2M5ZA

Enterocin 7a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
GAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterocin JSA
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 7
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m5zA00
2M60A 2M5ZA
chains in the Genus database with same CATH superfamily
3W67A 4Z6YA 4KODA 1TR8A 4GRIA 4JXJA 3W0LB 2QBYA 2CP8A 3B7ZA 3ILKA 4GITA 5EXSA 3THGA 3SATA 4OX9M 3R9XB 1XXHA 4CIZA 5KQDA 2QBYB 2G5GX 3HGIA 3M6AA 4L78A 3FD9A 2CV0A 4DV6M 2YFQA 1XXHB 3KS4A 4QNRA 3UJNA 1N77A 3GPYA 2LVPC 2OO9A 1PRBA 3T1YM 3RGSA 2R46A 1XMOM 2F5SA 4DBGB 4JI6M 2R4EA 1TF0B 1GJTA 2JY7A 3KVWA 3U6MA 4FCWA 1Y8GA 2XZUA 2YR0A 1NHGC 3Q8XA 3VDPA 2LVAA 2F4VM 1VEGA 3VKHA 5DYGA 2OQ4A 2QENA 4DV5M 2KXEA 5ITTA 3CF6E 4I81A 3VKGA 3LQRA 1VDLA 2EO2A 4G3OA 4BB9A 1N36M 3U6EA 1W5TA 1HQCA 3K2LA 2GQFA 2X4AA 3HHXA 2JY6B 1PJTA 1G8PA 3PNVA 2XFSA 5EXXA 1NNUC 2UUBM 4LGMA 1MU5A 3A98B 2O01F 2FNAA 1HQYE 5GKNA 4LFBM 5EP4A 2V6ZM 1DV0A 2AHMA 1E94E 4L6V6 1NV9A 3KXEC 4MH0E 2F5NA 3TQSA 4KLNA 2LNHC 2LBCA 3GLHA 5IZ7D 3E4RA 3E9SA 1XB2B 3Q8GA 4GC5A 3GO8A 3U6QA 1C7YA 4QOZC 1UM8A 3QAUA 5ITQA 3JAMS 3GLHB 2APLA 4NRWA 2UUCM 1CUKA 1QZMA 3GRVA 3I4YA 1NNJA 3ZCBB 2MJ5B 5FLXS 3SAWA 3KOZE 2Z4SA 1N33M 2LHCA 3D8BA 2XFTA 3C9PA 3FE3A 1NV8A 2Z7JA 3HKPA 1OIPA 3ZH9B 2E5LM 1Z5BA 3CF0A 1D0KA 4NSRA 3B9PA 3SMSA 1EFUB 1IN4A 3JR5A 1OTRA 4ZPXA 2KW0A 2CHQA 1HNXM 1GJSA 4G4QA 1GL6A 2M60A 5IT9S 5DFLA 1EE8A 2HHHM 3LVWA 2R65A 3J27B 3HHWA 1Q02A 4FWDA 3OTOM 3B89A 3GLFA 1IBMM 5EP3A 2K9DA 3NBXX 4P16A 2O5RA 3KOYE 3GP1A 2I7NA 4B7FA 3GLIA 2JA2A 2M5ZA 3PFIA 3GLFB 1HT2E 4DR3M 3T38A 4JI3M 2C9OA 1E9SA 2YNMD 1OAOC 3BXWA 2F5PA 3U6DA 1JB0F 2DVWB 3GPXA 4LZZA 4B7HA 8CATA 4WP2A 2JP7A 4RF0A 5E6JA 5DYIA 3W68A 3WHLA 5KPZA 4DV4M 4L15A 2XLJA 2FE8A 1NJFA 4FWGA 3ZQJA 1WHCA 1IXSA 2J7OA 4GH9A 4LJ6A 4UN2B 4B3SM 2WZJA 5L8RF 3HJSA 4X66M 2FFJA 2R44A 3GPUA 1DGBA 2FH0A 3J2PB 4IBBA 2DZOB 3B74A 1L1ZA 1SXJC 3J80S 3IG5A 4DV3M 4RF1A 2ZAOA 1T43A 1ZMVA 5FTNA 4LJ7A 3A46A 1JR3E 1IBLM 4GIPA 2EKKA 2QNJA 1ZMUA 4JN6A 4IBGA 3FUUA 1IY2A 4D81A 3DZDA 3KFUG 4LJAA 1GO5A 2XGNA 1G59A 2GNOA 2NQ8C 1HJPA 1Z59A 4DR4M 4LGYA 1C1KA 4FCVA 2VQEM 4L8RC 3AOEC 5C1BA 4GC9A 4B3RM 3FYDA 3K1JA 3I51A 3M7GA 1IY0A 4LCBA 4B7GA 1XMQM 2G3QA 1DGHA 2C98A 3GQ4A 2ZANA 4F2LA 4A3VB 2DWZB 2Y0QA 1DGHB 1L1TA 2WSEF 4FWHA 4FCTA 4AKHA 2HL7A 2L7IA 3HHZA 2R6FA 3IG8A 2N35A 4FVMA 2HKJA 3E21A 4S12A 1EIJA 5JI2E 5EP2A 1RU3A 1Z5AA 3V76A 4BLCA 1IN7A 3MHVC 2UXCM 1N75A 1SG9A 4F1IA 3DA1A 1OAIA 2KNZA 4LJ8A 4PT5A 4IBKA 4AQYM 4X64M 1HT1E 1MN3A 4ANRA 2Z3XA 1V33A 4LJ5A 4M9ZA 4QHTA 2JZ0A 4D80A 4JV5M 4MB7A 2VDBB 1TTEA 3UZUA 1Q39A 1QZEA 4B3TM 3L28A 1WIVA 1QVRA 3FYCA 4IBIA 1R6BX 4LFCM 2QPAA 1IXRC 4CISA 5EQTA 2EUCA 4M0WA 1I4WA 2DHRA 2KEBA 2D7HA 2KRUA 1Z6TA 2H1RA 1G3IA 4OU7A 3U5ZA 1XWIA 1L2DA 4MGIE 1T3TA 1D0MA 1Q3CA 2DI0A 3LCVB 2CE7A 2CEAA 1V92A 1IM2A 3TWMA 2QHOB 3SAVA 2KHHA 2LTUA 4AZFA 1ZQ9A 1PJJA 2L6OA 3D8LA 4QOSA 2BWEA 2H5XA 1KYIA 5EJCA 4X65M 2EKFA 3LW5F 1K82A 3J7BA 3F92A 1IFYA 1NY5A 4IBJA 2VF7A 1E9RA 3SAUA 2G8LA 4YHHM 2XSZD 1L2BA 2ZAMA 4AKIA 2LVQD 1KSFX 4RNAA 1J7KA 3MMPA 1QUSA 2MGWA 3GQ5A 3GLGA 4DUZM 4XBOA 1D0LA 1SXJD 2C99A 4W5WA 1PM5A 5FTJA 4GKJM 4TUWA 3LMMA 3GLGB 4IBEA 1IY1A 3HJQA 4LJ4A 4LF9M 3A42A 1R2ZA 4CGYB 5KPRA 5ITXE 3FTEA 4DR7M 1AIPC 1LV7A 1OJLA 4WURA 4G4OA 2KNAA 1PJSA 5BPVA 1QDTA 2OOBA 3SC3A 2B3TA 1VG5A 1HNZM 2XEPA 2ZTDA 2Y21A 4G6ZA 4OW0A 1TH2A 3WHKA 1QANA 1VDDA 3GLIB 3R8FA 2R0IA 4B3MM 4IBCA 2QQ8A 4PCZA 3PVSA 2VF8A 3HHYA 1QQWA 3T1HM 