2M5ZA

Enterocin 7a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
b'GAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterocin JSA
molecule tags Antimicrobial protein
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
total genus 7
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2013-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m5zA00
2M5ZA 2M60A
chains in the Genus database with same CATH superfamily
3GP1A 1NNUC 1IFYA 3I01M 4MGYE 3E4RA 4X62M 4JYAM 1A5TA 4DV0M 4LJ9A 4JXJA 3EIEA 2B3TA 1WGNA 2R0IA 2OPFA 3HKPA 3LMMA 1L2BA 1IXZA 1ZQ9A 2C99A 2XSZA 3AFHA 1DGHA 3HZJA 1WJ7A 4Y28F 5EXPA 2LVNC 3GPPA 1NHWC 2R62A 2JY8A 4UN2B 1GABA 2QZ4A 1VEJA 1XNRM 3VKHA 1WGLA 2BJVA 2YNMD 1PJJA 3MMPA 2XEPA 5C1BA 1IM2A 2W82A 1QZEA 4PD2A 1HNZM 3FUTA 3T6PA 2R46A 4JI0M 3E21A 2L7HA 3SHFA 4IBIA 1PJQA 3VK8A 1EE8A 2XFTA 4G6ZA 1NJGA 2HHHM 2WSCF 3HU1A 1AUAA 3K8ZA 4KT0F 1GL6A 3A46A 4MGIE 4LG2A 4D82A 1QANA 2C98A 2HL7A 4X65M 2ZAMA 2F5SA 2R4EA 3LCVB 1QDRA 5FTKA 3B9PA 3GPUA 1L8QA 2Q2EB 1G41A 2GQFA 3UGJA 4G4RA 4GKJM 2V6ZM 1TTEA 2BWBA 4MM3B 3SMPA 2VQEM 4ITQA 3BOSA 3L28A 4LJ7A 3R9XB 3SYKA 3VKGA 2DHRA 2UU9M 4GC9A 1C7YA 2E5LM 2N35A 2QP9X 1PGYA 3GPYA 1TH3A 1NY5A 1QZMA 3CF2A 4XGIA 5EXXA 3V76A 5JI2E 3U6LA 3J2PB 3KOZE 3MJ5A 4OX9M 4IBJA 3U60B 3GLHA 2KXEA 3U5ZB 3HHXA 2AHMA 2D7EA 2G5GX 2RRUA 4M9ZA 1X37A 2EO2A 1OIZA 1DV0A 4R7GA 3NWLA 1TR8A 1Z6TA 4CGYB 4GIPA 1N78A 4R3DA 3AL0C 3FKEA 4L6V6 2YQZA 4I5SA 1XNQM 4FCTA 2CHGA 2GNOA 1DO2A 2F5OA 1TDHA 4GMQA 4GEWA 1TH4A 4WURA 1UM8A 1VQ1A 2KDLA 1IY2A 3JR4A 3GLGE 4DV7M 1NSFA 1TH2A 2CV2A 4JI5M 2UUAM 1WXQA 3OTOM 4D80A 3D8BA 3C9PA 5F3WA 2LH0A 3BBZA 5KQDA 5KO3A 4LFAM 2FNAA 2DWMA 2KNAA 3VK7A 1D2NA 3U60A 4DV2M 3RGPA 1WHCA 4P16A 3HU2A 3GQ5A 1IY0A 2D7GA 3AKZA 2R65A 4WW0A 2J7NA 5LMNM 5E26A 4LZZA 3U61B 2C5RA 2QBYB 1VDLA 2EUCA 3KOYE 1SXJC 2CFOA 4MGZE 2Z7JA 5ITRA 3I4VA 3PVSA 4TUWA 2EJSA 1K3WA 4IJEA 2LHGA 1UFZA 5GKNA 5FTLA 1KFVA 1SXJE 4LZJA 1NVMA 3D8LA 3J7AS 4P17A 4FD2A 3W0FA 1IN5A 3FUXA 2LWXA 1DGGA 3DZDA 1NNJA 2VDBB 1QVRA 2QQ8A 2ZBKB 5FSWA 1QQWA 1Z5BA 4QHSA 1V92A 2J5YA 3IECA 3A42A 3SHGB 2JZ0A 3A98B 4IBCA 1QAMA 2LNHC 2C9OA 2ERCA 2Y21A 2ZTCA 3NBXX 4LF4M 3THGA 3GLIA 4B3RM 3GRYA 5EXTA 1N34M 4MGHA 1DGBA 3TQSA 2APLA 3HWSA 1SXJD 4HLQA 5H37D 4II7A 5FTMA 7CATA 2CHVA 3T38A 2RKOA 2LBCA 2C9CA 1DGHB 4IJFA 1JR3D 2DAMA 2HWJA 2VF7A 4PT5A 5FTNA 2O01F 5ITYA 3EIHA 2MJ5B 4G4NA 2DAEA 2KRKA 4DV1M 3K2LA 1R7RA 4DR5M 4QHTA 2HCBA 4LJAA 1Z5AA 3FUVA 3WHLA 1XWIA 3QWLA 1L1ZA 2H5XA 3U61A 2F5NA 4NSRA 4DR4M 1YLAA 1GKIA 1H6UA 3KVWA 1HT1E 1R5LA 4JI2M 3FTCA 3L2AA 1SXJA 4BBAA 2XZFA 1HQCA 2K47A 1MX0A 1Z5CA 3M0EA 4M9XA 5KPZA 4X64M 2YR0A 4I8OA 1G8PA 1N33M 4FVMA 1D0MA 1QDTA 4WP2A 3RGSA 3SMSA 2LHCA 2OOAA 3HGIA 1FNNA 4FWGA 3CGWA 2L7IA 5ITXA 1IN7A 1T3TA 2BNKA 2DWNA 3GQ4A 4JI3M 5FTJA 2QPAA 3FTDA 3GLIE 1NHGC 3CF6E 1TF0B 1T6OA 3PNYA 1GJSA 2MROB 4JI1M 4GRIA 1I4WA 4S12A 3VDUA 3GO8A 1IBKM 3I51A 1OFIA 3B89A 1WIVA 1IN8A 2WSFF 4YY3M 2VIIA 2J7OA 2XZUA 4B7FA 4LJ5A 4NXNM 1YUBA 3FTFA 1V34A 1NV8A 4QNRA 2LXEA 4AG5A 4JI7M 3VDPA 1S3SA 4DV6M 3FYDA 1P3QQ 3DA1A 2JNHA 4JI6M 1C1KA 3NBIA 1J7KA 4NL4H 5IWAM 1MJGM 4L15A 1NY6A 1NO1A 4G4OA 5DFLA 1L2DA 2O5RA 1R4GA 1ZMWA 2R44A 2O25A 2QCUA 1IQPA 1OKSA 4XBOA 4JI4M 3BXWA 1JB0F 2R18A 3KOXE 4LY6A 2I7NA 