V1CA 4B7HA 2A5YB 3H4MA 3PXGA 4KLNA 4DUZM 1KSFX 4L15A 1GL6A 2VQEM 1QQWA 1L8QA 5FTKA 1IN7A 1YUBA 2Z3XA 3SASA 4LGMA 4RNAA 4LF6M 3A98B 1R2YA 3L27A 1HT1E 3OTOM 4LF4M 4D82A 3SARA 2Z4RA 1G4AE 3GQ3A 2DWZB 3GLIA 1DO0A 1SXJC 3FTEA 2M60A 2CV0A 3CF0A 1QZMA 3L28A 3Q8XA 4B08A 2QCUA 3HHYA 1PJIA 2R18A 5EP4A 4JI7M 3NBIA 4DV3M 3KOXE 1HNXM 4LFBM 2D7EA 2UU9M 1XNRM 2LH0A 5ITXE 1Q39A 2OQ4A 3SC3A 1Z6TA 5IT9S 1DO2A 4K0KM 2C96A 5C18A 2XZFA 5E26A 2XFSA 2O5RA 4NSOB 2CEAA 5JI2E 3KS4A 4KODA 1NHWC 1SXJD 1LV7A 5DNYA 2F5SA 4TUWA 4LCBA 3DOAA 3IG8A 2CE7A 5KQ8A 5EJCA 4MM3B 2V1UA 4AKGA 2VQFM 4FWHA 2X8AA 1VDDA 2C9OA 4CISA 4PDGA 4LF8M 4MGHA 5C1BA 1Z5AA 4X62M 3GO8A 4AG5A 4B3RM 2XFTA 4IBBA 8CATA 1NSFA 3GRUA 4IJFA 1SXJE 4LJ5A 3GQ5A 4NOOB 3BOSA 1YE9A 1TH3A 4FW9A 4G4QA 1QAOA 3HKPA 4PCZA 3AOGA 4DUYM 3U6SA 5BPVA 3L2AA 2FOIC 4FCTA 3LQRA 4WURA 4QHTA 2DWMA 3L25A 1E9RA 4QNMA 2XLJA 1E94E 3R9XB 3LQQA 3A42A 1DGHA 4EIWA 4DV6M 1N32M 4GH9A 2D7HA 2ERCA 4DV2M 4X66M 2BJVA 3FUTA 2F4VM 2C9CA 5EQTA 3AKZA 1N75A 2CHGA 5H37D 2CFOA 1DGHB 2RGOA 1OJLA 3K1JA 3SHFA 3VDUA 4YHHM 4LF7M 1XC8A 3LMMA 1X37A 3M0EA 3E9SA 3NWLA 4LFAM 4G4RA 3HGIA 3SBJA 1GKIA 4RF0A 1N34M 3FTFA 3M7GA 5ITXA 1H6UA 4DV4M 2X49A 5KPTA 1IM2A 2KZSA 2LXEA 2DWNA 4KHPM 4ZPXA 4QOSA 4MGZE 2F5NA 4X64M 2ZAOA 3FTCA 1TDHA 3ZH9B 5FTMA 3VLFB 5IZ7D 2XEPA 3FUXA 2R62A 4LRTA 5DYGA 4R7GA 2YQZA 4JI1M 2UXDM 1YSYA 4AI6A 3KOZE 1NHGC 4G4NA 2XGNA 3SAVA 4D80A 3T1YM 1KFVA 3TQSA 4NRWA 3B9PA 5KPRA 1JR3A 3J7BA 4GITA 4LF5M 3CF6E 3VKGA 4BLCA 1NJFA 2F5PA 1Z5BA 2FFJA 5JI3E 1HQYE 1FNNA 3ZCBB 4OVZB 4IBJA 4GC5A 4W5WA 1K3XA 3KOWE 3SATA 1QAMA 1S3SA 4JI3M 3KOYE 4I4LA 4I5SA 2K47A 1IXRC 3UK6A 1NNUC 5KQDA 4JXJA 3LVVA 3HU3A 1L1TA 4HLQA 4AG6A 4LGYA 4FWDA 3UGJA 2G5GX 3HJSA 4AZFA 2UUBM 4LZJA 2YFQA 2R45A 1IBLM 2D7GA 1QVRA 3K8ZA 4GIPA 3WHLA 4ITQA 3GP1A 4MGKE 7CATA 1FJGM 5EP3A 4WW0A 3KS8A 1T3TA 2EUCA 3QAUA 4AW4A 3QWLA 4Z6YA 3GRVA 2BNKA 2QP9X 3D8LA 3SAWA 3U6QA 5EXSA 1UM8A 2HHHM 2YNMD 4XGIA 4YY3M 3U6CA 4RF1A 5KO3A 3GLIB 1ZAEA 3L29A 2DVWB 3RFWA 2Q2EB 1SXJA 4M9XA 4D81A 4FWGA 3KDSE 4Z8XA 2UXCM 4PT5A 4G4OA 1NNJA 1KYIA 2RGHA 2DZOB 1HQCA 1R2ZA 5EXXA 3A45A 3GLHA 1N77A 3D8BA 2CHQA 2CV2A 4DV1M 4B7GA 4NSRA 2Z7JA 3KVWA 4MH0E 3GPPA 1IN6A 3SHGB 1DGBA 1OFHA 1XMOM 4MGYE 3GPUA 1IXZA 3SMPA 1G41A 5EP1A 2AHMA 2XSZA 2L6OA 2L7HA 5ITQA 3I4VA 4LY6A 4KO8A 4LJ9A 1WXQA 2P5TA 2NQ8C 1GVNA 1IBKM 4XBOA 1TH2A 2QENA 4IBDA 3MK6A 4PDIA 3SFZA 3JR4A 3KP1E 3GQ4A 3T15A 1J5EM 1L2DA 1QANA 4X65M 3TWLA 3U6DA 5F3WA 2QBYB 3EIHA 1HR0M 2KA6B 1W5SA 2EO2A 4IBFA 4IBCA 