2LXEA 2WSCF 1XXHE 2CV2A 4DV1M 4JI2M 5BR8M 1YSYA 5ITRA 1P3QQ 3E46A 3MK6A 3M0EA 1XNQM 2KZSA 1IXSB 1W5SA 3AKZA 4KHPM 2HAKA 2DWLA 4LF6M 3SFZA 1IN5A 5E26A 1NSFA 1ZAEA 1A5TA 1TH3A 3FUVA 1G41A 1JQJC 3DOAA 3I01M 1FNNA 4YY3M 2CWBA 1WJ7A 2UUAM 3BBZA 2CRUA 2L4FA 1YLAA 4NL4H 4EIWA 1GL7A 4D82A 2Z4RA 2EA0A 3IHPA 4GEWA 2VIIA 1DO0A 2XH9A 3TWKA 1WGNA 2JY5A 1X37A 2X8AA 1QUTA 4NSOB 4FW9A 5EP1A 1QAOA 1PJQA 2VQFM 4RKUF 2BJWA 3HY5A 1PJIA 1OFHA 3CTWB 2DAGA 3HJ8A 2DNAA 3RE8A 3I04M 3C58A 4M0DA 2DWMA 4NXNM 2D7GA 3PXGA 3L25A 4MGYE 4AI6A 4II7A 1MJGM 1PGYA 2MROB 3HZJA 3B7NA 5FTLA 4LRSA 3VK8A 3AFHA 3H4JA 1GABA 4OVZA 3U6CA 2L2DA 4PDGA 3UGJA 1DGGA 2KDLA 2YQZA 4MGKE 2XSZA 2QZ4A 3J7AS 3QYEA 5EXTA 3GPPA 3KOXE 1F4IA 2ERCA 2DAKA 3FUTA 1FJGM 4JYAM 1XNRM 3FTCA 2Y0TA 3ZC7B 1SXJA 5FTKA 3GLHE 2XZFA 4HEOA 4X62M 1K3WA 4GMQA 1QYRA 3PNYA 1J09A 1ZMWA 3DFZA 1SXJB 3U60A 1DGFA 1VEJA 1IN6A 2XF3A 2UU9M 2DWNA 4HLQA 3B7QA 1G4AE 3U60B 2DKLA 4P17A 4I4LA 2L09A 4I5SA 4CHTB 3VDUA 2O25A 3KP0E 4M9XA 4PDIA 4IJFA 3AOEA 3C3EA 5FTMA 1QAMA 3EIEA 3U61A 2A5YB 2C96A 2F5QA 2LHGA 2R4JA 3SMPA 2P5TA 3TPZA 1D2NA 1E32A 3A45A 3GLGE 3U6SA 1TDZA 3U61B 4LZJA 3J81S 1NHWC 3IECA 1T6OA 2C5RA 2JNHA 3SYKA 2L7HA 1OKSA 2RKOA 1G71A 2ZBKB 1Q3BA 3HWSA 5KO3A 3K92A 4FD2A 3C3DA 2LH0A 3AL0C 2UXBM 1N32M 3L26A 4QHSA 2R18A 2J7NA 1JR3A 2R45A 3AJIB 4R71A 4JI7M 2UXDM 3RGPA 4L16A 3GLFE 4NC6A 3LQQA 4XK8F 1R5LA 2DENA 2K6BA 2L4EA 4LJ9A 4MGZE 4Q7JA 3GLIE 5EXPA 3U5ZB 4JI8M 3K9OA 1XHBA 1NVMA 4B08A 1OIZA 4DV7M 3K9PA 3GQ3A 1MX0A 3VFDA 4REZA 3VLFB 4WW0A 2JY8A 2QCUA 3QWLA 3W0FA 4HL4A 2JUJA 3T6PA 1AUAA 3U6PA 2KNVA 2JWSA 4CJ6A 7CATA 2X49A 2KZUA 2CHGA 3QYBA 2ZM6M 3HX3A 1Z5CA 4GHAA 3FKEA 4KO8A 2K47A 3FRIA 3I4VA 3GRRA 1TH4A 4NXMM 1GKIA 1H6UA 2F5OA 2ZTCA 1UFZA 3FTFA 2DZLA 2V1CA 2RGHA 1ZV1A 2CUZA 4JI4M 1GVNA 5ITYA 4LF7M 1IN8A 4NRVA 2HWJA 4K0KM 4AW4A 1QDRA 2FOIC 3TWLA 2CHVA 1R4GA 3SHFA 4AKGA 3NBIA 3HU2A 5F3WA 3LVVA 4JI0M 1IBKM 4G4RA 2QP9X 1TGUA 2MH8A 3RFWA 2BWBA 5IWAM 4PD2A 1QAQA 1K3XA 4DR5M 4IBDA 2EJSA 2R62A 4DV2M 4I8OA 3VK7A 1TDHA 3HU3A 3TE6A 5ITUA 2OOAA 4LFAM 3UK6A 1WR1B 3U6LA 4R3DA 2Z8YM 3FUXA 5LMUM 4DR6M 1I94M 1DO2A 2JXNA 2RRUA 2W82A 2V1UA 3L27A 2DXIA 4IIWA 2MR9A 3BOSA 3AOGA 4AG5A 4IJEA 3NWLA 3KOWE 1OFIA 4L4UA 1NJGA 3FTDA 4R7GA 5C18A 3SBJA 3GRUA 1S3SA 1L2CA 1YE9A 3FRHA 3KS8A 2LWXA 4NOOB 3KP1E 2HCBA 1JR3D 3SHGB 1VQ1A 1SXJE 3TL4X 3KDSE 3SASA 1J5EM 2OPFA 2FS1A 2CV1A 4DV0M 2DZNB 2QSFX 3KW6A 1R2YA 2LVNC 4QNMA 3CGWA 5KQ8A 1LTMA 1IQPA 3CF2A 5IREB 1KFVA 4GKKM 3SARA 1WXQA 3HU1A 2D7EA 3UMMA 1GLNA 1VEKA 4LF5M 2DHYA 2DAIA 3U6OA 1NO1A 4LY6A 1WGLA 5FSWA 2C9CA 1OQYA 1YUBA 4MGHA 3JR4A 1N78A 2I7PA 1N34M 2Y20A 4LG2A 3EIHA 2DAEA 2WSFF 3KSXA 1XC8A 1HNWM 3H4MA 4Y28F 2K0BX 4LF4M 2Q2EB 2KA6B 5A2QS 4LRTA 2BJVA 4DR1M 1BVSA 4IBFA 4MM3B 4GHLA 4ITQA 1V34A 5JI3E 1ORYB 3GRYA 4XGIA 3SYLA 4DR2M 1IXZA 4OVZB 4DUYM 2JZ1A 5KPTA 1L8QA 2J5YA 3AV0A 5ITXA 3MJ5A 5H37D 1NY6A 3L2AA 5DNYA 4KT0F 2DAMA 4G4NA 2CFOA 3FUWA 4LF8M 3L29A 1HR0M 2LVOC 3KSJA 1R7RA 4BBAA 4M9SA 4JI5M 5LMNM 4AG6A 2RGOA 3T15A 2KRKA 4JI1M 2BNKA 3K8ZA 4Z8XA 3LCUA
chains in the Genus database with same CATH topology
