2M5ZA

Enterocin 7a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
GAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterocin JSA
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 7
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m5zA00
2M60A 2M5ZA
chains in the Genus database with same CATH superfamily
1HNWM 3K9PA 1ZMWA 4D82A 4JV5M 2L6OA 2BNKA 5JI3E 3SAVA 1WJ7A 1ZMUA 4PCZA 3GLFB 2A5YB 1IXSA 3A45A 4B3SM 4GKKM 1WHCA 5BR8M 1IY1A 4LJ6A 4NOOB 2ZAOA 5ITXE 2DNAA 4DBGB 3GLFE 1BVSA 2K9DA 2J5YA 2Y20A 5ITQA 3L27A 4QHTA 2KXEA 1I94M 3LVWA 1TR8A 3NBIA 2Z8YM 5FTKA 5EP4A 4KLNA 1IN6A 2L4EA 4IJFA 4IBJA 4BBAA 3VKGA 4JI3M 2C9OA 4DV4M 1V34A 4XK8F 4OVZA 1Q3CA 1SG9A 4AKHA 2QBYB 1K82A 1LV7A 3U6OA 1NJFA 2F5QA 2LVNC 4GH9A 4FD2A 2J7OA 1AUAA 4M9SA 3K2LA 3U60B 1MJGM 3HU1A 1IY2A 4AG5A 1QDRA 1Z6TA 4L6V6 3HY5A 3UMMA 3A46A 1N32M 4GITA 2JY6B 4QNMA 1QDTA 3K8ZA 5KQ8A 3UZUA 1IBMM 1TH3A 3MMPA 4NXMM 4KODA 3LQRA 4DR6M 3TL4X 1G8PA 4L8RC 3DA1A 3ZCBB 1NV8A 1C1KA 1MX0A 3KOYE 2E5LM 3T38A 3FE3A 4LJAA 2R0IA 5IREB 3J80S 1OIZA 1GABA 2FOIC 3K1JA 1TDZA 1PGYA 3MJ5A 3SHGB 3SYKA 4CHTB 2F5NA 4RKUF 2UU9M 4I8OA 4LJ8A 1XXHB 2LWXA 1DGGA 4MGHA 2ZM6M 1XB2B 1EFUB 1HT1E 4DV3M 3TQSA 3THGA 3D8BA 3BOSA 4QHSA 1OFIA 3GLIB 2XSZA 1XXHE 3AJIB 2ZANA 1W5SA 4NRVA 4DV7M 2JY5A 3DZDA 4NXNM 1N78A 1G59A 3K9OA 3KVWA 3GLIE 4GKJM 1IFYA 2C98A 5EP2A 1DGHA 1WIVA 2XH9A 2G5GX 2VDBB 2KNAA 3SASA 3FTDA 3D8LA 2C99A 1AIPC 3GLHA 5EP1A 3UJNA 3U6SA 2R18A 2CWBA 4JI2M 3A98B 1JB0F 3AKZA 3LQQA 3HU3A 4JI0M 3TE6A 2LVPC 4LJ4A 1QUSA 1YLAA 4FCVA 4G6ZA 3EIEA 4FCWA 4KO8A 5DNYA 1GO5A 1PJQA 4G4RA 3T15A 1NY6A 1UM8A 3TWLA 3U6DA 3SAWA 2V6ZM 4MGYE 3AFHA 4GHLA 5C1BA 2JY8A 4S12A 4MB7A 4DV2M 1IXSB 4TUWA 4QOZC 4D80A 3VK7A 2DI0A 1V92A 1N33M 1R5LA 1D0KA 4MH0E 3HX3A 3HHYA 3AOEA 4LZJA 1R7RA 3CF0A 1OAOC 4GRIA 5EXSA 4Z8XA 4M0WA 4XBOA 3C3DA 5EJCA 4IBCA 2KZUA 2DZLA 2Y0TA 2Z7JA 3GLGB 4DR3M 4CISA 1MU5A 2DKLA 2FE8A 2CV2A 2YNMD 2LHCA 3IHPA 4LRSA 3JAMS 2DWLA 3Q8XA 1TF0B 3IG8A 4OVZB 2MGWA 3GLGE 4DUZM 2CUZA 3QYBA 3U6CA 1H6UA 4MM3B 2LH0A 4BLCA 4IBDA 2XSZD 4BB9A 3HJQA 4PDIA 3GPPA 3BBZA 5FTNA 4X64M 3T1HM 1GL6A 5DYIA 1OIPA 1OFHA 3KOXE 2FFJA 4NSOB 3FYDA 2ERCA 3QYEA 3AOGA 2CP8A 2VQEM 3R9XB 1HJPA 2DVWB 3E46A 2JZ0A 3FTCA 4UN2B 4DV6M 3RGPA 4JI5M 3GRVA 1GJSA 3W0LB 2Z4SA 3BXWA 2KRKA 2G8LA 4RF0A 1QUTA 4JXJA 4DR4M 3VKHA 1QAOA 4X66M 1YE9A 1Q39A 2DHRA 2ZTCA 5KO3A 2UUCM 4B7GA 3GPUA 3L26A 3HU2A 3GRYA 2LXEA 1VDLA 3C58A 2XF3A 5ITTA 1D2NA 3M7GA 3DFZA 2AHMA 4B7HA 3H4MA 4AKGA 2KRUA 4NRWA 2K6BA 1N77A 4IBEA 7CATA 2Q2EB 2P5TA 1IXZA 8CATA 3PFIA 3FUTA 3FD9A 3GQ4A 1N34M 4LF5M 3QWLA 3TWKA 2R44A 1K3XA 2VF8A 3HZJA 4RNAA 4OX9M 4FW9A 4IJEA 3VFDA 1CUKA 3IG5A 2Y0QA 2X4AA 3KW6A 2NQ8C 1DGHB 3GPXA 2ZBKB 1E94E 1HT2E 1XMOM 3VLFB 2DZOB 2QNJA 4KT0F 1OKSA 2QENA 4FCTA 2DHYA 4PDGA 3I04M 4DV0M 1IM2A 1N75A 1DO0A 2R4JA 3GLHE 1DGFA 3HHWA 3U5ZA 2H5XA 1GL7A 2JWSA 3ZH9B 4X62M 2CEAA 1TDHA 1J5EM 1L1ZA 3CGWA 4GC5A 1IXRC 4IBFA 3GQ3A 3U6QA 1XHBA 2OO9A 1Q3BA 3MK6A 4B3RM 1WGLA 4ZPXA 4OU7A 4GHAA 3B7QA 3KDSE 1NY5A 4AG6A 1OAIA 3HWSA 1ORYB 4F1IA 2LVAA 2R45A 1T3TA 3FYCA 3J27B 4IBKA 2DXIA 5EP3A 1K3WA 1V33A 2QZ4A 4LJ9A 1KFVA 4LF4M 3AOEC 2ZAMA 1C7YA 2HAKA 2JA2A 2O5RA 2UUAM 3KS8A 4I5SA 3U61A 2Y21A 2R46A 4L78A 2G3QA 3GP1A 3LW5F 4CJ6A 2UUBM 4B3MM 3H4JA 1NNJA 1XWIA 4HLQA 5LMNM 3JR4A 5DFLA 3A42A 4IIWA 4REZA 3PNVA 1Y8GA 1PJIA 3PXGA 2F5OA 2L4FA 3DOAA 4MGZE 3FTFA 1N36M 3J7BA 2EA0A 1I4WA 2EKKA 2XFTA 4Q7JA 4AW4A 2F5SA 3KXEC 4LJ5A 3VDUA 2L09A 1SXJD 2DWNA 1P3QQ 4L4UA 2CFOA 2EO2A 