1R7RA 3FYDA 3RGPA 2KEBA 1MX0A 2RKOA 1IQPA 3HHXA 3HJ8A 3VK7A 4NL4H 1PM5A 2R46A 4P16A 2QBYA 3PFIA 3PVSA 3GLGB 2LNHC 1NVMA 5FTNA 4L78A 1IY1A 2FNAA 2XF3A 4GKJM 5EXTA 4GHLA 4JI6M 4DR7M 1GL7A 3KW6A 1J09A 3ILKA 3K92A 4I81A 4DV7M 4LF9M 5E6JA 3U6PA 3KSJA 5FTJA 5GKNA 3GLGA 2L09A 1IN4A 3J2PB 2BJWA 5LMUM 4JI0M 3A46A 4BBAA 3HHWA 3U6LA 4DR6M 4GMQA 4B3SM 1QAQA 1QYRA 1Q3BA 2YR0A 4IBIA 4A3VB 4L16A 2I7NA 4DR1M 2EA0A 5IREB 4OU7A 3HHZA 4REZA 5EXPA 2ZAMA 3AV0A 5A2QS 1L2BA 4AQYM 2CV1A 2FE8A 3VKHA 1G3IA 2ZBKB 3HU1A 4CHTB 5IWAM 4IBKA 1R6BX 3PNYA 1Z59A 3MJ5A 1DGGA 5FTLA 3SMSA 4M0DA 3VDPA 3KXEC 1E9SA 4IIWA 3JR5A 2KXEA 1HT2E 1G59A 3DZDA 1XNQM 1Z5CA 4M9ZA 4NXNM 4OVZA 1EE8A 4QOZC 2Y0TA 3U5ZB 2I7PA 3AJIB 1G8PA 3TE6A 3U6EA 1DGFA 1C1KA 4FCWA 3VK8A 3GLFB 1L1ZA 4LJ6A 3FKEA 3FD9A 3HU2A 3U61A 4B3TM 3FTDA 3U60B 4B3MM 2L7IA 2R4EA 3ZC7B 3GLHB 2F5OA 4FD2A 2W82A 1PJJA 1IBMM 2KZUA 4L4UA 1XXHB 4LJ8A 3AL0C 3CF2A 1IN5A 2HKJA 4GKKM 1E32A 3E4RA 5ITTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5Z A;  2M60 A; 
#chains in the Genus database with same CATH topology
 3KFU G;  3LVW A;  2KRU A;  2DI0 A;  2M5Z A;  2DAE A;  1P3Q Q;  3FYC A;  2QPA A;  4LG2 A;  4I8O A;  2LVO C;  2JY5 A;  3U61 B;  4HL4 A;  5EP2 A;  4MB7 A;  2JY6 B;  2KRK A;  3L26 A;  5ITR A;  3J27 B;  2CP8 A;  3KP0 E;  1K82 A;  3HY5 A;  5ITY A;  4CGY B;  2C99 A;  4GHA A;  3GRY A;  3SYL A;  5BR8 M;  2ZM6 M;  3W0F A;  4OW0 A;  3BBZ A;  1LTM A;  1JQJ C;  3T38 A;  5KPZ A;  2KNV A;  1ORY B;  1NY6 A;  2DHR A;  3GPY A;  2HL7 A;  4IJE A;  1L2C A;  2G8L A;  5FSW A;  2MGW A;  4R3D A;  1GLN A;  2QQ8 A;  1Y8G A;  2R6F A;  1K3W A;  1NJG A;  2K9D A;  2J7N A;  3RE8 A;  3FUU A;  3TWK A;  3J81 S;  3CGW A;  3GLI E;  2UXB M;  3EIE A;  3U6O A;  3U5Z A;  3SAU A;  1HNW M;  1ZMW A;  1TGU A;  3DA1 A;  2DWL A;  1SG9 A;  2EJS A;  4QNR A;  3I4Y A;  4GC9 A;  3E46 A;  2KNZ A;  4Q7J A;  2DWM A;  2E5L M;  3TL4 X;  1JB0 F;  1QZE A;  3HWS A;  1WR1 B;  4LJ7 A;  3VFD A;  3MHV C;  3PNV A;  1HNZ M;  3I51 A;  4LJ4 A;  3WHK A;  4M0W A;  2VII A;  3DFZ A;  4JI4 M;  4AKH A;  2OPF A;  4S12 A;  2C5R A;  2J5Y A;  3UMM A;  3J7A S;  1XHB A;  1OIP A;  1TF0 B;  1IXS B;  3HX3 A;  3W0L B;  1OFI A;  1TDZ A;  3JAM S;  4DV0 M;  1NY5 A;  4OX9 M;  2LBC A;  2R65 A;  4DR3 M;  2OOA A;  1N36 M;  1XWI A;  2X4A A;  3RGS A;  3LW5 F;  2FH0 A;  1IY2 A;  2O01 F;  2C98 A;  2O25 A;  3K2L A;  4DR5 M;  1GJS A;  3J80 S;  5FLX S;  2DZN B;  5ITU A;  1QUS A;  3GRR A;  1IY0 A;  1IN8 A;  4II7 A;  3HJQ A;  2JA2 A;  2Y0Q A;  1TH4 