4Z6YA 4KODA 4JXJA 4GRIA 3W0LB 2QBYA 3ILKA 3THGA 4GITA 5EXSA 3SATA 4OX9M 3R9XB 1XXHA 5KQDA 2QBYB 2G5GX 3HGIA 3M6AA 4L78A 3FD9A 2CV0A 4DV6M 2YFQA 1XXHB 3KS4A 4QNRA 3UJNA 1N77A 3GPYA 3T1YM 3RGSA 2R46A 1XMOM 2F5SA 4JI6M 2R4EA 3U6MA 3KVWA 4FCWA 2XZUA 2YR0A 1NHGC 3Q8XA 3VDPA 2F4VM 3VKHA 5DYGA 2OQ4A 2QENA 4DV5M 2KXEA 5ITTA 3CF6E 4I81A 3VKGA 3LQRA 2EO2A 4BB9A 1N36M 3U6EA 1W5TA 1HQCA 3K2LA 3HHXA 2X4AA 1G8PA 3PNVA 2XFSA 5EXXA 1NNUC 2UUBM 4LGMA 1MU5A 3A98B 2FNAA 1HQYE 5GKNA 4LFBM 5EP4A 2V6ZM 2AHMA 1E94E 3KXEC 4MH0E 2F5NA 3TQSA 4KLNA 2LNHC 3GLHA 5IZ7D 3E4RA 3E9SA 4GC5A 3U6QA 3GO8A 4QOZC 1UM8A 3QAUA 5ITQA 3JAMS 3GLHB 4NRWA 2UUCM 1QZMA 3GRVA 3I4YA 1NNJA 3ZCBB 5FLXS 3SAWA 3KOZE 2Z4SA 1N33M 3D8BA 2XFTA 3HKPA 2Z7JA 3ZH9B 2E5LM 1Z5BA 3CF0A 4NSRA 3B9PA 3SMSA 1IN4A 3JR5A 4ZPXA 2KW0A 2CHQA 1HNXM 4G4QA 1GL6A 2M60A 5IT9S 1EE8A 2HHHM 3LVWA 2R65A 3J27B 3HHWA 4FWDA 3OTOM 3GLFA 1IBMM 5EP3A 4P16A 2O5RA 3KOYE 3GP1A 2I7NA 4B7FA 3GLIA 2JA2A 2M5ZA 3PFIA 3GLFB 1HT2E 4DR3M 3T38A 4JI3M 2C9OA 1E9SA 2YNMD 2F5PA 3U6DA 2DVWB 3GPXA 4LZZA 4B7HA 8CATA 4RF0A 5E6JA 5DYIA 3WHLA 5KPZA 4DV4M 4L15A 2XLJA 2FE8A 1NJFA 4FWGA 2J7OA 4GH9A 4LJ6A 4B3SM 3HJSA 4X66M 2FFJA 3GPUA 1DGBA 3J2PB 4IBBA 1L1ZA 2DZOB 1SXJC 3J80S 3IG5A 4DV3M 4RF1A 2ZAOA 5FTNA 4LJ7A 3A46A 1IBLM 4GIPA 4JN6A 4IBGA 3FUUA 1IY2A 4D81A 3DZDA 3KFUG 4LJAA 2XGNA 1G59A 2NQ8C 1Z59A 4DR4M 4LGYA 1C1KA 4FCVA 2VQEM 4L8RC 3AOEC 5C1BA 4GC9A 4B3RM 3FYDA 3K1JA 3I51A 3M7GA 1IY0A 4LCBA 4B7GA 1XMQM 1DGHA 2C98A 3GQ4A 2ZANA 4A3VB 2DWZB 2Y0QA 1DGHB 1L1TA 4FWHA 4FCTA 4AKHA 2HL7A 2L7IA 3HHZA 3IG8A 4FVMA 2HKJA 4S12A 5JI2E 5EP2A 1Z5AA 4BLCA 1IN7A 3MHVC 2UXCM 1N75A 3DA1A 4LJ8A 4PT5A 4IBKA 4AQYM 4X64M 1HT1E 2Z3XA 4LJ5A 4M9ZA 4QHTA 4D80A 4JV5M 4MB7A 3UZUA 4B3TM 1Q39A 3L28A 1QVRA 3FYCA 4IBIA 1R6BX 4LFCM 2QPAA 1IXRC 4CISA 5EQTA 2EUCA 4M0WA 1I4WA 2DHRA 2KEBA 2D7HA 2KRUA 1Z6TA 2H1RA 1G3IA 4OU7A 3U5ZA 1XWIA 1L2DA 4MGIE 1T3TA 1Q3CA 2CE7A 2CEAA 1IM2A 3TWMA 3SAVA 4AZFA 1ZQ9A 1PJJA 2L6OA 3D8LA 4QOSA 4X65M 5EJCA 1KYIA 1K82A 3J7BA 1NY5A 4IBJA 1E9RA 3SAUA 2G8LA 4YHHM 2XSZD 1L2BA 2ZAMA 4AKIA 1KSFX 4RNAA 1J7KA 3GQ5A 3GLGA 4DUZM 4XBOA 1SXJD 2C99A 4W5WA 1PM5A 5FTJA 4GKJM 4TUWA 3LMMA 3GLGB 4IBEA 1IY1A 3HJQA 4LJ4A 4LF9M 3A42A 1R2ZA 4CGYB 5KPRA 5ITXE 3FTEA 4DR7M 1LV7A 1OJLA 4WURA 4G4OA 5BPVA 3SC3A 1HNZM 2XEPA 2Y21A 4G6ZA 4OW0A 1TH2A 3WHKA 1QANA 1VDDA 3GLIB 3R8FA 4B3MM 4IBCA 4PCZA 3PVSA 3HHYA 1QQWA 3T1HM 2LXEA 2CV2A 4DV1M 4JI2M 5BR8M 1YSYA 5ITRA 3MK6A 3M0EA 1XNQM 2KZSA 1IXSB 1W5SA 3AKZA 4KHPM 2DWLA 4LF6M 3SFZA 1IN5A 5E26A 1NSFA 1ZAEA 1TH3A 3FUVA 4YY3M 1G41A 1JQJC 3DOAA 1FNNA 2UUAM 4NL4H 4EIWA 1GL7A 4D82A 2Z4RA 2EA0A 2VIIA 1DO0A 2XH9A 3TWKA 5EP1A 2X8AA 1X37A 4NSOB 4FW9A 1QAOA 2VQFM 1PJIA 2BJWA 1OFHA 3CTWB 3HJ8A 3RE8A 3C58A 4M0DA 2DWMA 4NXNM 2D7GA 3PXGA 3L25A 4MGYE 4AI6A 4II7A 5FTLA 4LRSA 3VK8A 3AFHA 4OVZA 3U6CA 4PDGA 3UGJA 1DGGA 4MGKE 2YQZA 2XSZA 2QZ4A 3J7AS 5EXTA 3GPPA 3KOXE 2ERCA 3FUTA 1FJGM 4JYAM 1XNRM 3FTCA 2Y0TA 3ZC7B 1SXJA 5FTKA 2XZFA 4X62M 1K3WA 4GMQA 1QYRA 3PNYA 1J09A 3DFZA 1SXJB 3U60A 1DGFA 1IN6A 2XF3A 2UU9M 2DWNA 4HLQA 3U60B 1G4AE 4I4LA 2L09A 4I5SA 4CHTB 3VDUA 3KP0E 4M9XA 4PDIA 4IJFA 3AOEA 5FTMA 1QAMA 3EIEA 3U61A 2A5YB 2C96A 2F5QA 2R4JA 3SMPA 2P5TA 3TPZA 1D2NA 1E32A 3A45A 3U6SA 1TDZA 3U61B 4LZJA 3J81S 1NHWC 2C5RA 3SYKA 2L7HA 2RKOA 3HWSA 2ZBKB 1Q3BA 5KO3A 4FD2A 2LH0A 3AL0C 2UXBM 1N32M 3L26A 4QHSA 2R18A 2J7NA 1JR3A 2R45A 3AJIB 2UXDM 4JI7M 3RGPA 4L16A 3LQQA 4MGZE 4LJ9A 3U5ZB 4JI8M 5EXPA 1XHBA 1NVMA 4B08A 4DV7M 3GQ3A 1MX0A 3VFDA 4REZA 3VLFB 4WW0A 2QCUA 3QWLA 3W0FA 4HL4A 3U6PA 7CATA 2X49A 2KZUA 2CHGA 2ZM6M 1Z5CA 4GHAA 3FKEA 4KO8A 2K47A 4NXMM 3I4VA 3GRRA 1TH4A 1GKIA 1H6UA 2F5OA 3FTFA 2V1CA 2RGHA 4JI4M 2CUZA 4LF7M 1GVNA 5ITYA 1IN8A 4NRVA 4K0KM 4AW4A 2FOIC 3TWLA 2CHVA 3SHFA 4AKGA 3NBIA 3HU2A 5F3WA 3LVVA 4JI0M 1IBKM 4G4RA 2QP9X 1TGUA 3RFWA 5IWAM 4PD2A 1QAQA 1K3XA 4DR5M 4IBDA 2R62A 4DV2M 4I8OA 