2GQFA 4W5WA 4QOSA 3ILKA 1VEJA 3KOZE 2BJVA 1QZEA 3FUXA 5DYGA 1PJTA 3W68A 1OTRA 4FVMA 3M6AA 3KS4A 1NHGC 3B7ZA 4GMQA 5FTMA 2X49A 4DV1M 2CHGA 1R2ZA 3B7NA 1Z5AA 4PD2A 2C9CA 1IN7A 2DAKA 4EIWA 1LTMA 3KP1E 1L8QA 2M5ZA 5C18A 4JI4M 5KQDA 1R4GA 1JR3D 1FNNA 3E4RA 3FUVA 1QAMA 2MROB 3PVSA 1IBKM 2R6FA 3T6PA 4LF6M 4IBBA 5GKNA 1QAQA 3E9SA 3QAUA 1DV0A 1QANA 1VG5A 1WGNA 1ZAEA 2M60A 4ANRA 3U60A 1EE8A 2XZUA 1VEKA 1PJJA 4DR5M 1D0MA 1T6OA 3L28A 4I4LA 2L2DA 4CIZA 4ITQA 2DWMA 1Q02A 3FRHA 2DENA 1YUBA 4LJ7A 5E26A 1ZQ9A 4AQYM 2YFQA 4LCBA 4P16A 4FWGA 1NVMA 3UK6A 3OTOM 3V76A 1QQWA 2R62A 3T1YM 2FNAA 1L1TA 4LGMA 2F5PA 1VEGA 1G41A 5ITYA 1NV9A 3HHZA 2KZSA 3GPYA 3J2PB 3JR5A 3GRUA 4DUYM 1PJSA 5EXXA 4LF8M 1XXHA 5IWAM 1HR0M 2FS1A 4WW0A 2RRUA 5KPZA 2XEPA 2OPFA 1A5TA 1WXQA 3FKEA 3E21A 4X65M 3B89A 1G3IA 3HJ8A 3WHLA 3SYLA 3AV0A 4YY3M 5EXTA 1MN3A 4JI1M 3R8FA 2J7NA 2HL7A 1J09A 3L25A 3HJSA 2V1UA 1UFZA 2VQFM 4M9XA 4JI7M 1KSFX 2KHHA 4R3DA 2CV1A 3U6EA 4K0KM 1D0LA 3M0EA 5FTLA 4L15A 1IN8A 2GNOA 1IQPA 3HHXA 4LY6A 4Y28F 5BPVA 3UGJA 3GLHB 2HCBA 4PT5A 3U6PA 4MGKE 2EUCA 4IBIA 1QVRA 1SXJA 2K0BX 2D7GA 5L8RF 2OQ4A 3FRIA 4YHHM 2JXNA 3WHKA 1R6BX 1GKIA 3SBJA 1XNRM 1DO2A 1R2YA 4LGYA 3J81S 2D7EA 1Z59A 2QHOB 2JNHA 1Z5CA 2QCUA 3AL0C 2CHVA 2BJWA 2FH0A 1HQYE 1NSFA 1GLNA 2HKJA 2OOAA 4NSRA 4AKIA 2K47A 1W5TA 2CRUA 1VQ1A 1DGBA 2L7HA 2EJSA 2RGHA 2VIIA 4P17A 2O01F 2HHHM 3I51A 2CHQA 2LVQD 3CTWB 3J7AS 1OJLA 4FWHA 4OW0A 3K92A 5EQTA 3GLGA 3TWMA 4CGYB 1E32A 3I01M 1E9SA 1JR3A 4M0DA 4KHPM 3ZC7B 5IT9S 3KSJA 1NNUC 3RGSA 1IN4A 1G4AE 2KA6B 5ITUA 4DR2M 2F4VM 4JN6A 4AZFA 2I7NA 2WZJA 4G3OA 5FTJA 3PNYA 4IBGA 4AI6A 3I4YA 4D81A 4R71A 1T43A 4NC6A 4DR7M 3IECA 3RE8A 3B9PA 3NBXX 1QZMA 4II7A 2QP9X 3SAUA 1XC8A 2B3TA 1L2CA 1NJGA 5E6JA 2QQ8A 3HGIA 2OOBA 1IN5A 4LRTA 1ZMVA 2LBCA 2JY7A 3HKPA 2MJ5B 3I4VA 2UXCM 2Z4RA 2L7IA 2YQZA 1J7KA 2HWJA 3FTEA 5KPRA 1TH4A 4LFCM 1PM5A 2RKOA 5JI2E 1WR1B 1RU3A 3NWLA 2QPAA 4B08A 1HNZM 5ITXA 3C9PA 4FWDA 2ZTDA 3GLFA 3SATA 1TGUA 2VF7A 1YSYA 4M9ZA 3LCVB 3F92A 4NL4H 2Z3XA 3LVVA 1EIJA 5FLXS 4G4NA 2DWZB 2XLJA 2JZ1A 1GJTA 1TTEA 3EIHA 1XMQM 3SARA 4JYAM 5LMUM 4Z6YA 3KP0E 3LMMA 2LTUA 2MH8A 2DZNB 2H1RA 2X8AA 2D7HA 3C3EA 3KOWE 3MHVC 2N35A 3KFUG 5IZ7D 5A2QS 2EKFA 4JI8M 3SFZA 2LVOC 4LFAM 2R65A 3U6LA 1NHWC 3TPZA 1PRBA 2UXDM 5H37D 3L2AA 3FUUA 4MGIE 3VDPA 4DV5M 1JQJC 4WURA 3GQ5A 2QBYA 4R7GA 2JUJA 2DAIA 2DAGA 1Z5BA 3ZQJA 1NO1A 4DR1M 1S3SA 1SXJB 2O25A 4B7FA 3CF2A 5F3WA 2JP7A 2CV0A 1GVNA 1SXJC 1VDDA 2R4EA 3U5ZB 2YR0A 3GRRA 4B3TM 4JI6M 1SXJE 4HEOA 2I7PA 4A3VB 1OQYA 5ITRA 2C5RA 3RFWA 2C96A 1QYRA 1E9RA 3LCUA 2BWBA 2W82A 4LF7M 1FJGM 2WSCF 2CE7A 3L29A 3SC3A 2KNVA 3SHFA 1L2DA 4LFBM 2KEBA 4GC9A 4GIPA 4LF9M 1IY0A 2UXBM 2KNZA 2QSFX 2RGOA 2V1CA 3GLIA 4G4OA 3U6MA 1HNXM 1HQCA 1JR3E 2DAMA 2XGNA 3Q8GA 4L16A 4G4QA 2LHGA 1F4IA 1IBLM 1TH2A 5EXPA 3U61B 4I81A 3SMSA 3SMPA 2XFSA 4XGIA 2XZFA 3CF6E 2KDLA 2WSFF 4WP2A 3GO8A 2DAEA 1XNQM 1ZV1A 4LG2A 1KYIA 2WSEF 2KW0A 2APLA 4GEWA 3VK8A 5FSWA 4HL4A 3W0FA 2MR9A 1X37A 1G71A 2LNHC 5KPTA 2BWEA 4RF1A 3FUWA 3KSXA 4QNRA 1L2BA 3B74A 4F2LA 3W67A 4LZZA
chains in the Genus database with same CATH topology