A;  3M6A A;  2Z8Y M;  2UUA M;  4G6Z A;  1CUK A;  3AFH A;  3FE3 A;  2XSZ D;  2JY7 A;  2DNA A;  1D0L A;  2Y21 A;  3R8F A;  4JI5 M;  1N33 M;  2QZ4 A;  2KW0 A;  2CUZ A;  4B7F A;  2F5Q A;  1ZQ9 A;  4JI2 M;  3UZU A;  2RRU A;  2QHO B;  2CHV A;  4NRV A;  2XH9 A;  2Z4S A;  2R4J A;  1I94 M;  1XXH A;  3KSX A;  1JR3 D;  3I01 M;  4DR2 M;  2OO9 A;  4JN6 A;  3TWM A;  3AOE C;  3GLG E;  4FCV A;  2K6B A;  2Y20 A;  3IG5 A;  4LRS A;  4NXM M;  1Q3C A;  3FUW A;  1XXH E;  2L4F A;  4MGI E;  3U60 A;  1IFY A;  2JNH A;  4FVM A;  4LZZ A;  4L8R C;  5DYI A;  4AKI A;  4JYA M;  3QYB A;  3U6M A;  2XZU A;  4IBG A;  2H1R A;  4G3O A;  3GLF A;  2HWJ A;  4QHS A;  1D2N A;  1J7K A;  4GEW A;  3GPX A;  2WSE F;  3TPZ A;  1GJT A;  4JV5 M;  1QDT A;  3SYK A;  4IBE A;  4CIZ A;  3UJN A;  3CTW B;  3THG A;  2VF8 A;  4BB9 A;  2V6Z M;  4PD2 A;  1I4W A;  1W5T A;  5LMN M;  2UUC M;  4DR4 M;  2LWX A;  4TUW A;  4M9S A;  2ZAN A;  1XMQ M;  4JI8 M;  1N78 A;  1WGN A;  2HCB A;  2LVP C;  3AOE A;  1OTR A;  1SXJ B;  3C58 A;  4GRI A;  4DV5 M;  1MU5 A;  2DXI A;  4LJA A;  4LFC M;  2J7O A;  3T1H M;  3FUV A;  2V1C A;  4B7H A;  2A5Y B;  3H4M A;  3PXG A;  4KLN A;  4DUZ M;  4P17 A;  1OIZ A;  1KSF X;  4L15 A;  1GL6 A;  2VQE M;  1QQW A;  1L8Q A;  4NC6 A;  5FTK A;  1IN7 A;  1EFU B;  1YUB A;  1ZMV A;  2Z3X A;  3SAS A;  4LGM A;  4RNA A;  4LF6 M;  3A98 B;  1R2Y A;  2KHH A;  3L27 A;  2DAK A;  1HT1 E;  3OTO M;  4LF4 M;  4D82 A;  3SAR A;  2Z4R A;  3C3E A;  1G4A E;  3GQ3 A;  2GNO A;  1XNQ M;  2DWZ B;  1A5T A;  1DO0 A;  3GLI A;  2EKF A;  1SXJ C;  3FTE A;  2M60 A;  2CV0 A;  3CF0 A;  1QZM A;  2JZ0 A;  3L28 A;  3Q8X A;  1IXS A;  4B08 A;  2QCU A;  3HHY A;  1PJI A;  1TR8 A;  2VDB B;  3B7N A;  2R18 A;  5EP4 A;  3HZJ A;  1YLA A;  4JI7 M;  3NBI A;  4DV3 M;  3KOX E;  1HNX M;  4LFB M;  2D7E A;  2UU9 M;  2VF7 A;  1XNR M;  2LH0 A;  5ITX E;  1Q39 A;  2JP7 A;  3GLH E;  2OQ4 A;  3V76 A;  3SC3 A;  1Z6T A;  5IT9 S;  1DO2 A;  4K0K M;  2C96 A;  5C18 A;  2XZF A;  5E26 A;  2XFS A;  2O5R A;  4NSO B;  2CEA A;  3W68 A;  5JI2 E;  3KS4 A;  4KOD A;  1NHW C;  1SXJ D;  1LV7 A;  5DNY A;  4HEO A;  2KDL A;  2F5S A;  2EKK A;  3DOA A;  4LCB A;  3IG8 A;  2CE7 A;  3B7Q A;  5KQ8 A;  5EJC A;  4MM3 B;  2V1U A;  4AKG A;  2QNJ A;  2VQF M;  4FWH A;  2X8A A;  1VDD A;  2C9O A;  3IEC A;  1MN3 A;  4CJ6 A;  4CIS A;  4PDG A;  4LF8 M;  4MGH A;  5C1B A;  2JWS A;  1D0K A;  1Z5A A;  1OQY A;  2DAG A;  4X62 M;  3GO8 A;  4AG5 A;  4B3R M;  2XFT A;  4IBB A;  8CAT A;  2R0I A;  1NSF A;  3GRU A;  4IJF A;  1SXJ E;  4LJ5 A;  3GQ5 A;  4NOO B;  3BOS A;  1YE9 A;  1TH3 A;  1QDR A;  1OAO C;  2APL A;  4FW9 A;  1VEK A;  1QAO A;  4G4Q A;  3HKP A;  4PCZ A;  2FS1 A;  3AOG A;  4DUY M;  3U6S A;  1VG5 A;  5BPV A;  3L2A A;  1VQ1 A;  2FOI C;  4FCT A;  2N35 A;  2CWB A;  3LQR A;  4QHT A;  4WUR A;  1TTE A;  1E9R A;  4QNM A;  2XLJ A;  1E94 E;  2ZTD A;  1PGY A;  3R9X B;  3LQQ A;  1WIV A;  3A42 A;  4Y28 F;  1DGH A;  4EIW A;  4DV6 M;  3K9P A;  1N32 M;  4GH9 A;  2D7H A;  2ERC A;  4DV2 M;  4X66 M;  2BJV A;  3FUT A;  2F4V M;  2C9C A;  2OOB A;  2K0B X;  5EQT A;  3AKZ A;  1N75 A;  1PJT A;  1T6O A;  2CHG A;  5H37 D;  1G71 A;  2CFO A;  1DGH B;  4WP2 A;  2RGO A;  1OJL A;  3K1J A;  3SHF A;  3VDU A;  4YHH M;  1C7Y A;  4LF7 M;  1XC8 A;  1MJG M;  3LMM A;  1DV0 A;  1X37 A;  3M0E A;  3E9S A;  3NWL A;  4LFA M;  4G4R A;  1V33 A;  3HGI A;  3SBJ A;  1GKI A;  4RF0 A;  1N34 M;  3FTF A;  3M7G A;  1NV8 A;  5ITX A;  1H6U A;  4DV4 M;  2X49 A;  5KPT A;  1IM2 A;  1OKS A;  2KZS A;  2LXE A;  2DWN A;  4KHP M;  4ZPX A;  4KT0 F;  4QOS A;  4MGZ E;  2F5N A;  4X64 M;  2ZAO A;  3FTC A;  1TDH A;  3ZH9 B;  3LCV B;  5FTM A;  3VLF B;  1VEG A;  2XEP A;  3FUX A;  5IZ7 D;  2LHC A;  2R62 A;  2GQF A;  3ZQJ A;  1WGL A;  4LRT A;  5DYG A;  4R7G A;  2YQZ A;  3FRH A;  2CRU A;  4JI1 M;  2UXD M;  1YSY A;  4AI6 A;  3E21 A;  3KOZ E;  1NHG C;  1NO1 A;  1AIP C;  4G4N A;  1WHC A;  2XGN A;  3SAV A;  4D80 A;  3T1Y M;  1KFV A;  4ANR A;  3TQS A;  4NRW A;  3B9P A;  2H5X A;  5KPR A;  1JR3 A;  2BWB A;  3J7B A;  4GIT A;  4LF5 M;  3CF6 E;  3C3D A;  3VKG A;  4BLC A;  1NJF A;  2F5P A;  1Z5B A;  2FFJ A;  5JI3 E;  1HQY E;  1FNN A;  3ZCB B;  4OVZ B;  4IBJ A;  4GC5 A;  4W5W A;  1K3X A;  3KOW E;  3SAT A;  1QAM A;  1S3S A;  2MR9 A;  4JI3 M;  2WSF F;  3KOY E;  1ZMU A;  4I4L A;  2K47 A;  4I5S A;  1IXR C;  3UK6 A;  1NNU C;  5KQD A;  4JXJ A;  3NBX X;  3LVV A;  1RU3 A;  3HU3 A;  1L1T A;  4HLQ A;  4AG6 A;  4LGY A;  4FWD A;  3UGJ A;  2G5G X;  3HJS A;  4AZF A;  2UUB M;  4LZJ A;  2YFQ A;  2R45 A;  1IBL M;  2D7G A;  1QVR A;  3K8Z A;  4GIP A;  3WHL A;  4ITQ A;  3GP1 A;  4MGK E;  7CAT A;  1FJG M;  5EP3 A;  4WW0 A;  3KS8 A;  1T3T A;  3H4J A;  1NV9 A;  2EUC A;  3IHP A;  3QAU A;  4AW4 A;  3QWL A;  2LHG A;  4Z6Y A;  3GRV A;  2BNK A;  2QP9 X;  2LTU A;  1PRB A;  3D8L A;  2R44 A;  3SAW A;  3U6Q A;  5EXS A;  1UM8 A;  2HHH M;  2YNM D;  4XGI A;  4YY3 M;  3U6C A;  4RF1 A;  5KO3 A;  2MJ5 B;  1ZAE A;  3L29 A;  2DVW B;  3GLI B;  3RFW A;  2Q2E B;  1SXJ A;  4M9X A;  2L2D A;  2MRO B;  4D81 A;  4FWG