3VK7A 1TDHA 3HU3A 3TE6A 5ITUA 3UK6A 4LFAM 3U6LA 4R3DA 3K8ZA 3FUXA 5LMUM 4DR6M 1I94M 1DO2A 2W82A 2V1UA 3L27A 2DXIA 4IIWA 3BOSA 3AOGA 4AG5A 4IJEA 3NWLA 3KOWE 1OFIA 4L4UA 1NJGA 3FTDA 4R7GA 5C18A 3SBJA 3GRUA 1S3SA 1L2CA 1YE9A 3KS8A 2LWXA 4NOOB 3KP1E 2HCBA 1JR3D 3SHGB 1SXJE 3TL4X 3KDSE 3SASA 1J5EM 2OPFA 2CV1A 4DV0M 2DZNB 3KW6A 1R2YA 4QNMA 5KQ8A 1IQPA 3CF2A 5IREB 1KFVA 4GKKM 3SARA 1WXQA 3HU1A 2D7EA 3UMMA 1GLNA 4LF5M 3U6OA 4LY6A 5FSWA 2C9CA 1YUBA 4MGHA 3JR4A 1N78A 2I7PA 1N34M 2Y20A 4LG2A 3EIHA 3KSXA 1XC8A 1HNWM 3H4MA 4LF4M 2Q2EB 2KA6B 5A2QS 4LRTA 2BJVA 4DR1M 4MM3B 4IBFA 4GHLA 4ITQA 5JI3E 1ORYB 3GRYA 4XGIA 3SYLA 4DR2M 1IXZA 4OVZB 4DUYM 5KPTA 1L8QA 3AV0A 5ITXA 5H37D 3MJ5A 1NY6A 3L2AA 5DNYA 4G4NA 2CFOA 3FUWA 4LF8M 3L29A 1HR0M 4BBAA 3KSJA 1R7RA 4JI5M 4M9SA 5LMNM 4AG6A 2RGOA 3T15A 2KRKA 4JI1M 2BNKA 3K92A 4Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M60 A;  2M5Z A; 
#chains in the Genus database with same CATH topology
 3W67 A;  4Z6Y A;  4KOD A;  1TR8 A;  4GRI A;  4JXJ A;  3W0L B;  2QBY A;  2CP8 A;  3B7Z A;  3ILK A;  4GIT A;  5EXS A;  3THG A;  3SAT A;  4OX9 M;  3R9X B;  1XXH A;  4CIZ A;  5KQD A;  2QBY B;  2G5G X;  3HGI A;  3M6A A;  4L78 A;  3FD9 A;  2CV0 A;  4DV6 M;  2YFQ A;  1XXH B;  3KS4 A;  4QNR A;  3UJN A;  1N77 A;  3GPY A;  2LVP C;  2OO9 A;  1PRB A;  3T1Y M;  3RGS A;  2R46 A;  1XMO M;  2F5S A;  4DBG B;  4JI6 M;  2R4E A;  1TF0 B;  1GJT A;  2JY7 A;  3KVW A;  3U6M A;  4FCW A;  1Y8G A;  2XZU A;  2YR0 A;  1NHG C;  3Q8X A;  3VDP A;  2LVA A;  2F4V M;  1VEG A;  3VKH A;  5DYG A;  2OQ4 A;  2QEN A;  4DV5 M;  2KXE A;  5ITT A;  3CF6 E;  4I81 A;  3VKG A;  3LQR A;  1VDL A;  2EO2 A;  4G3O A;  4BB9 A;  1N36 M;  3U6E A;  1W5T A;  1HQC A;  3K2L A;  2GQF A;  2X4A A;  3HHX A;  2JY6 B;  1PJT A;  1G8P A;  3PNV A;  2XFS A;  5EXX A;  1NNU C;  2UUB M;  4LGM A;  1MU5 A;  3A98 B;  2O01 F;  2FNA A;  1HQY E;  5GKN A;  4LFB M;  5EP4 A;  2V6Z M;  1DV0 A;  2AHM A;  1E94 E;  4L6V 6;  1NV9 A;  3KXE C;  4MH0 E;  2F5N A;  3TQS A;  4KLN A;  2LNH C;  2LBC A;  3GLH A;  5IZ7 D;  3E4R A;  3E9S A;  1XB2 B;  3Q8G A;  4GC5 A;  3GO8 A;  3U6Q A;  1C7Y A;  4QOZ C;  1UM8 A;  3QAU A;  5ITQ A;  3JAM S;  3GLH B;  2APL A;  4NRW A;  2UUC M;  1CUK A;  1QZM A;  3GRV A;  3I4Y A;  1NNJ A;  3ZCB B;  2MJ5 B;  5FLX S;  3SAW A;  3KOZ E;  2Z4S A;  1N33 M;  2LHC A;  3D8B A;  2XFT A;  3C9P A;  3FE3 A;  1NV8 A;  2Z7J A;  3HKP A;  1OIP A;  3ZH9 B;  2E5L M;  1Z5B A;  3CF0 A;  1D0K A;  4NSR A;  3B9P A;  3SMS A;  1EFU B;  1IN4 A;  3JR5 A;  1OTR A;  4ZPX A;  2KW0 A;  2CHQ A;  1HNX M;  1GJS A;  4G4Q A;  1GL6 A;  2M60 A;  5IT9 S;  5DFL A;  1EE8 A;  2HHH M;  3LVW A;  2R65 A;  3J27 B;  3HHW A;  1Q02 A;  4FWD A;  3OTO M;  3B89 A;  3GLF A;  1IBM M;  5EP3 A;  2K9D A;  3NBX X;  4P16 A;  2O5R A;  3KOY E;  3GP1 A;  2I7N A;  4B7F A;  3GLI A;  2JA2 A;  2M5Z A;  3PFI A;  3GLF B;  1HT2 E;  4DR3 M;  3T38 A;  4JI3 M;  2C9O A;  1E9S A;  2YNM D;  1OAO C;  3BXW A;  2F5P A;  3U6D A;  1JB0 F;  2DVW B;  3GPX A;  4LZZ A;  4B7H A;  8CAT A;  4WP2 A;  2JP7 A;  4RF0 A;  5E6J A;  5DYI A;  3W68 A;  3WHL A;  5KPZ A;  4DV4 M;  4L15 A;  2XLJ A;  2FE8 A;  1NJF A;  4FWG A;  3ZQJ A;  1WHC A;  1IXS A;  2J7O A;  4GH9 A;  4LJ6 A;  4UN2 B;  4B3S M;  2WZJ A;  5L8R F;  3HJS A;  4X66 M;  2FFJ A;  2R44 A;  3GPU A;  1DGB A;  2FH0 A;  3J2P B;  4IBB A;  2DZO B;  3B74 A;  1L1Z A;  1SXJ C;  3J80 S;  3IG5 A;  4DV3 M;  4RF1 A;  2ZAO A;  1T43 A;  1ZMV A;  5FTN A;  4LJ7 A;  3A46 A;  1JR3 E;  1IBL M;  4GIP A;  2EKK