4OVZA 3W0LB 3L26A 5EP1A 3GLFB 4DUYM 3SARA 3FYCA 2JY5A 2QHOB 4GHLA 3IG5A 1QAQA 1D0KA 4FW9A 3LVVA 1AIPC 2RGOA 2F5PA 2UXCM 3K1JA 3U6CA 1JR3E 3Q8XA 5ITTA 4KHPM 4B7HA 2M60A 3PNVA 3FD9A 2VF8A 2D7HA 2JY7A 3SFZA 4PCZA 4IIWA 2Y0TA 3HJSA 3QAUA 2LVPC 4G3OA 3W68A 4D81A 3HY5A 2F5QA 2BJWA 5KPRA 1I94M 2DXIA 2DNAA 3TWLA 1VG5A 2LTUA 3CTWB 3SAWA 4M0WA 4KO8A 4DV3M 4DR3M 2X8AA 4KLNA 4RF0A 4AKGA 1TGUA 3MHVC 3TPZA 3FTEA 1QAOA 3LCUA 3GLGB 4CISA 3HU3A 1WR1B 1FJGM 1Q02A 4QNMA 2M5ZA 4B3MM 2HKJA 3E9SA 1OAIA 4IBGA 1G71A 2MR9A 2R4JA 1GVNA 2I7PA 3SAVA 4GC5A 1Y8GA 5EXSA 4OW0A 1GL7A 2QBYA 3K92A 1HR0M 1TDZA 4GITA 3UZUA 3WHKA 3U6SA 2CE7A 1DGFA 3L27A 4QOSA 4FWDA 3ZC7B 3UJNA 3SASA 2UUCM 2L09A 5DYIA 2L4EA 3U6MA 2K6BA 2KZSA 3U6PA 3FUUA 1XHBA 3HHZA 2L6OA 2QNJA 2X4AA 1DO0A 3KDSE 4IBEA 4L16A 2JY6B 4B3SM 3LW5F 2G3QA 1Q3BA 2BWEA 4LJ6A 4RNAA 3GPXA 4AZFA 3L25A 1G4AE 5EP4A 4PDIA 4L4UA 1BVSA 3L29A 3MK6A 4JV5M 3PXGA 4RF1A 2XF3A 4NRWA 2L4FA 4LJ4A 5LMUM 2LVQD 1YE9A 2DVWB 1KYIA 5IT9S 3F92A 4LCBA 3VLFB 3GRRA 3HHYA 2OQ4A 4EIWA 3U6QA 1GO5A 3HHWA 2CRUA 2DZOB 2WSEF 1V33A 2X49A 4LGYA 1HT2E 5EP3A 1PJIA 2Z4SA 2OOBA 2DAIA 1OTRA 2KA6B 3HJQA 3KXEC 5BR8M 2Z3XA 1K82A 3AV0A 3IG8A 5BPVA 3LQQA 4LRTA 3U5ZA 2HAKA 3ZCBB 2JA2A 5ITXE 1LTMA 4JI8M 1G59A 1MU5A 2EKFA 1ZMUA 4FWHA 2KRUA 1OIPA 4XK8F 2CUZA 1J5EM 3CF0A 4LF5M 2JP7A 1NJFA 1OQYA 4Q7JA 1CUKA 4CIZA 2DAKA 3ZQJA 1L2CA 3J80S 1XB2B 4LF8M 4B08A 2KW0A 1VEGA 2Y20A 2DWZB 3AJIB 4M9SA 5EP2A 2H1RA 1E9RA 2CV0A 4CJ6A 1NV9A 2KHHA 4OU7A 1QUTA 2DKLA 4K0KM 3KFUG 4NOOB 3JAMS 4AKIA 4AI6A 5EQTA 1VEKA 2P5TA 1QYRA 3LQRA 2KZUA 3Q8GA 3VFDA 2EA0A 3GLIB 4HL4A 2MH8A 1T43A 1Q39A 5IREB 1GLNA 4LFCM 3FRIA 1W5TA 4R71A 1SG9A 4Z8XA 2K9DA 4DR6M 2QENA 1N32M 2KEBA 3HJ8A 3C58A 4G4QA 4Z6YA 4IBFA 5ITQA 3LVWA 1HNXM 3SC3A 1KSFX 1D0LA 2DHYA 3ILKA 3J27B 3KOWE 4F2LA 5C18A 4DUZM 2YFQA 4LF6M 4DR1M 5E6JA 1IN6A 4MB7A 1JQJC 4LGMA 1E32A 1HJPA 3B7QA 1Z59A 4DR7M 2Z4RA 1JR3A 3GRUA 2CEAA 4L8RC 4LFBM 5L8RF 3K9PA 4DV4M 3W67A 1J09A 2WZJA 5KQ8A 3KP1E 4YHHM 3ZH9B 3DOAA 3TWMA 3T15A 1IXSA 3FUWA 4NRVA 5FLXS 3GLGA 4ANRA 2DZLA 3UMMA 3M6AA 2CHQA 3T1YM 2FE8A 1XC8A 4LRSA 2UXDM 2ZTDA 3SAUA 4FCVA 1VDDA 2EKKA 4MH0E 2LVOC 4A3VB 4AQYM 4AKHA 1Q3CA 1ZV1A 2ZAOA 3KW6A 4RKUF 4AW4A 4F1IA 4LF7M 3QYEA 1ZMVA 3H4JA 4DBGB 4QOZC 2C96A 3FRHA 4X66M 3KSJA 3GLFE 3SATA 4GKKM 2JUJA 2KNZA 1XMQM 1PJSA 1XXHB 4AG6A 2RGHA 5DNYA 3J7BA 1OJLA 1OAOC 2JXNA 2OO9A 3K9OA 2DENA 2CWBA 1PJTA 8CATA 3GLFA 4OVZB 2G8LA 5EJCA 3GQ3A 1N77A 4NXMM 1RU3A 4GHAA 1GJTA 3GRVA 1HNWM 2V1UA 2XGNA 2K0BX 1IBLM 3TL4X 1ORYB 5A2QS 4IBDA 5DYGA 3HX3A 5KPTA 1LV7A 4NC6A 3KP0E 1IY1A 1YSYA 4IBKA 2NQ8C 2DAGA 4FCWA 2DWLA 3GLHB 3RFWA 2KNVA 2QSFX 1XMOM 1IN4A 3B7NA 1N75A 3AOEA 1PM5A 3IHPA 2XH9A 2DZNB 2R6FA 3J81S 3C3EA 2JZ1A 3SBJA 3QYBA 1E9SA 2DI0A 2LVAA 4I4LA 1R2YA 4HEOA 3C3DA 2XFSA 2ZM6M 1IXRC 1R6BX 4ZPXA 5ITUA 3H4MA 3U6DA 3M7GA 3I04M 3U6EA 1PRBA 2JWSA 1QUSA 5JI3E 2V1CA 3DFZA 3R8FA 2FS1A 1ZAEA 4B7GA 1F4IA 3B74A 2VQFM 2CV1A 4LJ8A 3KS8A 1R2ZA 3KSXA 4LF9M 1XXHA 3AOEC 3RE8A 2UUBM 4L78A 1E94E 3AOGA 1MN3A 4CHTB 2R45A 2FFJA 3GLHE 1XXHE 2MGWA 2Y0QA 3FE3A 2CP8A 3UK6A 4BLCA 4B3TM 4BB9A 1HQYE 3B7ZA 2ZANA 4GH9A 4IBBA 3E46A 3PFIA 2L2DA 3U6OA 3T1HM 1W5SA 5IZ7D 4NSOB 4REZA 3KS4A 3TE6A 4MGKE 2XLJA 4W5WA 4DV5M 1N36M 1K3XA 3A45A 1SXJB 1G3IA 2FH0A 4M0DA 4JN6A 4PDGA 3JR5A 2F4VM 4I81A 1EFUB 1L1TA 2UXBM 2A5YB 1IXSB 2FOIC 3SYLA 2XSZD 2Z8YM 1IBMM 1OFHA 4KODA 3TWKA 1EIJA 3I4YA 4DR2M