A;  3KDS E;  4Z8X A;  2UXC M;  4PT5 A;  5L8R F;  4G4O A;  1NNJ A;  1KYI A;  2RGH A;  2DZO B;  1HQC A;  1R2Z A;  5EXX A;  3A45 A;  3GLH A;  1N77 A;  3D8B A;  2CHQ A;  2CV2 A;  4DV1 M;  1QUT A;  3F92 A;  4B7G A;  4NSR A;  3B7Z A;  2DEN A;  2Z7J A;  3KVW A;  4MH0 E;  3GPP A;  1IN6 A;  3SHG B;  1DGB A;  1OFH A;  1XMO M;  4MGY E;  3GPU A;  1IXZ A;  3SMP A;  1G41 A;  5EP1 A;  2JZ1 A;  2AHM A;  2XSZ A;  1GAB A;  2L6O A;  1T43 A;  2L7H A;  5ITQ A;  2LVQ D;  2JUJ A;  3LCU A;  3I4V A;  2B3T A;  4LY6 A;  4KO8 A;  4LJ9 A;  1WXQ A;  2P5T A;  2NQ8 C;  1GVN A;  1V34 A;  3Q8G A;  4R71 A;  1IBK M;  4XBO A;  1TH2 A;  1R5L A;  2QEN A;  4IBD A;  3MK6 A;  2BWE A;  4PDI A;  3SFZ A;  3JR4 A;  3KP1 E;  2WZJ A;  3GQ4 A;  3T15 A;  4DBG B;  3B74 A;  1J5E M;  1L2D A;  1QAN A;  1GO5 A;  2LVA A;  3TWL A;  3BXW A;  4X65 M;  3U6D A;  5F3W A;  2QBY B;  3EIH A;  1D0M A;  1HR0 M;  2KA6 B;  1W5S A;  2EO2 A;  4IBF A;  4IBC A;  1R7R A;  3FYD A;  3RGP A;  2KEB A;  1MX0 A;  1HJP A;  2RKO A;  1IQP A;  3HHX A;  2JXN A;  3HJ8 A;  4NL4 H;  3VK7 A;  1V92 A;  1PM5 A;  2R46 A;  4P16 A;  2MH8 A;  2L4E A;  4L6V 6;  3PFI A;  3PVS A;  3GLG B;  2QBY A;  2DAI A;  2LNH C;  1NVM A;  5FTN A;  2G3Q A;  4L78 A;  1IY1 A;  2FNA A;  2XF3 A;  3W67 A;  5EXT A;  4GKJ M;  2DHY A;  4GHL A;  4JI6 M;  1F4I A;  1JR3 E;  4DR7 M;  1GL7 A;  3KW6 A;  1J09 A;  3ILK A;  3K92 A;  4I81 A;  4F2L A;  4DV7 M;  4LF9 M;  5E6J A;  3U6P A;  3KSJ A;  5FTJ A;  5GKN A;  3GLG A;  4UN2 B;  1UFZ A;  3T6P A;  2L09 A;  1IN4 A;  3J2P B;  2BJW A;  5LMU M;  4JI0 M;  3A46 A;  4BBA A;  3HHW A;  3U6L A;  4DR6 M;  1PJQ A;  1R4G A;  4GMQ A;  4B3S M;  1QAQ A;  1QYR A;  1Q3B A;  2YR0 A;  4IBI A;  4A3V B;  4L16 A;  2I7N A;  4DR1 M;  2EA0 A;  3GLF E;  4RKU F;  5IRE B;  4OU7 A;  1Q02 A;  1VDL A;  1WJ7 A;  3HHZ A;  4REZ A;  2HAK A;  5EXP A;  2DZL A;  2ZAM A;  2QSF X;  3AV0 A;  1AUA A;  3MMP A;  5A2Q S;  1L2B A;  4AQY M;  2CV1 A;  2FE8 A;  3VKH A;  1G3I A;  2ZBK B;  3HU1 A;  4CHT B;  5IWA M;  4IBK A;  1R6B X;  3B89 A;  3PNY A;  2KNA A;  1Z59 A;  3MJ5 A;  5DFL A;  1DGG A;  5FTL A;  3SMS A;  1EIJ A;  3C9P A;  4M0D A;  2ZTC A;  3VDP A;  1XB2 B;  3KXE C;  1ZV1 A;  1E9S A;  2DAM A;  4IIW A;  2KXE A;  1HT2 E;  1OAI A;  3DZD A;  3JR5 A;  1Z5C A;  1G59 A;  4M9Z A;  4NXN M;  3QYE A;  4OVZ A;  1EE8 A;  4QOZ C;  2DKL A;  2Y0T A;  1VEJ A;  3U5Z B;  2I7P A;  3AJI B;  1G8P A;  3TE6 A;  3U6E A;  1DGF A;  2WSC F;  1BVS A;  1C1K A;  4FCW A;  4F1I A;  3VK8 A;  3GLF B;  1L1Z A;  4LJ6 A;  2JY8 A;  3FKE A;  3FD9 A;  3HU2 A;  3U61 A;  4B3T M;  3FTD A;  3U60 B;  4B3M M;  3I04 M;  2L7I A;  3K9O A;  4XK8 F;  2R4E A;  3ZC7 B;  3GLH B;  3L25 A;  3FRI A;  2LVN C;  2F5O A;  4FD2 A;  2W82 A;  1PJJ A;  1PJS A;  2KZU A;  1IBM M;  4L4U A;  1XXH B;  4LJ8 A;  3AL0 C;  3CF2 A;  1IN5 A;  2HKJ A;  4GKK M;  1E32 A;  3E4R A;  5ITT A; 