A;  2QNJ A;  1ZMU A;  4JN6 A;  4IBG A;  3FUU A;  1IY2 A;  4D81 A;  3DZD A;  3KFU G;  4LJA A;  1GO5 A;  2XGN A;  1G59 A;  2GNO A;  2NQ8 C;  1HJP A;  1Z59 A;  4DR4 M;  4LGY A;  1C1K A;  4FCV A;  2VQE M;  4L8R C;  3AOE C;  5C1B A;  4GC9 A;  4B3R M;  3FYD A;  3K1J A;  3I51 A;  3M7G A;  1IY0 A;  4LCB A;  4B7G A;  1XMQ M;  2G3Q A;  1DGH A;  2C98 A;  3GQ4 A;  2ZAN A;  4F2L A;  4A3V B;  2DWZ B;  2Y0Q A;  1DGH B;  1L1T A;  2WSE F;  4FWH A;  4FCT A;  4AKH A;  2HL7 A;  2L7I A;  3HHZ A;  2R6F A;  3IG8 A;  2N35 A;  4FVM A;  2HKJ A;  3E21 A;  4S12 A;  1EIJ A;  5JI2 E;  5EP2 A;  1RU3 A;  1Z5A A;  3V76 A;  4BLC A;  1IN7 A;  3MHV C;  2UXC M;  1N75 A;  1SG9 A;  4F1I A;  3DA1 A;  1OAI A;  2KNZ A;  4LJ8 A;  4PT5 A;  4IBK A;  4AQY M;  4X64 M;  1HT1 E;  1MN3 A;  4ANR A;  2Z3X A;  1V33 A;  4LJ5 A;  4M9Z A;  4QHT A;  2JZ0 A;  4D80 A;  4JV5 M;  4MB7 A;  2VDB B;  1TTE A;  3UZU A;  1Q39 A;  1QZE A;  4B3T M;  3L28 A;  1WIV A;  1QVR A;  3FYC A;  4IBI A;  1R6B X;  4LFC M;  2QPA A;  1IXR C;  4CIS A;  5EQT A;  2EUC A;  4M0W A;  1I4W A;  2DHR A;  2KEB A;  2D7H A;  2KRU A;  1Z6T A;  2H1R A;  1G3I A;  4OU7 A;  3U5Z A;  1XWI A;  1L2D A;  4MGI E;  1T3T A;  1D0M A;  1Q3C A;  2DI0 A;  3LCV B;  2CE7 A;  2CEA A;  1V92 A;  1IM2 A;  3TWM A;  2QHO B;  3SAV A;  2KHH A;  2LTU A;  4AZF A;  1ZQ9 A;  1PJJ A;  2L6O A;  3D8L A;  4QOS A;  2BWE A;  2H5X A;  1KYI A;  5EJC A;  4X65 M;  2EKF A;  3LW5 F;  1K82 A;  3J7B A;  3F92 A;  1IFY A;  1NY5 A;  4IBJ A;  2VF7 A;  1E9R A;  3SAU A;  2G8L A;  4YHH M;  2XSZ D;  1L2B A;  2ZAM A;  4AKI A;  2LVQ D;  1KSF X;  4RNA A;  1J7K A;  3MMP A;  1QUS A;  2MGW A;  3GQ5 A;  3GLG A;  4DUZ M;  4XBO A;  1D0L A;  1SXJ D;  2C99 A;  4W5W A;  1PM5 A;  5FTJ A;  4GKJ M;  4TUW A;  3LMM A;  3GLG B;  4IBE A;  1IY1 A;  3HJQ A;  4LJ4 A;  4LF9 M;  3A42 A;  1R2Z A;  4CGY B;  5KPR A;  5ITX E;  3FTE A;  4DR7 M;  1AIP C;  1LV7 A;  1OJL A;  4WUR A;  4G4O A;  2KNA A;  1PJS A;  5BPV A;  1QDT A;  2OOB A;  3SC3 A;  2B3T A;  1VG5 A;  1HNZ M;  2XEP A;  2ZTD A;  2Y21 A;  4G6Z A;  4OW0 A;  1TH2 A;  3WHK A;  1QAN A;  1VDD A;  3GLI B;  3R8F A;  2R0I A;  4B3M M;  4IBC A;  2QQ8 A;  4PCZ A;  3PVS A;  2VF8 A;  3HHY A;  1QQW A;  3T1H M;  2LXE A;  2WSC F;  1XXH E;  2CV2 A;  4DV1 M;  4JI2 M;  5BR8 M;  1YSY A;  5ITR A;  1P3Q Q;  3E46 A;  3MK6 A;  3M0E A;  1XNQ M;  2KZS A;  1IXS B;  1W5S A;  3AKZ A;  4KHP M;  2HAK A;  2DWL A;  4LF6 M;  3SFZ A;  1IN5 A;  5E26 A;  1NSF A;  1ZAE A;  1A5T A;  1TH3 A;  3FUV A;  1G41 A;  1JQJ C;  3DOA A;  3I01 M;  1FNN A;  4YY3 M;  2CWB A;  1WJ7 A;  2UUA M;  3BBZ A;  2CRU A;  2L4F A;  1YLA A;  4NL4 H;  4EIW A;  1GL7 A;  4D82 A;  2Z4R A;  2EA0 A;  3IHP A;  4GEW A;  2VII A;  1DO0 A;  2XH9 A;  3TWK A;  1WGN A;  2JY5 A;  1X37 A;  2X8A A;  1QUT A;  4NSO B;  4FW9 A;  5EP1 A;  1QAO A;  1PJQ A;  2VQF M;  4RKU F;  2BJW A;  3HY5 A;  1PJI A;  1OFH A;  3CTW B;  2DAG A;  3HJ8 A;  2DNA A;  3RE8 A;  3I04 M;  3C58 A;  4M0D A;  2DWM A;  4NXN M;  2D7G A;  3PXG A;  3L25 A;  4MGY E;  4AI6 A;  4II7 A;  1MJG M;  1PGY A;  2MRO B;  3HZJ A;  3B7N A;  5FTL A;  4LRS A;  3VK8 A;  3AFH A;  3H4J A;  1GAB A;  4OVZ A;  3U6C A;  2L2D A;  4PDG A;  3UGJ A;  1DGG A;  2KDL A;  2YQZ A;  4MGK E;  2XSZ A;  2QZ4 A;  3J7A S;  3QYE A;  5EXT A;  3GPP A;  3KOX E;  1F4I A;  2ERC A;  2DAK A;  3FUT A;  1FJG M;  4JYA M;  1XNR M;  3FTC A;  2Y0T A;  3ZC7 B;  1SXJ A;  5FTK A;  3GLH E;  2XZF A;  4HEO A;  4X62 M;  1K3W A;  4GMQ A;  1QYR A;  3PNY A;  1J09 A;  1ZMW A;  3DFZ A;  1SXJ B;  3U60 A;  1DGF A;  1VEJ A;  1IN6 A;  2XF3 A;  2UU9 M;  2DWN A;  4HLQ A;  3B7Q A;  1G4A E;  3U60 B;  2DKL A;  4P17 A;  4I4L A;  2L09 A;  4I5S A;  4CHT B;  3VDU A;  2O25 A;  3KP0 E;  4M9X A;  4PDI A;  4IJF A;  3AOE A;  3C3E A;  5FTM A;  1QAM A;  3EIE A;  3U61 A;  2A5Y B;  2C96 A;  2F5Q A;  2LHG A;  2R4J A;  3SMP A;  2P5T A;  3TPZ A;  1D2N A;  1E32 A;  3A45 A;  3GLG E;  3U6S A;  1TDZ A;  3U61 B;  4LZJ A;  3J81 S;  1NHW C;  3IEC A;  1T6O A;  2C5R A;  2JNH A;  3SYK A;  2L7H A;  1OKS A;  2RKO A;  1G71 A;  2ZBK B;  1Q3B A;  3HWS A;  5KO3 A;  3K92 A;  4FD2 A;  3C3D A;  2LH0 A;  3AL0 C;  2UXB M;  1N32 M;  3L26 A;  4QHS A;  2R18 A;  2J7N A;  1JR3 A;  2R45 A;  3AJI B;  4R71 A;  4JI7 M;  2UXD M;  3RGP A;  4L16 A;  3GLF E;  4NC6 A;  3LQQ A;  4XK8 F;  1R5L A;  2DEN A;  2K6B A;  2L4E A;  4LJ9 A;  4MGZ E;  4Q7J A;  3GLI E;  5EXP A;  3U5Z B;  4JI8 M;  3K9O A;  1XHB A;  1NVM A;  4B08 A;  1OIZ A;  4DV7 M;  3K9P A;  3GQ3 A;  1MX0 A;  3VFD A;  4REZ A;  3VLF B;  4WW0 A;  2JY8 A;  2QCU A;  3QWL A;  3W0F A;  4HL4 A;  2JUJ A;  3T6P A;  1AUA A;  3U6P A;  2KNV A;  2JWS A;  4CJ6 A;  7CAT A;  2X49 A;  2KZU A;  2CHG A;  3QYB A;  2ZM6 M;  3HX3 A;  1Z5C A;  4GHA A;  3FKE A;  4KO8 A;  2K47 A;  3FRI A;  3I4V A;  3GRR A;  1TH4 A;  4NXM M;  1GKI A;  1H6U A;  2F5O A;  2ZTC A;  1UFZ A;  3FTF A;  2DZL A;  2V1C A;  2RGH A;  1ZV1 A;  2CUZ A;  4JI4 M;  1GVN A;  5ITY A;  4LF7 M;  1IN8 A;  4NRV A;  2HWJ A;  4K0K M;  4AW4 A;  1QDR A;  2FOI C;  3TWL A;  2CHV A;  1R4G A;  3SHF A;  4AKG A;  3NBI A;  3HU2 A;  5F3W A;  3LVV A;  4JI0 M;  1IBK M;  4G4R A;  2QP9 X;  1TGU A;  2MH8 A;  3RFW A;  2BWB A;  5IWA M;  4PD2 A;  1QAQ A;  1K3X A;  4DR5 M;  4IBD A;  2EJS A;  2R62 A;  4DV2 M;  4I8O A;  3VK7 A;  1TDH A;  3HU3 A;  3TE6 A;  5ITU A;  2OOA A;  4LFA M;  3UK6 A;  1WR1 B;  3U6L A;  4R3D A;  2Z8Y M;  3FUX A;  5LMU M;  4DR6 M;  1I94 M;  1DO2 A;  2JXN A;  2RRU A;  2W82 A;  2V1U A;  3L27 A;  2DXI A;  4IIW A;  2MR9 A;  3BOS A;  3AOG A;  4AG5 A;  4IJE A;  3NWL A;  3KOW E;  1OFI A;  4L4U A;  1NJG A;  3FTD A;  4R7G A;  5C18 A;  3SBJ A;  3GRU A;  1S3S A;  1L2C A;  1YE9 A;  3FRH A;  3KS8 A;  2LWX A;  4NOO B;  3KP1 E;  2HCB A;  1JR3 D;  3SHG B;  1VQ1 A;  1SXJ E;  3TL4 X;  3KDS E;  3SAS A;  1J5E M;  2OPF A;  2FS1 A;  2CV1 A;  4DV0 M;  2DZN B;  2QSF X;  3KW6 A;  1R2Y A;  2LVN C;  4QNM A;  3CGW A;  5KQ8 A;  1LTM A;  1IQP A;  3CF2 A;  5IRE B;  1KFV A;  4GKK M;  3SAR A;  1WXQ A;  3HU1 A;  2D7E A;  3UMM A;  1GLN A;  1VEK A;  4LF5 M;  2DHY A;  2DAI A;  3U6O A;  1NO1 A;  4LY6 A;  1WGL A;  5FSW A;  2C9C A;  1OQY A;  1YUB A;  4MGH A;  3JR4 A;  1N78 A;  2I7P A;  1N34 M;  2Y20 A;  4LG2 A;  3EIH A;  2DAE A;  2WSF F;  3KSX A;  1XC8 A;  1HNW M;  3H4M A;  4Y28 F;  2K0B X;  4LF4 M;  2Q2E B;  2KA6 B;  5A2Q S;  4LRT A;  2BJV A;  4DR1 M;  1BVS A;  4IBF A;  4MM3 B;  4GHL A;  4ITQ A;  1V34 A;  5JI3 E;  1ORY B;  3GRY A;  4XGI A;  3SYL A;  4DR2 M;  1IXZ A;  4OVZ B;  4DUY M;  2JZ1 A;  5KPT A;  1L8Q A;  2J5Y A;  3AV0 A;  5ITX A;  3MJ5 A;  5H37 D;  1NY6 A;  3L2A A;  5DNY A;  4KT0 F;  2DAM A;  4G4N A;  2CFO A;  3FUW A;  4LF8 M;  3L29 A;  1HR0 M;  2LVO C;  3KSJ A;  1R7R A;  4BBA A;  4M9S A;  4JI5 M;  5LMN M;  4AG6 A;  2RGO A;  3T15 A;  2KRK A;  4JI1 M;  2BNK A;  3K8Z A;  4Z8X A;  3LCU A; 
#chains in the Genus database with same CATH homology