chains in the Genus database with same CATH topology
3GP1A 1NNUC 4MGYE 3E4RA 4X62M 4JYAM 4DV0M 4LJ9A 4JXJA 3EIEA 2OPFA 3HKPA 3LMMA 1L2BA 1IXZA 1ZQ9A 2C99A 2XSZA 3AFHA 1DGHA 5EXPA 4DV2M 3GPPA 1NHWC 2R62A 2QZ4A 1XNRM 3VKHA 2BJVA 2YNMD 1PJJA 5C1BA 2XEPA 1IM2A 2W82A 4PD2A 1HNZM 3FUTA 2R46A 4JI0M 2L7HA 3SHFA 4IBIA 3VK8A 1EE8A 2XFTA 4G6ZA 1NJGA 2HHHM 3K8ZA 3HU1A 1GL6A 3A46A 4MGIE 4LG2A 4D82A 1QANA 2C98A 2HL7A 4X65M 2ZAMA 2F5SA 2R4EA 5FTKA 3B9PA 3GPUA 1L8QA 2Q2EB 1G41A 3UGJA 4G4RA 4GKJM 2V6ZM 4MM3B 2VQEM 3SMPA 4ITQA 3BOSA 3L28A 4LJ7A 3R9XB 3SYKA 3VKGA 2DHRA 2UU9M 4GC9A 2E5LM 2QP9X 3GPYA 1TH3A 1NY5A 1QZMA 3CF2A 4XGIA 5EXXA 5JI2E 3U6LA 4OX9M 3J2PB 3KOZE 3MJ5A 4IBJA 3U60B 3GLHA 2KXEA 3U5ZB 3HHXA 2AHMA 2D7EA 2G5GX 4M9ZA 1X37A 2EO2A 4R7GA 3NWLA 1Z6TA 4CGYB 4GIPA 1N78A 4R3DA 3AL0C 3FKEA 2YQZA 4I5SA 1XNQM 4FCTA 2CHGA 1DO2A 2F5OA 1TDHA 4GMQA 1TH4A 4WURA 1UM8A 1IY2A 3JR4A 4DV7M 1NSFA 1TH2A 2CV2A 4JI5M 2UUAM 1WXQA 3OTOM 4D80A 3D8BA 5F3WA 2LH0A 5KO3A 5KQDA 4LFAM 2FNAA 2DWMA 3VK7A 1D2NA 3U60A 3RGPA 4P16A 3HU2A 3GQ5A 1IY0A 2D7GA 3AKZA 2R65A 4WW0A 2J7NA 5LMNM 5E26A 4LZZA 3U61B 2C5RA 2QBYB 3KOYE 2EUCA 1SXJC 2CFOA 4MGZE 2Z7JA 5ITRA 3I4VA 3PVSA 4TUWA 1K3WA 4IJEA 5GKNA 5FTLA 1KFVA 1SXJE 4LZJA 3D8LA 1NVMA 3J7AS 3W0FA 4FD2A 1IN5A 3FUXA 2LWXA 1DGGA 3DZDA 1NNJA 1QVRA 2ZBKB 5FSWA 1QQWA 1Z5BA 4QHSA 3SHGB 3A42A 3A98B 4IBCA 1QAMA 2LNHC 2C9OA 2ERCA 2Y21A 4LF4M 3THGA 3GLIA 4B3RM 3GRYA 5EXTA 1N34M 4MGHA 1DGBA 3TQSA 3HWSA 1SXJD 4HLQA 5H37D 4II7A 5FTMA 7CATA 2CHVA 3T38A 2RKOA 2C9CA 1DGHB 4IJFA 1JR3D 4PT5A 5FTNA 5ITYA 3EIHA 4G4NA 2KRKA 4DV1M 3K2LA 1R7RA 4DR5M 4QHTA 2HCBA 4LJAA 1Z5AA 3FUVA 3WHLA 1XWIA 3QWLA 1L1ZA 3U61A 2F5NA 4NSRA 4DR4M 1GKIA 1H6UA 3KVWA 1HT1E 4JI2M 3FTCA 3L2AA 1SXJA 4BBAA 2XZFA 1HQCA 2K47A 1MX0A 1Z5CA 3M0EA 4M9XA 5KPZA 4X64M 2YR0A 4I8OA 1G8PA 1N33M 4FVMA 3SMSA 3RGSA 3HGIA 1FNNA 4FWGA 2L7IA 5ITXA 1IN7A 1T3TA 2BNKA 2DWNA 3GQ4A 4JI3M 5FTJA 2QPAA 3FTDA 1NHGC 3CF6E 3PNYA 4JI1M 4GRIA 1I4WA 4S12A 3VDUA 3GO8A 1IBKM 3I51A 1OFIA 1IN8A 4YY3M 2VIIA 2J7OA 2XZUA 4B7FA 4LJ5A 4NXNM 1YUBA 3FTFA 4QNRA 2LXEA 4AG5A 4JI7M 3VDPA 1S3SA 4DV6M 3FYDA 3DA1A 4JI6M 1C1KA 3NBIA 1J7KA 4NL4H 5IWAM 4L15A 1NY6A 4G4OA 1L2DA 2O5RA 2QCUA 1IQPA 4XBOA 4JI4M 2R18A 3KOXE 4LY6A 2I7NA 4OVZA 3W0LB 3L26A 5EP1A 3GLFB 4DUYM 3SARA 3FYCA 4GHLA 3IG5A 1QAQA 4FW9A 3LVVA 2RGOA 2F5PA 2UXCM 3K1JA 3U6CA 3Q8XA 5ITTA 4KHPM 4B7HA 2M60A 3PNVA 3FD9A 2D7HA 4PCZA 3SFZA 4PDGA 4IIWA 2Y0TA 3HJSA 3QAUA 4D81A 2F5QA 2DXIA 2BJWA 5KPRA 1I94M 3TWLA 3CTWB 3SAWA 4M0WA 4KO8A 4DV3M 4DR3M 2X8AA 4KLNA 4RF0A 4AKGA 1TGUA 3MHVC 3TPZA 3FTEA 1QAOA 3GLGB 4CISA 3HU3A 1FJGM 4QNMA 2M5ZA 4B3MM 2HKJA 3E9SA 4IBGA 2R4JA 1GVNA 2I7PA 3SAVA 4GC5A 5EXSA 4OW0A 1GL7A 2QBYA 3K92A 1HR0M 1TDZA 4GITA 3UZUA 3WHKA 3U6SA 2CE7A 1DGFA 3L27A 4QOSA 4FWDA 3ZC7B 3UJNA 3SASA 2UUCM 2L09A 5DYIA 3U6MA 3U6PA 2KZSA 3FUUA 1XHBA 3HHZA 2L6OA 2X4AA 1DO0A 3KDSE 4IBEA 4L16A 4B3SM 1Q3BA 4RNAA 4LJ6A 3GPXA 4AZFA 3L25A 1G4AE 5EP4A 4PDIA 4L4UA 3L29A 3MK6A 4JV5M 3PXGA 4RF1A 2XF3A 4NRWA 4LJ4A 5LMUM 1YE9A 2DVWB 1KYIA 5IT9S 4LCBA 3VLFB 3GRRA 3HHYA 2OQ4A 4EIWA 3U6QA 3HHWA 2DZOB 4LGYA 5EP3A 