#chains in the Genus database with same CATH homology
 3KFU G;  3LVW A;  2KRU A;  2M5Z A;  3FYC A;  2QPA A;  4LG2 A;  4I8O A;  3U61 B;  4HL4 A;  5EP2 A;  4MB7 A;  2KRK A;  3L26 A;  5ITR A;  3J27 B;  3KP0 E;  1K82 A;  5ITY A;  4CGY B;  2C99 A;  4GHA A;  3GRY A;  3SYL A;  5BR8 M;  2ZM6 M;  3W0F A;  4OW0 A;  1JQJ C;  3T38 A;  5KPZ A;  1ORY B;  1NY6 A;  2DHR A;  3GPY A;  2HL7 A;  4IJE A;  1L2C A;  2G8L A;  5FSW A;  4R3D A;  1GLN A;  1K3W A;  1NJG A;  2J7N A;  3RE8 A;  3FUU A;  3TWK A;  3J81 S;  2UXB M;  3EIE A;  3U6O A;  3U5Z A;  3SAU A;  1HNW M;  1TGU A;  3DA1 A;  2DWL A;  4QNR A;  3I4Y A;  4GC9 A;  2E5L M;  3TL4 X;  3HWS A;  4LJ7 A;  3VFD A;  3MHV C;  3PNV A;  1HNZ M;  3I51 A;  4LJ4 A;  3WHK A;  4M0W A;  2VII A;  3DFZ A;  4JI4 M;  4AKH A;  2OPF A;  4S12 A;  2C5R A;  3UMM A;  3J7A S;  1XHB A;  1IXS B;  3W0L B;  1OFI A;  1TDZ A;  3JAM S;  4DV0 M;  1NY5 A;  4OX9 M;  2R65 A;  4DR3 M;  1N36 M;  1XWI A;  2X4A A;  3RGS A;  3K2L A;  1IY2 A;  2C98 A;  4DR5 M;  3J80 S;  5FLX S;  2DZN B;  5ITU A;  3GRR A;  1IY0 A;  1IN8 A;  4II7 A;  3HJQ A;  2JA2 A;  2Y0Q A;  1TH4 A;  3M6A A;  2UUA M;  4G6Z A;  3AFH A;  2XSZ D;  4JI5 M;  3R8F A;  2Y21 A;  1N33 M;  2KW0 A;  2QZ4 A;  2CUZ A;  4B7F A;  2F5Q A;  1ZQ9 A;  4JI2 M;  3UZU A;  2CHV A;  4NRV A;  2XH9 A;  2Z4S A;  2R4J A;  1I94 M;  1XXH A;  3KSX A;  1JR3 D;  4DR2 M;  3TWM A;  4JN6 A;  3AOE C;  4FCV A;  2Y20 A;  4NXM M;  3IG5 A;  4LRS A;  1Q3C A;  3FUW A;  4MGI E;  3U60 A;  4FVM A;  4LZZ A;  4L8R C;  5DYI A;  4AKI A;  4JYA M;  3U6M A;  2XZU A;  4IBG A;  2H1R A;  3GLF A;  4QHS A;  1D2N A;  1J7K A;  3GPX A;  3TPZ A;  4JV5 M;  3SYK A;  4IBE A;  3UJN A;  3CTW B;  3THG A;  4PD2 A;  4BB9 A;  2V6Z M;  5LMN M;  1I4W A;  1W5T A;  2UUC M;  4DR4 M;  2LWX A;  4M9S A;  2ZAN A;  1XMQ M;  4JI8 M;  1N78 A;  2HCB A;  3AOE A;  1SXJ B;  3C58 A;  4GRI A;  4DV5 M;  1MU5 A;  2DXI A;  4LJA A;  4LFC M;  2J7O A;  3T1H M;  3FUV A;  2V1C A;  4B7H A;  2A5Y B;  3H4M A;  3PXG A;  4KLN A;  4DUZ M;  1KSF X;  4L15 A;  1GL6 A;  2VQE M;  1QQW A;  1L8Q A;  5FTK A;  1IN7 A;  1YUB A;  2Z3X A;  3SAS A;  4LGM A;  4RNA A;  4LF6 M;  3A98 B;  1R2Y A;  3L27 A;  1HT1 E;  3OTO M;  4LF4 M;  4D82 A;  3SAR A;  2Z4R A;  1G4A E;  3GQ3 A;  2DWZ B;  3GLI A;  1DO0 A;  1SXJ C;  3FTE A;  2M60 A;  2CV0 A;  3CF0 A;  1QZM A;  3L28 A;  3Q8X A;  4B08 A;  2QCU A;  3HHY A;  1PJI A;  2R18 A;  5EP4 A;  4JI7 M;  3NBI A;  4DV3 M;  3KOX E;  1HNX M;  4LFB M;  2D7E A;  2UU9 M;  1XNR M;  2LH0 A;  5ITX E;  1Q39 A;  2OQ4 A;  3SC3 A;  1Z6T A;  5IT9 S;  1DO2 A;  4K0K M;  2C96 A;  5C18 A;  2XZF A;  5E26 A;  2XFS A;  2O5R A;  4NSO B;  2CEA A;  5JI2 E;  3KS4 A;  4KOD A;  1NHW C;  1SXJ D;  1LV7 A;  5DNY A;  2F5S A;  4TUW A;  4LCB A;  3DOA A;  3IG8 A;  2CE7 A;  5KQ8 A;  5EJC A;  4MM3 B;  2V1U A;  4AKG A;  2VQF M;  4FWH A;  2X8A A;  1VDD A;  2C9O A;  4CIS A;  4PDG A;  4LF8 M;  4MGH A;  5C1B A;  1Z5A A;  4X62 M;  3GO8 A;  4AG5 A;  4B3R M;  2XFT A;  4IBB A;  8CAT A;  1NSF A;  3GRU A;  4IJF A;  1SXJ E;  4LJ5 A;  3GQ5 A;  4NOO B;  3BOS A;  1YE9 A;  1TH3 A;  4FW9 A;  4G4Q A;  1QAO A;  3HKP A;  4PCZ A;  3AOG A;  4DUY M;  3U6S A;  5BPV A;  3L2A A;  2FOI C;  4FCT A;  3LQR A;  4WUR A;  4QHT A;  2DWM A;  3L25 A;  1E9R A;  4QNM A;  2XLJ A;  1E94 E;  3R9X B;  3LQQ A;  3A42 A;  1DGH A;  4EIW A;  4DV6 M;  1N32 M;  4GH9 A;  2D7H A;  2ERC A;  4DV2 M;  4X66 M;  2BJV A;  3FUT A;  2F4V M;  2C9C A;  5EQT A;  3AKZ A;  1N75 A;  2CHG A;  5H37 D;  2CFO A;  1DGH B;  2RGO A;  1OJL A;  3K1J A;  3SHF A;  3VDU A;  4YHH M;  4LF7 M;  1XC8 A;  3LMM A;  1X37 A;  3M0E A;  3E9S A;  3NWL A;  4LFA M;  4G4R A;  3HGI A;  3SBJ A;  1GKI A;  4RF0 A;  1N34 M;  3FTF A;  3M7G A;  5ITX A;  1H6U A;  4DV4 M;  2X49 A;  5KPT A;  1IM2 A;  2KZS A;  2LXE A;  2DWN A;  4KHP M;  4ZPX A;  4QOS A;  4MGZ E;  2F5N A;  4X64 M;  2ZAO A;  3FTC A;  1TDH A;  3ZH9 B;  5FTM A;  3VLF B;  5IZ7 D;  2XEP A;  3FUX A;  2R62 A;  4LRT A;  5DYG A;  4R7G A;  2YQZ A;  4JI1 M;  2UXD M;  1YSY A;  4AI6 A;  3KOZ E;  1NHG C;  4G4N A;  2XGN A;  3SAV A;  4D80 A;  3T1Y M;  1KFV A;  3TQS A;  4NRW A;  3B9P A;  5KPR A;  1JR3 A;  3J7B A;  4GIT A;  4LF5 M;  3CF6 E;  3VKG A;  4BLC A;  1NJF A;  2F5P A;  1Z5B A;  2FFJ A;  5JI3 E;  1HQY E;  1FNN A;  3ZCB B;  4OVZ B;  4IBJ A;  4GC5 A;  4W5W A;  1K3X A;  3KOW E;  3SAT A;  1QAM A;  1S3S A;  4JI3 M;  3KOY E;  4I4L A;  4I5S A;  2K47 A;  1IXR C;  3UK6 A;  1NNU C;  5KQD A;  4JXJ A;  3LVV A;  3HU3 A;  1L1T A;  4HLQ A;  4AG6 A;  4LGY A;  4FWD A;  3UGJ A;  2G5G X;  3HJS A;  4AZF A;  2UUB M;  4LZJ A;  2YFQ A;  2R45 A;  1IBL M;  2D7G A;  1QVR A;  3K8Z A;  4GIP A;  3WHL A;  4ITQ A;  3GP1 A;  4MGK E;  7CAT A;  1FJG M;  5EP3 