 4Z6Y A;  4KOD A;  4JXJ A;  4GRI A;  3W0L B;  2QBY A;  3ILK A;  3THG A;  4GIT A;  5EXS A;  3SAT A;  4OX9 M;  3R9X B;  1XXH A;  5KQD A;  2QBY B;  2G5G X;  3HGI A;  3M6A A;  4L78 A;  3FD9 A;  2CV0 A;  4DV6 M;  2YFQ A;  1XXH B;  3KS4 A;  4QNR A;  3UJN A;  1N77 A;  3GPY A;  3T1Y M;  3RGS A;  2R46 A;  1XMO M;  2F5S A;  4JI6 M;  2R4E A;  3U6M A;  3KVW A;  4FCW A;  2XZU A;  2YR0 A;  1NHG C;  3Q8X A;  3VDP A;  2F4V M;  3VKH A;  5DYG A;  2OQ4 A;  2QEN A;  4DV5 M;  2KXE A;  5ITT A;  3CF6 E;  4I81 A;  3VKG A;  3LQR A;  2EO2 A;  4BB9 A;  1N36 M;  3U6E A;  1W5T A;  1HQC A;  3K2L A;  3HHX A;  2X4A A;  1G8P A;  3PNV A;  2XFS A;  5EXX A;  1NNU C;  2UUB M;  4LGM A;  1MU5 A;  3A98 B;  2FNA A;  1HQY E;  5GKN A;  4LFB M;  5EP4 A;  2V6Z M;  2AHM A;  1E94 E;  3KXE C;  4MH0 E;  2F5N A;  3TQS A;  4KLN A;  2LNH C;  3GLH A;  5IZ7 D;  3E4R A;  3E9S A;  4GC5 A;  3U6Q A;  3GO8 A;  4QOZ C;  1UM8 A;  3QAU A;  5ITQ A;  3JAM S;  3GLH B;  4NRW A;  2UUC M;  1QZM A;  3GRV A;  3I4Y A;  1NNJ A;  3ZCB B;  5FLX S;  3SAW A;  3KOZ E;  2Z4S A;  1N33 M;  3D8B A;  2XFT A;  3HKP A;  2Z7J A;  3ZH9 B;  2E5L M;  1Z5B A;  3CF0 A;  4NSR A;  3B9P A;  3SMS A;  1IN4 A;  3JR5 A;  4ZPX A;  2KW0 A;  2CHQ A;  1HNX M;  4G4Q A;  1GL6 A;  2M60 A;  5IT9 S;  1EE8 A;  2HHH M;  3LVW A;  2R65 A;  3J27 B;  3HHW A;  4FWD A;  3OTO M;  3GLF A;  1IBM M;  5EP3 A;  4P16 A;  2O5R A;  3KOY E;  3GP1 A;  2I7N A;  4B7F A;  3GLI A;  2JA2 A;  2M5Z A;  3PFI A;  3GLF B;  1HT2 E;  4DR3 M;  3T38 A;  4JI3 M;  2C9O A;  1E9S A;  2YNM D;  2F5P A;  3U6D A;  2DVW B;  3GPX A;  4LZZ A;  4B7H A;  8CAT A;  4RF0 A;  5E6J A;  5DYI A;  3WHL A;  5KPZ A;  4DV4 M;  4L15 A;  2XLJ A;  2FE8 A;  1NJF A;  4FWG A;  2J7O A;  4GH9 A;  4LJ6 A;  4B3S M;  3HJS A;  4X66 M;  2FFJ A;  3GPU A;  1DGB A;  3J2P B;  4IBB A;  1L1Z A;  2DZO B;  1SXJ C;  3J80 S;  3IG5 A;  4DV3 M;  4RF1 A;  2ZAO A;  5FTN A;  4LJ7 A;  3A46 A;  1IBL M;  4GIP A;  4JN6 A;  4IBG A;  3FUU A;  1IY2 A;  4D81 A;  3DZD A;  3KFU G;  4LJA A;  2XGN A;  1G59 A;  2NQ8 C;  1Z59 A;  4DR4 M;  4LGY A;  1C1K A;  4FCV A;  2VQE M;  4L8R C;  3AOE C;  5C1B A;  4GC9 A;  4B3R M;  3FYD A;  3K1J A;  3I51 A;  3M7G A;  1IY0 A;  4LCB A;  4B7G A;  1XMQ M;  1DGH A;  2C98 A;  3GQ4 A;  2ZAN A;  4A3V B;  2DWZ B;  2Y0Q A;  1DGH B;  1L1T A;  4FWH A;  4FCT A;  4AKH A;  2HL7 A;  2L7I A;  3HHZ A;  3IG8 A;  4FVM A;  2HKJ A;  4S12 A;  5JI2 E;  5EP2 A;  1Z5A A;  4BLC A;  1IN7 A;  3MHV C;  2UXC M;  1N75 A;  3DA1 A;  4LJ8 A;  4PT5 A;  4IBK A;  4AQY M;  4X64 M;  1HT1 E;  2Z3X A;  4LJ5 A;  4M9Z A;  4QHT A;  4D80 A;  4JV5 M;  4MB7 A;  3UZU A;  4B3T M;  1Q39 A;  3L28 A;  1QVR A;  3FYC A;  4IBI A;  1R6B X;  4LFC M;  2QPA A;  1IXR C;  4CIS A;  5EQT A;  2EUC A;  4M0W A;  1I4W A;  2DHR A;  2KEB A;  2D7H A;  2KRU A;  1Z6T A;  2H1R A;  1G3I A;  4OU7 A;  3U5Z A;  1XWI A;  1L2D A;  4MGI E;  1T3T A;  1Q3C A;  2CE7 A;  2CEA A;  1IM2 A;  3TWM A;  3SAV A;  4AZF A;  1ZQ9 A;  1PJJ A;  2L6O A;  3D8L A;  4QOS A;  4X65 M;  5EJC A;  1KYI A;  1K82 A;  3J7B A;  1NY5 A;  4IBJ A;  1E9R A;  3SAU A;  2G8L A;  4YHH M;  2XSZ D;  1L2B A;  2ZAM A;  4AKI A;  1KSF X;  4RNA A;  1J7K A;  3GQ5 A;  3GLG A;  4DUZ M;  4XBO A;  1SXJ D;  2C99 A;  4W5W A;  1PM5 A;  5FTJ A;  4GKJ M;  4TUW A;  3LMM A;  3GLG B;  4IBE A;  1IY1 A;  3HJQ A;  4LJ4 A;  4LF9 M;  3A42 A;  1R2Z A;  4CGY B;  5KPR A;  5ITX E;  3FTE A;  4DR7 M;  1LV7 A;  1OJL A;  4WUR A;  4G4O A;  5BPV A;  3SC3 A;  1HNZ M;  2XEP A;  2Y21 A;  4G6Z A;  4OW0 A;  1TH2 A;  3WHK A;  1QAN A;  1VDD A;  3GLI B;  3R8F A;  4B3M M;  4IBC A;  4PCZ A;  3PVS A;  3HHY A;  1QQW A;  3T1H M;  2LXE A;  2CV2 A;  4DV1 M;  4JI2 