2X49A 1HT2E 1PJIA 2Z4SA 3KXEC 2KA6B 3HJQA 5BR8M 2Z3XA 1K82A 3AV0A 3IG8A 5BPVA 3LQQA 4LRTA 3U5ZA 3ZCBB 2JA2A 5ITXE 4JI8M 1G59A 1MU5A 4FWHA 2KRUA 2CUZA 1J5EM 3CF0A 4LF5M 1NJFA 1L2CA 3J80S 4LF8M 4B08A 2KW0A 2Y20A 2DWZB 3AJIB 4M9SA 5EP2A 2H1RA 1E9RA 2CV0A 4OU7A 4K0KM 3KFUG 4NOOB 3JAMS 4AKIA 4AI6A 5EQTA 2P5TA 3LQRA 1QYRA 2KZUA 3VFDA 2EA0A 3GLIB 4HL4A 5IREB 1Q39A 1GLNA 4LFCM 1W5TA 4Z8XA 4DR6M 1N32M 2QENA 2KEBA 3HJ8A 3C58A 4G4QA 4Z6YA 4IBFA 5ITQA 3LVWA 1HNXM 3SC3A 1KSFX 3ILKA 3J27B 3KOWE 5C18A 4DUZM 2YFQA 4LF6M 4DR1M 5E6JA 1IN6A 4MB7A 1JQJC 4LGMA 1E32A 1Z59A 4DR7M 2Z4RA 1JR3A 3GRUA 2CEAA 4L8RC 4LFBM 4DV4M 1J09A 4YHHM 5KQ8A 3KP1E 3ZH9B 3DOAA 3TWMA 3T15A 3FUWA 4NRVA 5FLXS 3GLGA 3UMMA 3M6AA 2CHQA 3T1YM 2FE8A 1XC8A 4LRSA 2UXDM 3SAUA 4FCVA 1VDDA 4AQYM 4MH0E 4A3VB 4AKHA 1Q3CA 2ZAOA 3KW6A 4AW4A 4LF7M 4QOZC 2C96A 4X66M 3KSJA 3SATA 4GKKM 1XMQM 4AG6A 1XXHB 2RGHA 5DNYA 3J7BA 1OJLA 8CATA 3GLFA 1N77A 4OVZB 2G8LA 5EJCA 3GQ3A 4NXMM 4GHAA 3GRVA 1HNWM 2V1UA 2XGNA 1IBLM 3TL4X 1ORYB 5A2QS 4IBDA 5DYGA 5KPTA 1LV7A 3KP0E 1IY1A 1YSYA 4IBKA 2NQ8C 4FCWA 2DWLA 3GLHB 3RFWA 1XMOM 1IN4A 1N75A 3AOEA 1PM5A 2XH9A 2DZNB 3J81S 3SBJA 4I4LA 1E9SA 1R2YA 2XFSA 2ZM6M 1IXRC 1R6BX 4ZPXA 5ITUA 3H4MA 3U6DA 3M7GA 3U6EA 5JI3E 2V1CA 3DFZA 3R8FA 1ZAEA 4B7GA 2VQFM 2CV1A 4LJ8A 3KS8A 1R2ZA 3KSXA 4LF9M 1XXHA 3AOEC 3RE8A 2UUBM 4L78A 1E94E 3AOGA 4CHTB 2R45A 2FFJA 2Y0QA 4BLCA 3UK6A 4B3TM 4BB9A 1HQYE 2ZANA 4GH9A 4IBBA 3PFIA 3T1HM 3U6OA 1W5SA 5IZ7D 4NSOB 4REZA 3KS4A 3TE6A 4MGKE 2XLJA 4W5WA 4DV5M 1N36M 1K3XA 3A45A 1SXJB 1G3IA 4M0DA 4JN6A 3JR5A 2F4VM 4I81A 1L1TA 2UXBM 2A5YB 1IXSB 2FOIC 3SYLA 2XSZD 1IBMM 1OFHA 4KODA 3TWKA 3I4YA 4DR2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5Z A;  2M60 A; 
#chains in the Genus database with same CATH topology
 3GP1 A;  1NNU C;  1IFY A;  3I01 M;  4MGY E;  3E4R A;  4X62 M;  4JYA M;  1A5T A;  4DV0 M;  4LJ9 A;  4JXJ A;  3EIE A;  2B3T A;  1WGN A;  2R0I A;  2OPF A;  3HKP A;  3LMM A;  1L2B A;  1IXZ A;  1ZQ9 A;  2C99 A;  2XSZ A;  3AFH A;  1DGH A;  3HZJ A;  1WJ7 A;  4Y28 F;  5EXP A;  2LVN C;  3GPP A;  1NHW C;  2R62 A;  2JY8 A;  4UN2 B;  1GAB A;  2QZ4 A;  1VEJ A;  1XNR M;  3VKH A;  1WGL A;  2BJV A;  2YNM D;  1PJJ A;  3MMP A;  2XEP A;  5C1B A;  1IM2 A;  2W82 A;  1QZE A;  4PD2 A;  1HNZ M;  3FUT A;  3T6P A;  2R46 A;  4JI0 M;  3E21 A;  2L7H A;  3SHF A;  4IBI A;  1PJQ A;  3VK8 A;  1EE8 A;  2XFT A;  4G6Z A;  1NJG A;  2HHH M;  2WSC F;  3HU1 A;  1AUA A;  3K8Z A;  4KT0 F;  1GL6 A;  3A46 A;  4MGI E;  4LG2 A;  4D82 A;  1QAN A;  2C98 A;  2HL7 A;  4X65 M;  2ZAM A;  2F5S A;  2R4E A;  3LCV B;  1QDR A;  5FTK A;  3B9P A;  3GPU A;  1L8Q A;  2Q2E B;  1G41 A;  2GQF A;  3UGJ A;  4G4R A;  4GKJ M;  2V6Z M;  1TTE A;  2BWB A;  4MM3 B;  3SMP A;  2VQE M;  4ITQ A;  3BOS A;  3L28 A;  4LJ7 A;  3R9X B;  3SYK A;  3VKG A;  2DHR A;  2UU9 M;  4GC9 A;  1C7Y A;  2E5L M;  2N35 A;  2QP9 X;  1PGY A;  3GPY A;  1TH3 A;  1NY5 A;  1QZM A;  3CF2 A;  4XGI A;  5EXX A;  3V76 A;  5JI2 E;  3U6L A;  3J2P B;  3KOZ E;  3MJ5 A;  4OX9 M;  4IBJ A;  3U60 B;  3GLH A;  2KXE A;  3U5Z B;  3HHX A;  2AHM A;  2D7E A;  2G5G X;  2RRU A;  4M9Z A;  1X37 A;  2EO2 A;  1OIZ A;  1DV0 A;  4R7G A;  3NWL A;  1TR8 A;  1Z6T A;  4CGY B;  4GIP A;  1N78 A;  4R3D A;  3AL0 C;  3FKE A;  