1HNWM 4D82A 4JV5M 2L6OA 2BNKA 5JI3E 3SAVA 4PCZA 4B3SM 3GLFB 2A5YB 3A45A 4GKKM 5BR8M 1IY1A 4LJ6A 4NOOB 2ZAOA 5ITXE 2Y20A 5ITQA 3L27A 4QHTA 2KXEA 1I94M 3LVWA 3NBIA 5FTKA 5EP4A 4KLNA 1IN6A 4IJFA 4IBJA 4BBAA 3VKGA 4JI3M 2C9OA 4DV4M 4OVZA 1Q3CA 4AKHA 2QBYB 1K82A 1LV7A 3U6OA 1NJFA 2F5QA 4GH9A 4FD2A 2J7OA 4M9SA 3U60B 3K2LA 3HU1A 1IY2A 4AG5A 3A46A 1Z6TA 3UMMA 1N32M 4GITA 4QNMA 3K8ZA 5KQ8A 3UZUA 1IBMM 1TH3A 4NXMM 4KODA 3LQRA 4DR6M 3TL4X 1G8PA 4L8RC 3DA1A 3ZCBB 1C1KA 1MX0A 3KOYE 2E5LM 3T38A 3J80S 4LJAA 5IREB 2FOIC 3K1JA 1TDZA 3MJ5A 3SHGB 3SYKA 2F5NA 4CHTB 2UU9M 4I8OA 4LJ8A 1XXHB 2LWXA 1DGGA 4MGHA 2ZM6M 4DV3M 1HT1E 3TQSA 3THGA 3D8BA 3BOSA 4QHSA 1OFIA 3GLIB 2XSZA 3AJIB 2ZANA 1W5SA 4NRVA 4DV7M 3DZDA 4NXNM 1N78A 1G59A 3KVWA 4GKJM 2C98A 5EP2A 1DGHA 2XH9A 2G5GX 3SASA 3FTDA 3D8LA 2C99A 5EP1A 3GLHA 3UJNA 3U6SA 2R18A 4JI2M 3A98B 3AKZA 3LQQA 3HU3A 4JI0M 3TE6A 4LJ4A 4FCVA 4G6ZA 3EIEA 4FCWA 4KO8A 5DNYA 4G4RA 3T15A 1NY6A 1UM8A 3TWLA 3U6DA 3SAWA 2V6ZM 4MGYE 3AFHA 4GHLA 5C1BA 4S12A 4MB7A 4DV2M 1IXSB 4TUWA 4QOZC 4D80A 3VK7A 1N33M 4MH0E 3HHYA 3AOEA 4LZJA 1R7RA 3CF0A 4GRIA 5EXSA 4Z8XA 4M0WA 4XBOA 5EJCA 4IBCA 2KZUA 2Z7JA 2Y0TA 3GLGB 4DR3M 4CISA 1MU5A 2FE8A 2CV2A 2YNMD 4LRSA 3JAMS 2DWLA 3Q8XA 3IG8A 4OVZB 3U6CA 4DUZM 2CUZA 1H6UA 4MM3B 2LH0A 4BLCA 4IBDA 2XSZD 4BB9A 3HJQA 4PDIA 3GPPA 5FTNA 4X64M 3T1HM 1GL6A 5DYIA 1OFHA 3KOXE 2FFJA 4NSOB 3FYDA 2ERCA 3AOGA 2VQEM 3R9XB 2DVWB 3FTCA 4DV6M 3RGPA 4JI5M 3GRVA 3W0LB 2Z4SA 2KRKA 2G8LA 4RF0A 3VKHA 4JXJA 4DR4M 1QAOA 4X66M 1YE9A 1Q39A 2DHRA 5KO3A 2UUCM 4B7GA 3GPUA 3L26A 3HU2A 3GRYA 2LXEA 3C58A 2XF3A 5ITTA 1D2NA 3M7GA 3DFZA 2AHMA 4B7HA 3H4MA 4AKGA 2KRUA 4NRWA 1N77A 4IBEA 7CATA 2Q2EB 2P5TA 1IXZA 8CATA 3PFIA 3FUTA 3FD9A 3GQ4A 1N34M 4LF5M 3QWLA 3TWKA 1K3XA 4RNAA 4OX9M 4FW9A 4IJEA 3VFDA 3IG5A 2Y0QA 2X4AA 3KW6A 2NQ8C 1DGHB 3GPXA 2ZBKB 1E94E 1HT2E 1XMOM 3VLFB 2DZOB 4PDGA 2QENA 4FCTA 4DV0M 1IM2A 1N75A 1DO0A 2R4JA 1DGFA 3HHWA 3U5ZA 1L1ZA 1GL7A 3ZH9B 4X62M 2CEAA 1TDHA 1J5EM 4IBFA 4GC5A 1IXRC 3GQ3A 3U6QA 1XHBA 1Q3BA 3MK6A 4B3RM 4ZPXA 4OU7A 4GHAA 3KDSE 1NY5A 4AG6A 3HWSA 1ORYB 2R45A 4IBKA 1T3TA 3FYCA 3J27B 2DXIA 5EP3A 1K3WA 2QZ4A 4LJ9A 1KFVA 4LF4M 3AOEC 2ZAMA 2JA2A 2O5RA 2UUAM 3KS8A 4I5SA 3U61A 2Y21A 2R46A 4L78A 3GP1A 2UUBM 4B3MM 1NNJA 1XWIA 4HLQA 5LMNM 3JR4A 3A42A 4IIWA 4REZA 3PNVA 1PJIA 3PXGA 2F5OA 3DOAA 4MGZE 3FTFA 1N36M 3J7BA 2EA0A 1I4WA 2XFTA 4AW4A 2F5SA 3KXEC 4LJ5A 3VDUA 2L09A 1SXJD 2DWNA 4L4UA 2CFOA 2EO2A 4W5WA 4QOSA 3ILKA 3KOZE 2BJVA 5DYGA 3FUXA 4FVMA 3M6AA 3KS4A 1NHGC 4GMQA 5FTMA 2X49A 4DV1M 2CHGA 1R2ZA 4PD2A 1Z5AA 2C9CA 1IN7A 4EIWA 3KP1E 1L8QA 2M5ZA 5C18A 4JI4M 5KQDA 1JR3D 1FNNA 3E4RA 3FUVA 1QAMA 3PVSA 1IBKM 4LF6M 4IBBA 5GKNA 1QAQA 3E9SA 3QAUA 1QANA 1ZAEA 2M60A 3U60A 1EE8A 2XZUA 1PJJA 4DR5M 3L28A 4I4LA 4ITQA 2DWMA 1YUBA 4LJ7A 5E26A 1ZQ9A 4AQYM 2YFQA 4LCBA 4P16A 4FWGA 1NVMA 3UK6A 3OTOM 1QQWA 2R62A 3T1YM 2FNAA 1L1TA 4LGMA 2F5PA 1G41A 5ITYA 3HHZA 2KZSA 3GPYA 3J2PB 3JR5A 3GRUA 4DUYM 5EXXA 4LF8M 1XXHA 5IWAM 1HR0M 4WW0A 5KPZA 2XEPA 2OPFA 1WXQA 3FKEA 4X65M 1G3IA 3HJ8A 3WHLA 3SYLA 3AV0A 4YY3M 5EXTA 4JI1M 3R8FA 2J7NA 2HL7A 1J09A 3L25A 3HJSA 2V1UA 2VQFM 4M9XA 4JI7M 1KSFX 4R3DA 2CV1A 3U6EA 4K0KM 3M0EA 5FTLA 4L15A 1IN8A 4LY6A 1IQPA 3HHXA 5BPVA 3UGJA 3GLHB 2HCBA 4PT5A 3U6PA 4MGKE 2EUCA 4IBIA 1QVRA 1SXJA 2D7GA 2OQ4A 4YHHM 3WHKA 1R6BX 1GKIA 3SBJA 1XNRM 1DO2A 1R2YA 4LGYA 3J81S 2D7EA 1Z59A 1Z5CA 2QCUA 3AL0C 2CHVA 2BJWA 1HQYE 1NSFA 1GLNA 2HKJA 4NSRA 4AKIA 1W5TA 2K47A 1DGBA 2L7HA 2RGHA 2VIIA 2HHHM 3I51A 2CHQA 3CTWB 3J7AS 1OJLA 4FWHA 4OW0A 3K92A 5EQTA 3GLGA 3TWMA 4CGYB 1E32A 4KHPM 1E9SA 1JR3A 4M0DA 3ZC7B 5IT9S 3KSJA 1NNUC 3RGSA 1IN4A 1G4AE 2KA6B 5ITUA 4DR2M 2F4VM 4JN6A 4AZFA 2I7NA 5FTJA 3PNYA 4IBGA 4AI6A 3I4YA 4D81A 4DR7M 3RE8A 3B9PA 4II7A 1QZMA 2QP9X 3SAUA 1XC8A 1L2CA 1NJGA 5E6JA 3HGIA 1IN5A 4LRTA 3HKPA 3I4VA 2UXCM 2Z4RA 2L7IA 2YQZA 1J7KA 3FTEA 5KPRA 1TH4A 4LFCM 1PM5A 2RKOA 5JI2E 