M;  5BR8 M;  1YSY A;  5ITR A;  3MK6 A;  3M0E A;  1XNQ M;  2KZS A;  1IXS B;  1W5S A;  3AKZ A;  4KHP M;  2DWL A;  4LF6 M;  3SFZ A;  1IN5 A;  5E26 A;  1NSF A;  1ZAE A;  1TH3 A;  3FUV A;  4YY3 M;  1G41 A;  1JQJ C;  3DOA A;  1FNN A;  2UUA M;  4NL4 H;  4EIW A;  1GL7 A;  4D82 A;  2Z4R A;  2EA0 A;  2VII A;  1DO0 A;  2XH9 A;  3TWK A;  5EP1 A;  2X8A A;  1X37 A;  4NSO B;  4FW9 A;  1QAO A;  2VQF M;  1PJI A;  2BJW A;  1OFH A;  3CTW B;  3HJ8 A;  3RE8 A;  3C58 A;  4M0D A;  2DWM A;  4NXN M;  2D7G A;  3PXG A;  3L25 A;  4MGY E;  4AI6 A;  4II7 A;  5FTL A;  4LRS A;  3VK8 A;  3AFH A;  4OVZ A;  3U6C A;  4PDG A;  3UGJ A;  1DGG A;  4MGK E;  2YQZ A;  2XSZ A;  2QZ4 A;  3J7A S;  5EXT A;  3GPP A;  3KOX E;  2ERC A;  3FUT A;  1FJG M;  4JYA M;  1XNR M;  3FTC A;  2Y0T A;  3ZC7 B;  1SXJ A;  5FTK A;  2XZF A;  4X62 M;  1K3W A;  4GMQ A;  1QYR A;  3PNY A;  1J09 A;  3DFZ A;  1SXJ B;  3U60 A;  1DGF A;  1IN6 A;  2XF3 A;  2UU9 M;  2DWN A;  4HLQ A;  3U60 B;  1G4A E;  4I4L A;  2L09 A;  4I5S A;  4CHT B;  3VDU A;  3KP0 E;  4M9X A;  4PDI A;  4IJF A;  3AOE A;  5FTM A;  1QAM A;  3EIE A;  3U61 A;  2A5Y B;  2C96 A;  2F5Q A;  2R4J A;  3SMP A;  2P5T A;  3TPZ A;  1D2N A;  1E32 A;  3A45 A;  3U6S A;  1TDZ A;  3U61 B;  4LZJ A;  3J81 S;  1NHW C;  2C5R A;  3SYK A;  2L7H A;  2RKO A;  3HWS A;  2ZBK B;  1Q3B A;  5KO3 A;  4FD2 A;  2LH0 A;  3AL0 C;  2UXB M;  1N32 M;  3L26 A;  4QHS A;  2R18 A;  2J7N A;  1JR3 A;  2R45 A;  3AJI B;  2UXD M;  4JI7 M;  3RGP A;  4L16 A;  3LQQ A;  4MGZ E;  4LJ9 A;  3U5Z B;  4JI8 M;  5EXP A;  1XHB A;  1NVM A;  4B08 A;  4DV7 M;  3GQ3 A;  1MX0 A;  3VFD A;  4REZ A;  3VLF B;  4WW0 A;  2QCU A;  3QWL A;  3W0F A;  4HL4 A;  3U6P A;  7CAT A;  2X49 A;  2KZU A;  2CHG A;  2ZM6 M;  1Z5C A;  4GHA A;  3FKE A;  4KO8 A;  2K47 A;  4NXM M;  3I4V A;  3GRR A;  1TH4 A;  1GKI A;  1H6U A;  2F5O A;  3FTF A;  2V1C A;  2RGH A;  4JI4 M;  2CUZ A;  4LF7 M;  1GVN A;  5ITY A;  1IN8 A;  4NRV A;  4K0K M;  4AW4 A;  2FOI C;  3TWL A;  2CHV A;  3SHF A;  4AKG A;  3NBI A;  3HU2 A;  5F3W A;  3LVV A;  4JI0 M;  1IBK M;  4G4R A;  2QP9 X;  1TGU A;  3RFW A;  5IWA M;  4PD2 A;  1QAQ A;  1K3X A;  4DR5 M;  4IBD A;  2R62 A;  4DV2 M;  4I8O A;  3VK7 A;  1TDH A;  3HU3 A;  3TE6 A;  5ITU A;  3UK6 A;  4LFA M;  3U6L A;  4R3D A;  3K8Z A;  3FUX A;  5LMU M;  4DR6 M;  1I94 M;  1DO2 A;  2W82 A;  2V1U A;  3L27 A;  2DXI A;  4IIW A;  3BOS A;  3AOG A;  4AG5 A;  4IJE A;  3NWL A;  3KOW E;  1OFI A;  4L4U A;  1NJG A;  3FTD A;  4R7G A;  5C18 A;  3SBJ A;  3GRU A;  1S3S A;  1L2C A;  1YE9 A;  3KS8 A;  2LWX A;  4NOO B;  3KP1 E;  2HCB A;  1JR3 D;  3SHG B;  1SXJ E;  3TL4 X;  3KDS E;  3SAS A;  1J5E M;  2OPF A;  2CV1 A;  4DV0 M;  2DZN B;  3KW6 A;  1R2Y A;  4QNM A;  5KQ8 A;  1IQP A;  3CF2 A;  5IRE B;  1KFV A;  4GKK M;  3SAR A;  1WXQ A;  3HU1 A;  2D7E A;  3UMM A;  1GLN A;  4LF5 M;  3U6O A;  4LY6 A;  5FSW A;  2C9C A;  1YUB A;  4MGH A;  3JR4 A;  1N78 A;  2I7P A;  1N34 M;  2Y20 A;  4LG2 A;  3EIH A;  3KSX A;  1XC8 A;  1HNW M;  3H4M A;  4LF4 M;  2Q2E B;  2KA6 B;  5A2Q S;  4LRT A;  2BJV A;  4DR1 M;  4MM3 B;  4IBF A;  4GHL A;  4ITQ A;  5JI3 E;  1ORY B;  3GRY A;  4XGI A;  3SYL A;  4DR2 M;  1IXZ A;  4OVZ B;  4DUY M;  5KPT A;  1L8Q A;  3AV0 A;  5ITX A;  5H37 D;  3MJ5 A;  1NY6 A;  3L2A A;  5DNY A;  4G4N A;  2CFO A;  3FUW A;  4LF8 M;  3L29 A;  1HR0 M;  4BBA A;  3KSJ A;  1R7R A;  4JI5 M;  4M9S A;  5LMN M;  4AG6 A;  2RGO A;  3T15 A;  2KRK A;  4JI1 M;  2BNK A;  3K92 A;  4Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...