4L6V 6;  2YQZ A;  4I5S A;  1XNQ M;  4FCT A;  2CHG A;  2GNO A;  1DO2 A;  2F5O A;  1TDH A;  4GMQ A;  4GEW A;  1TH4 A;  4WUR A;  1UM8 A;  1VQ1 A;  2KDL A;  1IY2 A;  3JR4 A;  3GLG E;  4DV7 M;  1NSF A;  1TH2 A;  2CV2 A;  4JI5 M;  2UUA M;  1WXQ A;  3OTO M;  4D80 A;  3D8B A;  3C9P A;  5F3W A;  2LH0 A;  3BBZ A;  5KQD A;  5KO3 A;  4LFA M;  2FNA A;  2DWM A;  2KNA A;  3VK7 A;  1D2N A;  3U60 A;  4DV2 M;  3RGP A;  1WHC A;  4P16 A;  3HU2 A;  3GQ5 A;  1IY0 A;  2D7G A;  3AKZ A;  2R65 A;  4WW0 A;  2J7N A;  5LMN M;  5E26 A;  4LZZ A;  3U61 B;  2C5R A;  2QBY B;  1VDL A;  2EUC A;  3KOY E;  1SXJ C;  2CFO A;  4MGZ E;  2Z7J A;  5ITR A;  3I4V A;  3PVS A;  4TUW A;  2EJS A;  1K3W A;  4IJE A;  2LHG A;  1UFZ A;  5GKN A;  5FTL A;  1KFV A;  1SXJ E;  4LZJ A;  1NVM A;  3D8L A;  3J7A S;  4P17 A;  4FD2 A;  3W0F A;  1IN5 A;  3FUX A;  2LWX A;  1DGG A;  3DZD A;  1NNJ A;  2VDB B;  1QVR A;  2QQ8 A;  2ZBK B;  5FSW A;  1QQW A;  1Z5B A;  4QHS A;  1V92 A;  2J5Y A;  3IEC A;  3A42 A;  3SHG B;  2JZ0 A;  3A98 B;  4IBC A;  1QAM A;  2LNH C;  2C9O A;  2ERC A;  2Y21 A;  2ZTC A;  3NBX X;  4LF4 M;  3THG A;  3GLI A;  4B3R M;  3GRY A;  5EXT A;  1N34 M;  4MGH A;  1DGB A;  3TQS A;  2APL A;  3HWS A;  1SXJ D;  4HLQ A;  5H37 D;  4II7 A;  5FTM A;  7CAT A;  2CHV A;  3T38 A;  2RKO A;  2LBC A;  2C9C A;  1DGH B;  4IJF A;  1JR3 D;  2DAM A;  2HWJ A;  2VF7 A;  4PT5 A;  5FTN A;  2O01 F;  5ITY A;  3EIH A;  2MJ5 B;  4G4N A;  2DAE A;  2KRK A;  4DV1 M;  3K2L A;  1R7R A;  4DR5 M;  4QHT A;  2HCB A;  4LJA A;  1Z5A A;  3FUV A;  3WHL A;  1XWI A;  3QWL A;  1L1Z A;  2H5X A;  3U61 A;  2F5N A;  4NSR A;  4DR4 M;  1YLA A;  1GKI A;  1H6U A;  3KVW A;  1HT1 E;  1R5L A;  4JI2 M;  3FTC A;  3L2A A;  1SXJ A;  4BBA A;  2XZF A;  1HQC A;  2K47 A;  1MX0 A;  1Z5C A;  3M0E A;  4M9X A;  5KPZ A;  4X64 M;  2YR0 A;  4I8O A;  1G8P A;  1N33 M;  4FVM A;  1D0M A;  1QDT A;  4WP2 A;  3RGS A;  3SMS A;  2LHC A;  2OOA A;  3HGI A;  1FNN A;  4FWG A;  3CGW A;  2L7I A;  5ITX A;  1IN7 A;  1T3T A;  2BNK A;  2DWN A;  3GQ4 A;  4JI3 M;  5FTJ A;  2QPA A;  3FTD A;  3GLI E;  1NHG C;  3CF6 E;  1TF0 B;  1T6O A;  3PNY A;  1GJS A;  2MRO B;  4JI1 M;  4GRI A;  1I4W A;  4S12 A;  3VDU A;  3GO8 A;  1IBK M;  3I51 A;  1OFI A;  3B89 A;  1WIV A;  1IN8 A;  2WSF F;  4YY3 M;  2VII A;  2J7O A;  2XZU A;  4B7F A;  4LJ5 A;  4NXN M;  1YUB A;  3FTF A;  1V34 A;  1NV8 A;  4QNR A;  2LXE A;  4AG5 A;  4JI7 M;  3VDP A;  1S3S A;  4DV6 M;  3FYD A;  1P3Q Q;  3DA1 A;  2JNH A;  4JI6 M;  1C1K A;  3NBI A;  1J7K A;  4NL4 H;  5IWA M;  1MJG M;  4L15 A;  1NY6 A;  1NO1 A;  4G4O A;  5DFL A;  1L2D A;  2O5R A;  1R4G A;  1ZMW A;  2R44 A;  2O25 A;  2QCU A;  1IQP A;  1OKS A;  4XBO A;  4JI4 M;  3BXW A;  1JB0 F;  2R18 A;  3KOX E;  4LY6 A;  2I7N A;  4OVZ A;  3W0L B;  3L26 A;  5EP1 A;  3GLF B;  4DUY M;  3SAR A;  3FYC A;  2JY5 A;  2QHO B;  4GHL A;  3IG5 A;  1QAQ A;  1D0K A;  4FW9 A;  3LVV A;  1AIP C;  2RGO A;  2F5P A;  2UXC M;  3K1J A;  3U6C A;  1JR3 E;  3Q8X A;  5ITT A;  4KHP M;  4B7H A;  2M60 A;  3PNV A;  3FD9 A;  2VF8 A;  2D7H A;  2JY7 A;  3SFZ A;  4PCZ A;  4IIW A;  2Y0T A;  3HJS A;  3QAU A;  2LVP C;  4G3O A;  3W68 A;  4D81 A;  3HY5 A;  2F5Q A;  2BJW A;  5KPR A;  1I94 M;  2DXI A;  2DNA A;  3TWL A;  1VG5 A;  2LTU A;  3CTW B;  3SAW A;  4M0W