3NWLA 4B08A 2QPAA 1HNZM 5ITXA 4FWDA 3SATA 3GLFA 1TGUA 4M9ZA 1YSYA 4NL4H 2Z3XA 3LVVA 5FLXS 4G4NA 2DWZB 2XLJA 3EIHA 1XMQM 3SARA 4JYAM 5LMUM 4Z6YA 3KP0E 3LMMA 2DZNB 2H1RA 2X8AA 2D7HA 3KOWE 3MHVC 3KFUG 5IZ7D 5A2QS 4JI8M 3SFZA 4LFAM 2R65A 3U6LA 1NHWC 3TPZA 2UXDM 5H37D 3L2AA 3FUUA 4MGIE 3VDPA 4DV5M 1JQJC 4WURA 3GQ5A 2QBYA 4R7GA 1Z5BA 4DR1M 1S3SA 1SXJB 4B7FA 3CF2A 5F3WA 2CV0A 1GVNA 1SXJC 1VDDA 2R4EA 3U5ZB 2YR0A 3GRRA 4B3TM 4JI6M 1SXJE 2I7PA 4A3VB 5ITRA 2C5RA 3RFWA 2C96A 1QYRA 1E9RA 2W82A 4LF7M 1FJGM 3L29A 2CE7A 3SC3A 3SHFA 1L2DA 4LFBM 2KEBA 4GC9A 4GIPA 4LF9M 1IY0A 2UXBM 2V1CA 2RGOA 3GLIA 4G4OA 3U6MA 1HNXM 1HQCA 4L16A 2XGNA 4G4QA 1IBLM 1TH2A 5EXPA 3U61B 4I81A 3SMSA 3SMPA 2XFSA 4XGIA 2XZFA 3CF6E 3GO8A 1XNQM 4LG2A 1KYIA 2KW0A 3VK8A 5FSWA 4HL4A 3W0FA 1X37A 2LNHC 5KPTA 4RF1A 3FUWA 3KSXA 4QNRA 1L2BA 4LZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M60 A;  2M5Z A; 
#chains in the Genus database with same CATH topology
 1HNW M;  3K9P A;  1ZMW A;  4D82 A;  4JV5 M;  2L6O A;  2BNK A;  5JI3 E;  3SAV A;  1WJ7 A;  1ZMU A;  4PCZ A;  3GLF B;  2A5Y B;  1IXS A;  3A45 A;  4B3S M;  4GKK M;  1WHC A;  5BR8 M;  1IY1 A;  4LJ6 A;  4NOO B;  2ZAO A;  5ITX E;  2DNA A;  4DBG B;  3GLF E;  1BVS A;  2K9D A;  2J5Y A;  2Y20 A;  5ITQ A;  3L27 A;  4QHT A;  2KXE A;  1I94 M;  3LVW A;  1TR8 A;  3NBI A;  2Z8Y M;  5FTK A;  5EP4 A;  4KLN A;  1IN6 A;  2L4E A;  4IJF A;  4IBJ A;  4BBA A;  3VKG A;  4JI3 M;  2C9O A;  4DV4 M;  1V34 A;  4XK8 F;  4OVZ A;  1Q3C A;  1SG9 A;  4AKH A;  2QBY B;  1K82 A;  1LV7 A;  3U6O A;  1NJF A;  2F5Q A;  2LVN C;  4GH9 A;  4FD2 A;  2J7O A;  1AUA A;  4M9S A;  3K2L A;  3U60 B;  1MJG M;  3HU1 A;  1IY2 A;  4AG5 A;  1QDR A;  1Z6T A;  4L6V 6;  3HY5 A;  3UMM A;  3A46 A;  1N32 M;  4GIT A;  2JY6 B;  4QNM A;  1QDT A;  3K8Z A;  5KQ8 A;  3UZU A;  1IBM M;  1TH3 A;  3MMP A;  4NXM M;  4KOD A;  3LQR A;  4DR6 M;  3TL4 X;  1G8P A;  4L8R C;  3DA1 A;  3ZCB B;  1NV8 A;  1C1K A;  1MX0 A;  3KOY E;  2E5L M;  3T38 A;  3FE3 A;  4LJA A;  2R0I A;  5IRE B;  3J80 S;  1OIZ A;  1GAB A;  2FOI C;  3K1J A;  1TDZ A;  1PGY A;  3MJ5 A;  3SHG B;  3SYK A;  4CHT B;  2F5N A;  4RKU F;  2UU9 M;  4I8O A;  4LJ8 A;  1XXH B;  2LWX A;  1DGG A;  4MGH A;  2ZM6 M;  1XB2 B;  1EFU B;  1HT1 E;  4DV3 M;  3TQS A;  3THG A;  3D8B A;  3BOS A;  4QHS A;  1OFI A;  3GLI B;  2XSZ A;  1XXH E;  3AJI B;  2ZAN A;  1W5S A;  4NRV A;  4DV7 M;  2JY5 A;  3DZD A;  4NXN M;  1N78 A;  1G59 A;  3K9O A;  3KVW A;  3GLI E;  4GKJ M;  1IFY A;  2C98 A;  5EP2 A;  1DGH A;  1WIV A;  2XH9 A;  2G5G X;  2VDB B;  2KNA A;  3SAS A;  3FTD A;  3D8L A;  2C99 A;  1AIP C;  3GLH A;  5EP1 A;  3UJN A;  3U6S A;  2R18 A;  2CWB A;  4JI2 M;  3A98 B;  1JB0 F;  3AKZ A;  3LQQ A;  3HU3 A;  4JI0 M;  3TE6 A;  2LVP C;  4LJ4 A;  1QUS A;  1YLA A;  4FCV A;  4G6Z A;  3EIE A;  4FCW A;  4KO8 A;  5DNY A;  1GO5 A;  1PJQ A;  4G4R A;  3T15 A;  1NY6 A;  1UM8 A;  3TWL A;  3U6D A;  3SAW A;  2V6Z M;  4MGY E;  3AFH A;  4GHL A;  5C1B A;  2JY8 A;  4S12 A;  4MB7 A;  4DV2 M;  1IXS B;  4TUW A;  4QOZ C;  4D80 A;  3VK7 A;  2DI0 A;  1V92 A;  1N33 M;  1R5L A;  1D0K A;  4MH0 E;  3HX3 A;  3HHY A;  3AOE A;  4LZJ A;  1R7R A;  3CF0 A;  1OAO C;  4GRI A;  5EXS A;  4Z8X A;  4M0W A;  4XBO A;  3C3D A;  5EJC A;  4IBC A;  2KZU A;  2DZL A;  2Y0T A;  2Z7J A;  3GLG B;  4DR3 M;  4CIS A;  1MU5 A;  2DKL A;  2FE8 A;  2CV2 A;  2YNM D;  2LHC A;  3IHP A;  4LRS A;  3JAM S;  2DWL A;  3Q8X A;  1TF0 B;  3IG8 A;  4OVZ B;  2MGW A;  3GLG E;  4DUZ M;  2CUZ A;  3QYB A;  3U6C