A;  4WW0 A;  3KS8 A;  1T3T A;  2EUC A;  3QAU A;  4AW4 A;  3QWL A;  4Z6Y A;  3GRV A;  2BNK A;  2QP9 X;  3D8L A;  3SAW A;  3U6Q A;  5EXS A;  1UM8 A;  2HHH M;  2YNM D;  4XGI A;  4YY3 M;  3U6C A;  4RF1 A;  5KO3 A;  3GLI B;  1ZAE A;  3L29 A;  2DVW B;  3RFW A;  2Q2E B;  1SXJ A;  4M9X A;  4D81 A;  4FWG A;  3KDS E;  4Z8X A;  2UXC M;  4PT5 A;  4G4O A;  1NNJ A;  1KYI A;  2RGH A;  2DZO B;  1HQC A;  1R2Z A;  5EXX A;  3A45 A;  3GLH A;  1N77 A;  3D8B A;  2CHQ A;  2CV2 A;  4DV1 M;  4B7G A;  4NSR A;  2Z7J A;  3KVW A;  4MH0 E;  3GPP A;  1IN6 A;  3SHG B;  1DGB A;  1OFH A;  1XMO M;  4MGY E;  3GPU A;  1IXZ A;  3SMP A;  1G41 A;  5EP1 A;  2AHM A;  2XSZ A;  2L6O A;  2L7H A;  5ITQ A;  3I4V A;  4LY6 A;  4KO8 A;  4LJ9 A;  1WXQ A;  2P5T A;  2NQ8 C;  1GVN A;  1IBK M;  4XBO A;  1TH2 A;  2QEN A;  4IBD A;  3MK6 A;  4PDI A;  3SFZ A;  3JR4 A;  3KP1 E;  3GQ4 A;  3T15 A;  1J5E M;  1L2D A;  1QAN A;  4X65 M;  3TWL A;  3U6D A;  5F3W A;  2QBY B;  3EIH A;  1HR0 M;  2KA6 B;  1W5S A;  2EO2 A;  4IBF A;  4IBC A;  1R7R A;  3FYD A;  3RGP A;  2KEB A;  1MX0 A;  2RKO A;  1IQP A;  3HHX A;  3HJ8 A;  3VK7 A;  4NL4 H;  1PM5 A;  2R46 A;  4P16 A;  2QBY A;  3PFI A;  3PVS A;  3GLG B;  2LNH C;  1NVM A;  5FTN A;  4L78 A;  1IY1 A;  2FNA A;  2XF3 A;  4GKJ M;  5EXT A;  4GHL A;  4JI6 M;  4DR7 M;  1GL7 A;  3KW6 A;  1J09 A;  3ILK A;  3K92 A;  4I81 A;  4DV7 M;  4LF9 M;  5E6J A;  3U6P A;  3KSJ A;  5FTJ A;  5GKN A;  3GLG A;  2L09 A;  1IN4 A;  3J2P B;  2BJW A;  5LMU M;  4JI0 M;  3A46 A;  4BBA A;  3HHW A;  3U6L A;  4DR6 M;  4GMQ A;  4B3S M;  1QAQ A;  1QYR A;  1Q3B A;  2YR0 A;  4IBI A;  4A3V B;  4L16 A;  2I7N A;  4DR1 M;  2EA0 A;  5IRE B;  4OU7 A;  3HHZ A;  4REZ A;  5EXP A;  2ZAM A;  3AV0 A;  5A2Q S;  1L2B A;  4AQY M;  2CV1 A;  2FE8 A;  3VKH A;  1G3I A;  2ZBK B;  3HU1 A;  4CHT B;  5IWA M;  4IBK A;  1R6B X;  3PNY A;  1Z59 A;  3MJ5 A;  1DGG A;  5FTL A;  3SMS A;  4M0D A;  3VDP A;  3KXE C;  1E9S A;  4IIW A;  3JR5 A;  2KXE A;  1HT2 E;  1G59 A;  3DZD A;  1XNQ M;  1Z5C A;  4M9Z A;  4NXN M;  4OVZ A;  1EE8 A;  4QOZ C;  2Y0T A;  3U5Z B;  2I7P A;  3AJI B;  1G8P A;  3TE6 A;  3U6E A;  1DGF A;  1C1K A;  4FCW A;  3VK8 A;  3GLF B;  1L1Z A;  4LJ6 A;  3FKE A;  3FD9 A;  3HU2 A;  3U61 A;  4B3T M;  3FTD A;  3U60 B;  4B3M M;  2L7I A;  2R4E A;  3ZC7 B;  3GLH B;  2F5O A;  4FD2 A;  2W82 A;  1PJJ A;  1IBM M;  2KZU A;  4L4U A;  1XXH B;  4LJ8 A;  3AL0 C;  3CF2 A;  1IN5 A;  2HKJ A;  4GKK M;  1E32 A;  3E4R A;  5ITT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...