A;  4KO8 A;  4DV3 M;  4DR3 M;  2X8A A;  4KLN A;  4RF0 A;  4AKG A;  1TGU A;  3MHV C;  3TPZ A;  3FTE A;  1QAO A;  3LCU A;  3GLG B;  4CIS A;  3HU3 A;  1WR1 B;  1FJG M;  1Q02 A;  4QNM A;  2M5Z A;  4B3M M;  2HKJ A;  3E9S A;  1OAI A;  4IBG A;  1G71 A;  2MR9 A;  2R4J A;  1GVN A;  2I7P A;  3SAV A;  4GC5 A;  1Y8G A;  5EXS A;  4OW0 A;  1GL7 A;  2QBY A;  3K92 A;  1HR0 M;  1TDZ A;  4GIT A;  3UZU A;  3WHK A;  3U6S A;  2CE7 A;  1DGF A;  3L27 A;  4QOS A;  4FWD A;  3ZC7 B;  3UJN A;  3SAS A;  2UUC M;  2L09 A;  5DYI A;  2L4E A;  3U6M A;  2K6B A;  2KZS A;  3U6P A;  3FUU A;  1XHB A;  3HHZ A;  2L6O A;  2QNJ A;  2X4A A;  1DO0 A;  3KDS E;  4IBE A;  4L16 A;  2JY6 B;  4B3S M;  3LW5 F;  2G3Q A;  1Q3B A;  2BWE A;  4LJ6 A;  4RNA A;  3GPX A;  4AZF A;  3L25 A;  1G4A E;  5EP4 A;  4PDI A;  4L4U A;  1BVS A;  3L29 A;  3MK6 A;  4JV5 M;  3PXG A;  4RF1 A;  2XF3 A;  4NRW A;  2L4F A;  4LJ4 A;  5LMU M;  2LVQ D;  1YE9 A;  2DVW B;  1KYI A;  5IT9 S;  3F92 A;  4LCB A;  3VLF B;  3GRR A;  3HHY A;  2OQ4 A;  4EIW A;  3U6Q A;  1GO5 A;  3HHW A;  2CRU A;  2DZO B;  2WSE F;  1V33 A;  2X49 A;  4LGY A;  1HT2 E;  5EP3 A;  1PJI A;  2Z4S A;  2OOB A;  2DAI A;  1OTR A;  2KA6 B;  3HJQ A;  3KXE C;  5BR8 M;  2Z3X A;  1K82 A;  3AV0 A;  3IG8 A;  5BPV A;  3LQQ A;  4LRT A;  3U5Z A;  2HAK A;  3ZCB B;  2JA2 A;  5ITX E;  1LTM A;  4JI8 M;  1G59 A;  1MU5 A;  2EKF A;  1ZMU A;  4FWH A;  2KRU A;  1OIP A;  4XK8 F;  2CUZ A;  1J5E M;  3CF0 A;  4LF5 M;  2JP7 A;  1NJF A;  1OQY A;  4Q7J A;  1CUK A;  4CIZ A;  2DAK A;  3ZQJ A;  1L2C A;  3J80 S;  1XB2 B;  4LF8 M;  4B08 A;  2KW0 A;  1VEG A;  2Y20 A;  2DWZ B;  3AJI B;  4M9S A;  5EP2 A;  2H1R A;  1E9R A;  2CV0 A;  4CJ6 A;  1NV9 A;  2KHH A;  4OU7 A;  1QUT A;  2DKL A;  4K0K M;  3KFU G;  4NOO B;  3JAM S;  4AKI A;  4AI6 A;  5EQT A;  1VEK A;  2P5T A;  1QYR A;  3LQR A;  2KZU A;  3Q8G A;  3VFD A;  2EA0 A;  3GLI B;  4HL4 A;  2MH8 A;  1T43 A;  1Q39 A;  5IRE B;  1GLN A;  4LFC M;  3FRI A;  1W5T A;  4R71 A;  1SG9 A;  4Z8X A;  2K9D A;  4DR6 M;  2QEN A;  1N32 M;  2KEB A;  3HJ8 A;  3C58 A;  4G4Q A;  4Z6Y A;  4IBF A;  5ITQ A;  3LVW A;  1HNX M;  3SC3 A;  1KSF X;  1D0L A;  2DHY A;  3ILK A;  3J27 B;  3KOW E;  4F2L A;  5C18 A;  4DUZ M;  2YFQ A;  4LF6 M;  4DR1 M;  5E6J A;  1IN6 A;  4MB7 A;  1JQJ C;  4LGM A;  1E32 A;  1HJP A;  3B7Q A;  1Z59 A;  4DR7 M;  2Z4R A;  1JR3 A;  3GRU A;  2CEA A;  4L8R C;  4LFB M;  5L8R F;  3K9P A;  4DV4 M;  3W67 A;  1J09 A;  2WZJ A;  5KQ8 A;  3KP1 E;  4YHH M;  3ZH9 B;  3DOA A;  3TWM A;  3T15 A;  1IXS A;  3FUW A;  4NRV A;  5FLX S;  3GLG A;  4ANR A;  2DZL A;  3UMM A;  3M6A A;  2CHQ A;  3T1Y M;  2FE8 A;  1XC8 A;  4LRS A;  2UXD M;  2ZTD A;  3SAU A;  4FCV A;  1VDD A;  2EKK A;  4MH0 E;  2LVO C;  4A3V B;  4AQY M;  4AKH A;  1Q3C A;  1ZV1 A;  2ZAO A;  3KW6 A;  4RKU F;  4AW4 A;  4F1I A;  4LF7 M;  3QYE A;  1ZMV A;  3H4J A;  4DBG B;  4QOZ C;  2C96 A;  3FRH A;  4X66 M;  3KSJ A;  3GLF E;  3SAT A;  4GKK M;  2JUJ A;  2KNZ A;  1XMQ M;  1PJS A;  1XXH B;  4AG6 A;  2RGH A;  5DNY A;  3J7B A;  1OJL A;  1OAO C;  2JXN A;  2OO9 A;  3K9O A;  2DEN A;  2CWB A;  1PJT A;  8CAT A;  3GLF A;  4OVZ B;  2G8L A;  5EJC A;  3GQ3 A;  1N77 A;  4NXM M;  1RU3 A;  4GHA A;  1GJT A;  3GRV A;  1HNW M;  2V1U A;  2XGN A;  2K0B X;  1IBL M;  3TL4 X;  