A;  1H6U A;  4MM3 B;  2LH0 A;  4BLC A;  4IBD A;  2XSZ D;  4BB9 A;  3HJQ A;  4PDI A;  3GPP A;  3BBZ A;  5FTN A;  4X64 M;  3T1H M;  1GL6 A;  5DYI A;  1OIP A;  1OFH A;  3KOX E;  2FFJ A;  4NSO B;  3FYD A;  2ERC A;  3QYE A;  3AOG A;  2CP8 A;  2VQE M;  3R9X B;  1HJP A;  2DVW B;  3E46 A;  2JZ0 A;  3FTC A;  4UN2 B;  4DV6 M;  3RGP A;  4JI5 M;  3GRV A;  1GJS A;  3W0L B;  2Z4S A;  3BXW A;  2KRK A;  2G8L A;  4RF0 A;  1QUT A;  4JXJ A;  4DR4 M;  3VKH A;  1QAO A;  4X66 M;  1YE9 A;  1Q39 A;  2DHR A;  2ZTC A;  5KO3 A;  2UUC M;  4B7G A;  3GPU A;  3L26 A;  3HU2 A;  3GRY A;  2LXE A;  1VDL A;  3C58 A;  2XF3 A;  5ITT A;  1D2N A;  3M7G A;  3DFZ A;  2AHM A;  4B7H A;  3H4M A;  4AKG A;  2KRU A;  4NRW A;  2K6B A;  1N77 A;  4IBE A;  7CAT A;  2Q2E B;  2P5T A;  1IXZ A;  8CAT A;  3PFI A;  3FUT A;  3FD9 A;  3GQ4 A;  1N34 M;  4LF5 M;  3QWL A;  3TWK A;  2R44 A;  1K3X A;  2VF8 A;  3HZJ A;  4RNA A;  4OX9 M;  4FW9 A;  4IJE A;  3VFD A;  1CUK A;  3IG5 A;  2Y0Q A;  2X4A A;  3KW6 A;  2NQ8 C;  1DGH B;  3GPX A;  2ZBK B;  1E94 E;  1HT2 E;  1XMO M;  3VLF B;  2DZO B;  2QNJ A;  4KT0 F;  1OKS A;  2QEN A;  4FCT A;  2DHY A;  4PDG A;  3I04 M;  4DV0 M;  1IM2 A;  1N75 A;  1DO0 A;  2R4J A;  3GLH E;  1DGF A;  3HHW A;  3U5Z A;  2H5X A;  1GL7 A;  2JWS A;  3ZH9 B;  4X62 M;  2CEA A;  1TDH A;  1J5E M;  1L1Z A;  3CGW A;  4GC5 A;  1IXR C;  4IBF A;  3GQ3 A;  3U6Q A;  1XHB A;  2OO9 A;  1Q3B A;  3MK6 A;  4B3R M;  1WGL A;  4ZPX A;  4OU7 A;  4GHA A;  3B7Q A;  3KDS E;  1NY5 A;  4AG6 A;  1OAI A;  3HWS A;  1ORY B;  4F1I A;  2LVA A;  2R45 A;  1T3T A;  3FYC A;  3J27 B;  4IBK A;  2DXI A;  5EP3 A;  1K3W A;  1V33 A;  2QZ4 A;  4LJ9 A;  1KFV A;  4LF4 M;  3AOE C;  2ZAM A;  1C7Y A;  2HAK A;  2JA2 A;  2O5R A;  2UUA M;  3KS8 A;  4I5S A;  3U61 A;  2Y21 A;  2R46 A;  4L78 A;  2G3Q A;  3GP1 A;  3LW5 F;  4CJ6 A;  2UUB M;  4B3M M;  3H4J A;  1NNJ A;  1XWI A;  4HLQ A;  5LMN M;  3JR4 A;  5DFL A;  3A42 A;  4IIW A;  4REZ A;  3PNV A;  1Y8G A;  1PJI A;  3PXG A;  2F5O A;  2L4F A;  3DOA A;  4MGZ E;  3FTF A;  1N36 M;  3J7B A;  2EA0 A;  1I4W A;  2EKK A;  2XFT A;  4Q7J A;  4AW4 A;  2F5S A;  3KXE C;  4LJ5 A;  3VDU A;  2L09 A;  1SXJ D;  2DWN A;  1P3Q Q;  4L4U A;  2CFO A;  2EO2 A;  2GQF A;  4W5W A;  4QOS A;  3ILK A;  1VEJ A;  3KOZ E;  2BJV A;  1QZE A;  3FUX A;  5DYG A;  1PJT A;  3W68 A;  1OTR A;  4FVM A;  3M6A A;  3KS4 A;  1NHG C;  3B7Z A;  4GMQ A;  5FTM A;  2X49 A;  4DV1 M;  2CHG A;  1R2Z A;  3B7N A;  1Z5A A;  4PD2 A;  2C9C A;  1IN7 A;  2DAK A;  4EIW A;  1LTM A;  3KP1 E;  1L8Q A;  2M5Z A;  5C18 A;  4JI4 M;  5KQD A;  1R4G A;  1JR3 D;  1FNN A;  3E4R A;  3FUV A;  1QAM A;  2MRO B;  3PVS A;  1IBK M;  2R6F A;  3T6P A;  4LF6 M;  4IBB A;  5GKN A;  1QAQ A;  3E9S A;  3QAU A;  1DV0 A;  1QAN A;  1VG5 A;  1WGN A;  1ZAE A;  2M60 A;  4ANR A;  3U60 A;  1EE8 A;  2XZU A;  1VEK A;  1PJJ A;  4DR5 M;  1D0M A;  1T6O A;  3L28 A;  4I4L A;  2L2D A;  4CIZ A;  4ITQ A;  2DWM A;  1Q02 A;  3FRH A;  2DEN A;  1YUB A;  4LJ7 A;  5E26 A;  1ZQ9 A;  4AQY M;  2YFQ A;  4LCB A;  4P16 A;  4FWG A;  1NVM A;  3UK6 A;  3OTO M;  3V76 A;  1QQW A;  2R62 A;  3T1Y M;  2FNA A;  1L1T A;  4LGM A;  2F5P A;  1VEG A;  1G41 A;  5ITY A;  1NV9 A;  3HHZ A;  2KZS A;  3GPY A;  3J2P B;  3JR5 A;  3GRU A;  4DUY M;  1PJS A;  5EXX A;  4LF8 M;  1XXH A;  5IWA M;  1HR0 M;  2FS1 A;  4WW0 A;  2RRU A;  5KPZ A;  2XEP A;  2OPF A;  1A5T A;  1WXQ A;  3FKE A;  3E21 A;  4X65 M;  3B89 A;  1G3I A;  3HJ8 A;  3WHL A;  3SYL A;  3AV0 A;  4YY3 M;  5EXT A;  1MN3 A;  4JI1 M;  3R8F