1ORY B;  5A2Q S;  4IBD A;  5DYG A;  3HX3 A;  5KPT A;  1LV7 A;  4NC6 A;  3KP0 E;  1IY1 A;  1YSY A;  4IBK A;  2NQ8 C;  2DAG A;  4FCW A;  2DWL A;  3GLH B;  3RFW A;  2KNV A;  2QSF X;  1XMO M;  1IN4 A;  3B7N A;  1N75 A;  3AOE A;  1PM5 A;  3IHP A;  2XH9 A;  2DZN B;  2R6F A;  3J81 S;  3C3E A;  2JZ1 A;  3SBJ A;  3QYB A;  1E9S A;  2DI0 A;  2LVA A;  4I4L A;  1R2Y A;  4HEO A;  3C3D A;  2XFS A;  2ZM6 M;  1IXR C;  1R6B X;  4ZPX A;  5ITU A;  3H4M A;  3U6D A;  3M7G A;  3I04 M;  3U6E A;  1PRB A;  2JWS A;  1QUS A;  5JI3 E;  2V1C A;  3DFZ A;  3R8F A;  2FS1 A;  1ZAE A;  4B7G A;  1F4I A;  3B74 A;  2VQF M;  2CV1 A;  4LJ8 A;  3KS8 A;  1R2Z A;  3KSX A;  4LF9 M;  1XXH A;  3AOE C;  3RE8 A;  2UUB M;  4L78 A;  1E94 E;  3AOG A;  1MN3 A;  4CHT B;  2R45 A;  2FFJ A;  3GLH E;  1XXH E;  2MGW A;  2Y0Q A;  3FE3 A;  2CP8 A;  3UK6 A;  4BLC A;  4B3T M;  4BB9 A;  1HQY E;  3B7Z A;  2ZAN A;  4GH9 A;  4IBB A;  3E46 A;  3PFI A;  2L2D A;  3U6O A;  3T1H M;  1W5S A;  5IZ7 D;  4NSO B;  4REZ A;  3KS4 A;  3TE6 A;  4MGK E;  2XLJ A;  4W5W A;  4DV5 M;  1N36 M;  1K3X A;  3A45 A;  1SXJ B;  1G3I A;  2FH0 A;  4M0D A;  4JN6 A;  4PDG A;  3JR5 A;  2F4V M;  4I81 A;  1EFU B;  1L1T A;  2UXB M;  2A5Y B;  1IXS B;  2FOI C;  3SYL A;  2XSZ D;  2Z8Y M;  1IBM M;  1OFH A;  4KOD A;  3TWK A;  1EIJ A;  3I4Y A;  4DR2 M; 
#chains in the Genus database with same CATH homology
 3GP1 A;  1NNU C;  4MGY E;  3E4R A;  4X62 M;  4JYA M;  4DV0 M;  4LJ9 A;  4JXJ A;  3EIE A;  2OPF A;  3HKP A;  3LMM A;  1L2B A;  1IXZ A;  1ZQ9 A;  2C99 A;  2XSZ A;  3AFH A;  1DGH A;  5EXP A;  4DV2 M;  3GPP A;  1NHW C;  2R62 A;  2QZ4 A;  1XNR M;  3VKH A;  2BJV A;  2YNM D;  1PJJ A;  5C1B A;  2XEP A;  1IM2 A;  2W82 A;  4PD2 A;  1HNZ M;  3FUT A;  2R46 A;  4JI0 M;  2L7H A;  3SHF A;  4IBI A;  3VK8 A;  1EE8 A;  2XFT A;  4G6Z A;  1NJG A;  2HHH M;  3K8Z A;  3HU1 A;  1GL6 A;  3A46 A;  4MGI E;  4LG2 A;  4D82 A;  1QAN A;  2C98 A;  2HL7 A;  4X65 M;  2ZAM A;  2F5S A;  2R4E A;  5FTK A;  3B9P A;  3GPU A;  1L8Q A;  2Q2E B;  1G41 A;  3UGJ A;  4G4R A;  4GKJ M;  2V6Z M;  4MM3 B;  2VQE M;  3SMP A;  4ITQ A;  3BOS A;  3L28 A;  4LJ7 A;  3R9X B;  3SYK A;  3VKG A;  2DHR A;  2UU9 M;  4GC9 A;  2E5L M;  2QP9 X;  3GPY A;  1TH3 A;  1NY5 A;  1QZM A;  3CF2 A;  4XGI A;  5EXX A;  5JI2 E;  3U6L A;  4OX9 M;  3J2P B;  3KOZ E;  3MJ5 A;  4IBJ A;  3U60 B;  3GLH A;  2KXE A;  3U5Z B;  3HHX A;  2AHM A;  2D7E A;  2G5G X;  4M9Z A;  1X37 A;  2EO2 A;  4R7G A;  3NWL A;  1Z6T A;  4CGY B;  4GIP A;  1N78 A;  4R3D A;  3AL0 C;  3FKE A;  2YQZ A;  4I5S A;  1XNQ M;  4FCT A;  2CHG A;  1DO2 A;  2F5O A;  1TDH A;  4GMQ A;  1TH4 A;  4WUR A;  1UM8 A;  1IY2 A;  3JR4 A;  4DV7 M;  1NSF A;  1TH2 A;  2CV2 A;  4JI5 M;  2UUA M;  1WXQ A;  3OTO M;  4D80 A;  3D8B A;  5F3W A;  2LH0 A;  5KO3 A;  5KQD A;  4LFA M;  2FNA A;  2DWM A;  3VK7 A;  1D2N A;  3U60 A;  3RGP A;  4P16 A;  3HU2 A;  3GQ5 A;  1IY0 A;  2D7G A;  3AKZ A;  2R65 A;  4WW0 A;  2J7N A;  5LMN M;  5E26 A;  4LZZ A;  3U61 B;  2C5R A;  2QBY B;  3KOY E;  2EUC A;  1SXJ C;  2CFO A;  4MGZ E;  2Z7J A;  5ITR A;  3I4V A;  3PVS A;  4TUW A;  1K3W A;  4IJE A;  5GKN A;  5FTL A;  1KFV A;  1SXJ E;  4LZJ A;  3D8L A;  1NVM A;  3J7A S;  3W0F A;  4FD2 A;  1IN5 A;  3FUX A;  2LWX A;  1DGG A;  3DZD A;  1NNJ A;  1QVR