A;  2J7N A;  2HL7 A;  1J09 A;  3L25 A;  3HJS A;  2V1U A;  1UFZ A;  2VQF M;  4M9X A;  4JI7 M;  1KSF X;  2KHH A;  4R3D A;  2CV1 A;  3U6E A;  4K0K M;  1D0L A;  3M0E A;  5FTL A;  4L15 A;  1IN8 A;  2GNO A;  1IQP A;  3HHX A;  4LY6 A;  4Y28 F;  5BPV A;  3UGJ A;  3GLH B;  2HCB A;  4PT5 A;  3U6P A;  4MGK E;  2EUC A;  4IBI A;  1QVR A;  1SXJ A;  2K0B X;  2D7G A;  5L8R F;  2OQ4 A;  3FRI A;  4YHH M;  2JXN A;  3WHK A;  1R6B X;  1GKI A;  3SBJ A;  1XNR M;  1DO2 A;  1R2Y A;  4LGY A;  3J81 S;  2D7E A;  1Z59 A;  2QHO B;  2JNH A;  1Z5C A;  2QCU A;  3AL0 C;  2CHV A;  2BJW A;  2FH0 A;  1HQY E;  1NSF A;  1GLN A;  2HKJ A;  2OOA A;  4NSR A;  4AKI A;  2K47 A;  1W5T A;  2CRU A;  1VQ1 A;  1DGB A;  2L7H A;  2EJS A;  2RGH A;  2VII A;  4P17 A;  2O01 F;  2HHH M;  3I51 A;  2CHQ A;  2LVQ D;  3CTW B;  3J7A S;  1OJL A;  4FWH A;  4OW0 A;  3K92 A;  5EQT A;  3GLG A;  3TWM A;  4CGY B;  1E32 A;  3I01 M;  1E9S A;  1JR3 A;  4M0D A;  4KHP M;  3ZC7 B;  5IT9 S;  3KSJ A;  1NNU C;  3RGS A;  1IN4 A;  1G4A E;  2KA6 B;  5ITU A;  4DR2 M;  2F4V M;  4JN6 A;  4AZF A;  2I7N A;  2WZJ A;  4G3O A;  5FTJ A;  3PNY A;  4IBG A;  4AI6 A;  3I4Y A;  4D81 A;  4R71 A;  1T43 A;  4NC6 A;  4DR7 M;  3IEC A;  3RE8 A;  3B9P A;  3NBX X;  1QZM A;  4II7 A;  2QP9 X;  3SAU A;  1XC8 A;  2B3T A;  1L2C A;  1NJG A;  5E6J A;  2QQ8 A;  3HGI A;  2OOB A;  1IN5 A;  4LRT A;  1ZMV A;  2LBC A;  2JY7 A;  3HKP A;  2MJ5 B;  3I4V A;  2UXC M;  2Z4R A;  2L7I A;  2YQZ A;  1J7K A;  2HWJ A;  3FTE A;  5KPR A;  1TH4 A;  4LFC M;  1PM5 A;  2RKO A;  5JI2 E;  1WR1 B;  1RU3 A;  3NWL A;  2QPA A;  4B08 A;  1HNZ M;  5ITX A;  3C9P A;  4FWD A;  2ZTD A;  3GLF A;  3SAT A;  1TGU A;  2VF7 A;  1YSY A;  4M9Z A;  3LCV B;  3F92 A;  4NL4 H;  2Z3X A;  3LVV A;  1EIJ A;  5FLX S;  4G4N A;  2DWZ B;  2XLJ A;  2JZ1 A;  1GJT A;  1TTE A;  3EIH A;  1XMQ M;  3SAR A;  4JYA M;  5LMU M;  4Z6Y A;  3KP0 E;  3LMM A;  2LTU A;  2MH8 A;  2DZN B;  2H1R A;  2X8A A;  2D7H A;  3C3E A;  3KOW E;  3MHV C;  2N35 A;  3KFU G;  5IZ7 D;  5A2Q S;  2EKF A;  4JI8 M;  3SFZ A;  2LVO C;  4LFA M;  2R65 A;  3U6L A;  1NHW C;  3TPZ A;  1PRB A;  2UXD M;  5H37 D;  3L2A A;  3FUU A;  4MGI E;  3VDP A;  4DV5 M;  1JQJ C;  4WUR A;  3GQ5 A;  2QBY A;  4R7G A;  2JUJ A;  2DAI A;  2DAG A;  1Z5B A;  3ZQJ A;  1NO1 A;  4DR1 M;  1S3S A;  1SXJ B;  2O25 A;  4B7F A;  3CF2 A;  5F3W A;  2JP7 A;  2CV0 A;  1GVN A;  1SXJ C;  1VDD A;  2R4E A;  3U5Z B;  2YR0 A;  3GRR A;  4B3T M;  4JI6 M;  1SXJ E;  4HEO A;  2I7P A;  4A3V B;  1OQY A;  5ITR A;  2C5R A;  3RFW A;  2C96 A;  1QYR A;  1E9R A;  3LCU A;  2BWB A;  2W82 A;  4LF7 M;  1FJG M;  2WSC F;  2CE7 A;  3L29 A;  3SC3 A;  2KNV A;  3SHF A;  1L2D A;  4LFB M;  2KEB A;  4GC9 A;  4GIP A;  4LF9 M;  1IY0 A;  2UXB M;  2KNZ A;  2QSF X;  2RGO A;  2V1C A;  3GLI A;  4G4O A;  3U6M A;  1HNX M;  1HQC A;  1JR3 E;  2DAM A;  2XGN A;  3Q8G A;  4L16 A;  4G4Q A;  2LHG A;  1F4I A;  1IBL M;  1TH2 A;  5EXP A;  3U61 B;  4I81 A;  3SMS A;  3SMP A;  2XFS A;  4XGI A;  2XZF A;  3CF6 E;  2KDL A;  2WSF F;  4WP2 A;  3GO8 A;  2DAE A;  1XNQ M;  1ZV1 A;  4LG2 A;  1KYI A;  2WSE F;  2KW0 A;  2APL A;  4GEW A;  3VK8 A;  5FSW A;  4HL4 A;  3W0F A;  2MR9 A;  1X37 A;  1G71 A;  2LNH C;  5KPT A;  2BWE A;  4RF1 A;  3FUW A;  3KSX A;  4QNR A;  1L2B A;  3B74 A;  4F2L A;  3W67 A;  4LZZ A; 
#chains in the Genus database with same CATH homology
 1HNW M;  4D82 A;  4JV5 M;  2L6O A;  2BNK A;  5JI3 E;  3SAV A;  4PCZ A;  4B3S M;  3GLF B;  2A5Y B;  3A45 A;  4GKK M;  5BR8 M;  1IY1 A;  4LJ6 A;  4NOO B;  2ZAO A;  5ITX E;  2Y20 A;  5ITQ A;  3L27 A;  4QHT A;  2KXE A;  1I94 M;  3LVW A;  3NBI A;  5FTK A;  5EP4 A;  4KLN A;  1IN6 A;  4IJF A;  4IBJ A;  4BBA A;  3VKG A;  4JI3 M;  2C9O A;  4DV4 M;  4OVZ A;  1Q3C A;  4AKH A;  2QBY B;  1K82 A;  1LV7 A;  3U6O A;  1NJF A;  2F5Q A;  4GH9 A;  4FD2 A;  2J7O A;  4M9S A;  3U60 B;  3K2L A;  3HU1 A;  1IY2 A;  4AG5 A;  3A46 A;  1Z6T A;  3UMM A;  1N32 M;  4GIT A;  4QNM A;  3K8Z A;  5KQ8 A;  3UZU A;  1IBM M;  1TH3 A;  4NXM M;  4KOD A;  3LQR A;  4DR6 M;  3TL4 X;  1G8P A;  4L8R C;  3DA1 A;  3ZCB B;  1C1K A;  1MX0 A;  3KOY E;  2E5L M;  3T38 A;  3J80 S;  4LJA A;  5IRE B;  2FOI C;  3K1J A;  1TDZ A;  3MJ5 A;  3SHG B;  3SYK A;  2F5N A;  4CHT B;  2UU9 M;  4I8O A;  4LJ8 A;  1XXH B;  2LWX A;  1DGG A;  4MGH A;  2ZM6 M;  4DV3 M;  1HT1 E;  3TQS A;  3THG A;  3D8B A;  3BOS A;  4QHS A;  1OFI A;  3GLI B;  2XSZ A;  3AJI B;  2ZAN A;  1W5S A;  4NRV A;  4DV7 M;  3DZD A;  4NXN M;  1N78 A;  1G59 A;  3KVW A;  4GKJ M;  2C98 A;  5EP2 A;  1DGH A;  2XH9 A;  2G5G X;  3SAS A;  3FTD A;  3D8L A;  2C99 A;  5EP1 A;  3GLH A;  3UJN A;  3U6S A;  2R18 A;  4JI2 M;  3A98 B;  3AKZ A;  3LQQ A;  3HU3 A;  4JI0 M;  3TE6 A;  4LJ4 A;  4FCV A;  4G6Z A;  3EIE A;  4FCW A;  4KO8 A;  5DNY A;  4G4R A;  3T15 A;  1NY6 A;  1UM8 A;  3TWL A;  3U6D A;  3SAW A;  2V6Z M;  4MGY E;  3AFH A;  4GHL A;  5C1B A;  4S12 A;  4MB7 A;  4DV2 M;  1IXS B;  4TUW A;  4QOZ C;  4D80 A;  3VK7 A;  1N33 M;  4MH0 E;  3HHY A;  3AOE A;  4LZJ A;  1R7R A;  3CF0 A;  4GRI A;  5EXS A;  4Z8X A;  4M0W A;  4XBO A;  5EJC A;  4IBC A;  2KZU A;  2Z7J A;  2Y0T A;  3GLG B;  4DR3 M;  4CIS A;  1MU5 A;  2FE8 A;  2CV2 A;  2YNM D;  4LRS A;  3JAM S;  2DWL A;  3Q8X A;  3IG8 A;  4OVZ B;  3U6C A;  4DUZ M;  2CUZ A;  1H6U A;  4MM3 B;  2LH0 A;  4BLC A;  4IBD A;  2XSZ D;  4BB9 A;  3HJQ A;  4PDI A;  3GPP A;  5FTN A;  4X64 M;  3T1H M;  1GL6 A;  5DYI A;  1OFH A;  3KOX E;  2FFJ A;  4NSO B;  3FYD A;  2ERC A;  3AOG A;  2VQE M;  3R9X B;  2DVW B;  3FTC A;  4DV6 M;  3RGP A;  4JI5 M;  3GRV A;  3W0L B;  2Z4S A;  2KRK A;  2G8L A;  4RF0 A;  3VKH A;  4JXJ A;  4DR4 M;  1QAO A;  4X66 M;  1YE9 A;  1Q39 A;  2DHR A;  5KO3 A;  2UUC M;  4B7G A;  3GPU A;  3L26 A;  3HU2 A;  3GRY A;  2LXE A;  3C58 A;  2XF3 A;  5ITT A;  1D2N A;  3M7G A;  3DFZ A;  2AHM A;  4B7H A;  3H4M A;  4AKG A;  2KRU A;  4NRW A;  1N77 A;  4IBE A;  7CAT A;  2Q2E B;  2P5T A;  1IXZ A;  8CAT A;  3PFI A;  3FUT A;  3FD9 A;  3GQ4 A;  1N34 M;  4LF5 M;  3QWL A;  3TWK A;  1K3X A;  4RNA A;  4OX9 M;  4FW9 A;  4IJE A;  3VFD A;  3IG5 A;  2Y0Q A;  2X4A A;  3KW6 A;  2NQ8 C;  1DGH B;  3GPX A;  2ZBK B;  1E94 E;  1HT2 E;  1XMO M;  3VLF B;  2DZO B;  4PDG A;  2QEN A;  4FCT A;  4DV0 M;  1IM2 A;  1N75 A;  1DO0 A;  2R4J A;  1DGF A;  3HHW A;  3U5Z A;  1L1Z A;  1GL7 A;  3ZH9 B;  4X62 M;  2CEA A;  1TDH A;  1J5E M;  4IBF A;  4GC5 A;  1IXR C;  3GQ3 A;  3U6Q A;  1XHB A;  1Q3B A;  3MK6 A;  4B3R M;  4ZPX A;  4OU7 A;  4GHA A;  3KDS E;  1NY5 A;  4AG6 A;  3HWS A;  1ORY B;  2R45 A;  4IBK A;  1T3T A;  3FYC A;  3J27 B;  2DXI A;  5EP3 A;  1K3W A;  2QZ4 A;  4LJ9 A;  1KFV A;  4LF4 M;  3AOE C;  2ZAM A;  2JA2 A;  2O5R A;  2UUA M;  3KS8 A;  4I5S A;  3U61 A;  2Y21 A;  2R46 A;  4L78 A;  3GP1 A;  2UUB M;  4B3M M;  1NNJ A;  1XWI A;  4HLQ A;  5LMN M;  3JR4 A;  3A42 A;  4IIW A;  4REZ A;  3PNV A;  1PJI A;  3PXG A;  2F5O A;  3DOA A;  4MGZ E;  3FTF A;  1N36 M;  3J7B A;  2EA0 A;  1I4W A;  2XFT A;  4AW4 A;  2F5S A;  3KXE C;  4LJ5 A;  3VDU A;  2L09 A;  1SXJ D;  2DWN A;  4L4U A;  2CFO A;  2EO2 A;  4W5W A;  4QOS A;  3ILK A;  3KOZ E;  2BJV A;  5DYG A;  3FUX A;  4FVM A;  3M6A A;  3KS4 A;  1NHG C;  4GMQ A;  5FTM A;  2X49 A;  4DV1 M;  2CHG A;  1R2Z A;  4PD2 A;  1Z5A A;  2C9C A;  1IN7 A;  4EIW A;  3KP1 E;  1L8Q A;  2M5Z A;  5C18 A;  4JI4 M;  5KQD A;  1JR3 D;  1FNN A;  3E4R A;  3FUV A;  1QAM A;  3PVS A;  1IBK M;  4LF6 M;  4IBB A;  5GKN A;  1QAQ A;  3E9S A;  3QAU A;  1QAN A;  1ZAE A;  2M60 A;  3U60 A;  1EE8 A;  2XZU A;  1PJJ A;  4DR5 M;  3L28 A;  4I4L A;  4ITQ A;  2DWM A;  1YUB A;  4LJ7 A;  5E26 A;  1ZQ9 A;  4AQY M;  2YFQ A;  4LCB A;  4P16 A;  4FWG A;  1NVM A;  3UK6 A;  3OTO M;  1QQW A;  2R62 A;  3T1Y M;  2FNA A;  1L1T A;  4LGM A;  2F5P A;  1G41 A;  5ITY A;  3HHZ A;  2KZS A;  3GPY A;  3J2P B;  3JR5 A;  3GRU A;  4DUY M;  5EXX A;  4LF8 M;  1XXH A;  5IWA M;  1HR0 M;  4WW0 A;  5KPZ A;  2XEP A;  2OPF A;  1WXQ A;  3FKE A;  4X65 M;  1G3I A;  3HJ8 A;  3WHL A;  3SYL A;  3AV0 A;  4YY3 M;  5EXT A;  4JI1 M;  3R8F A;  2J7N A;  2HL7 A;  1J09 A;  3L25 A;  3HJS A;  2V1U A;  2VQF M;  4M9X A;  4JI7 M;  1KSF X;  4R3D A;  2CV1 A;  3U6E A;  4K0K M;  3M0E A;  5FTL A;  4L15 A;  1IN8 A;  4LY6 A;  1IQP A;  3HHX A;  5BPV A;  3UGJ A;  3GLH B;  2HCB A;  4PT5 A;  3U6P A;  4MGK E;  2EUC A;  4IBI A;  1QVR A;  1SXJ A;  2D7G A;  2OQ4 A;  4YHH M;  3WHK A;  1R6B X;  1GKI A;  3SBJ A;  1XNR M;  1DO2 A;  1R2Y A;  4LGY A;  3J81 S;  2D7E A;  1Z59 A;  1Z5C A;  2QCU A;  3AL0 C;  2CHV A;  2BJW A;  1HQY E;  1NSF A;  1GLN A;  2HKJ A;  4NSR A;  4AKI A;  1W5T A;  2K47 A;  1DGB A;  2L7H A;  2RGH A;  2VII A;  2HHH M;  3I51 A;  2CHQ A;  3CTW B;  3J7A S;  1OJL A;  4FWH A;  4OW0 A;  3K92 A;  5EQT A;  3GLG A;  3TWM A;  4CGY B;  1E32 A;  4KHP M;  1E9S A;  1JR3 A;  4M0D A;  3ZC7 B;  5IT9 S;  3KSJ A;  1NNU C;  3RGS A;  1IN4 A;  1G4A E;  2KA6 B;  5ITU A;  4DR2 M;  2F4V M;  4JN6 A;  4AZF A;  2I7N A;  5FTJ A;  3PNY A;  4IBG A;  4AI6 A;  3I4Y A;  4D81 A;  4DR7 M;  3RE8 A;  3B9P A;  4II7 A;  1QZM A;  2QP9 X;  3SAU A;  1XC8 A;  1L2C A;  1NJG A;  5E6J A;  3HGI A;  1IN5 A;  4LRT A;  3HKP A;  3I4V A;  2UXC M;  2Z4R A;  2L7I A;  2YQZ A;  1J7K A;  3FTE A;  5KPR A;  1TH4 A;  4LFC M;  1PM5 A;  2RKO A;  5JI2 E;  3NWL A;  4B08 A;  2QPA A;  1HNZ M;  5ITX A;  4FWD A;  3SAT A;  3GLF A;  1TGU A;  4M9Z A;  1YSY A;  4NL4 H;  2Z3X A;  3LVV A;  5FLX S;  4G4N A;  2DWZ B;  2XLJ A;  3EIH A;  1XMQ M;  3SAR A;  4JYA M;  5LMU M;  4Z6Y A;  3KP0 E;  3LMM A;  2DZN B;  2H1R A;  2X8A A;  2D7H A;  3KOW E;  3MHV C;  3KFU G;  5IZ7 D;  5A2Q S;  4JI8 M;  3SFZ A;  4LFA M;  2R65 A;  3U6L A;  1NHW C;  3TPZ A;  2UXD M;  5H37 D;  3L2A A;  3FUU A;  4MGI E;  3VDP A;  4DV5 M;  1JQJ C;  4WUR A;  3GQ5 A;  2QBY A;  4R7G A;  1Z5B A;  4DR1 M;  1S3S A;  1SXJ B;  4B7F A;  3CF2 A;  5F3W A;  2CV0 A;  1GVN A;  1SXJ C;  1VDD A;  2R4E A;  3U5Z B;  2YR0 A;  3GRR A;  4B3T M;  4JI6 M;  1SXJ E;  2I7P A;  4A3V B;  5ITR A;  2C5R A;  3RFW A;  2C96 A;  1QYR A;  1E9R A;  2W82 A;  4LF7 M;  1FJG M;  3L29 A;  2CE7 A;  3SC3 A;  3SHF A;  1L2D A;  4LFB M;  2KEB A;  4GC9 A;  4GIP A;  4LF9 M;  1IY0 A;  2UXB M;  2V1C A;  2RGO A;  3GLI A;  4G4O A;  3U6M A;  1HNX M;  1HQC A;  4L16 A;  2XGN A;  4G4Q A;  1IBL M;  1TH2 A;  5EXP A;  3U61 B;  4I81 A;  3SMS A;  3SMP A;  2XFS A;  4XGI A;  2XZF A;  3CF6 E;  3GO8 A;  1XNQ M;  4LG2 A;  1KYI A;  2KW0 A;  3VK8 A;  5FSW A;  4HL4 A;  3W0F A;  1X37 A;  2LNH C;  5KPT A;  4RF1 A;  3FUW A;  3KSX A;  4QNR A;  1L2B A;  4LZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...