A;  2ZBK B;  5FSW A;  1QQW A;  1Z5B A;  4QHS A;  3SHG B;  3A42 A;  3A98 B;  4IBC A;  1QAM A;  2LNH C;  2C9O A;  2ERC A;  2Y21 A;  4LF4 M;  3THG A;  3GLI A;  4B3R M;  3GRY A;  5EXT A;  1N34 M;  4MGH A;  1DGB A;  3TQS A;  3HWS A;  1SXJ D;  4HLQ A;  5H37 D;  4II7 A;  5FTM A;  7CAT A;  2CHV A;  3T38 A;  2RKO A;  2C9C A;  1DGH B;  4IJF A;  1JR3 D;  4PT5 A;  5FTN A;  5ITY A;  3EIH A;  4G4N A;  2KRK A;  4DV1 M;  3K2L A;  1R7R A;  4DR5 M;  4QHT A;  2HCB A;  4LJA A;  1Z5A A;  3FUV A;  3WHL A;  1XWI A;  3QWL A;  1L1Z A;  3U61 A;  2F5N A;  4NSR A;  4DR4 M;  1GKI A;  1H6U A;  3KVW A;  1HT1 E;  4JI2 M;  3FTC A;  3L2A A;  1SXJ A;  4BBA A;  2XZF A;  1HQC A;  2K47 A;  1MX0 A;  1Z5C A;  3M0E A;  4M9X A;  5KPZ A;  4X64 M;  2YR0 A;  4I8O A;  1G8P A;  1N33 M;  4FVM A;  3SMS A;  3RGS A;  3HGI A;  1FNN A;  4FWG A;  2L7I A;  5ITX A;  1IN7 A;  1T3T A;  2BNK A;  2DWN A;  3GQ4 A;  4JI3 M;  5FTJ A;  2QPA A;  3FTD A;  1NHG C;  3CF6 E;  3PNY A;  4JI1 M;  4GRI A;  1I4W A;  4S12 A;  3VDU A;  3GO8 A;  1IBK M;  3I51 A;  1OFI A;  1IN8 A;  4YY3 M;  2VII A;  2J7O A;  2XZU A;  4B7F A;  4LJ5 A;  4NXN M;  1YUB A;  3FTF A;  4QNR A;  2LXE A;  4AG5 A;  4JI7 M;  3VDP A;  1S3S A;  4DV6 M;  3FYD A;  3DA1 A;  4JI6 M;  1C1K A;  3NBI A;  1J7K A;  4NL4 H;  5IWA M;  4L15 A;  1NY6 A;  4G4O A;  1L2D A;  2O5R A;  2QCU A;  1IQP A;  4XBO A;  4JI4 M;  2R18 A;  3KOX E;  4LY6 A;  2I7N A;  4OVZ A;  3W0L B;  3L26 A;  5EP1 A;  3GLF B;  4DUY M;  3SAR A;  3FYC A;  4GHL A;  3IG5 A;  1QAQ A;  4FW9 A;  3LVV A;  2RGO A;  2F5P A;  2UXC M;  3K1J A;  3U6C A;  3Q8X A;  5ITT A;  4KHP M;  4B7H A;  2M60 A;  3PNV A;  3FD9 A;  2D7H A;  4PCZ A;  3SFZ A;  4PDG A;  4IIW A;  2Y0T A;  3HJS A;  3QAU A;  4D81 A;  2F5Q A;  2DXI A;  2BJW A;  5KPR A;  1I94 M;  3TWL A;  3CTW B;  3SAW A;  4M0W A;  4KO8 A;  4DV3 M;  4DR3 M;  2X8A A;  4KLN A;  4RF0 A;  4AKG A;  1TGU A;  3MHV C;  3TPZ A;  3FTE A;  1QAO A;  3GLG B;  4CIS A;  3HU3 A;  1FJG M;  4QNM A;  2M5Z A;  4B3M M;  2HKJ A;  3E9S A;  4IBG A;  2R4J A;  1GVN A;  2I7P A;  3SAV A;  4GC5 A;  5EXS A;  4OW0 A;  1GL7 A;  2QBY A;  3K92 A;  1HR0 M;  1TDZ A;  4GIT A;  3UZU A;  3WHK A;  3U6S A;  2CE7 A;  1DGF A;  3L27 A;  4QOS A;  4FWD A;  3ZC7 B;  3UJN A;  3SAS A;  2UUC M;  2L09 A;  5DYI A;  3U6M A;  3U6P A;  2KZS A;  3FUU A;  1XHB A;  3HHZ A;  2L6O A;  2X4A A;  1DO0 A;  3KDS E;  4IBE A;  4L16 A;  4B3S M;  1Q3B A;  4RNA A;  4LJ6 A;  3GPX A;  4AZF A;  3L25 A;  1G4A E;  5EP4 A;  4PDI A;  4L4U A;  3L29 A;  3MK6 A;  4JV5 M;  3PXG A;  4RF1 A;  2XF3 A;  4NRW A;  4LJ4 A;  5LMU M;  1YE9 A;  2DVW B;  1KYI A;  5IT9 S;  4LCB A;  3VLF B;  3GRR A;  3HHY A;  2OQ4 A;  4EIW A;  3U6Q A;  3HHW A;  2DZO B;  4LGY A;  5EP3 A;  2X49 A;  1HT2 E;  1PJI A;  2Z4S A;  3KXE C;  2KA6 B;  3HJQ A;  5BR8 M;  2Z3X A;  1K82 A;  3AV0 A;  3IG8 A;  5BPV A;  3LQQ A;  4LRT A;  3U5Z A;  3ZCB B;  2JA2 A;  5ITX E;  4JI8 M;  1G59 A;  1MU5 A;  4FWH A;  2KRU A;  2CUZ A;  1J5E M;  3CF0 A;  4LF5 M;  1NJF A;  1L2C A;  3J80 S;  4LF8 M;  4B08 A;  2KW0 A;  2Y20 A;  2DWZ B;  3AJI B;  4M9S A;  5EP2 A;  2H1R A;  1E9R A;  2CV0 A;  4OU7 A;  4K0K M;  3KFU G;  4NOO B;  3JAM S;  4AKI A;  4AI6 A;  5EQT A;  2P5T A;  3LQR A;  1QYR A;  2KZU A;  3VFD A;  2EA0 A;  3GLI B;  4HL4 A;  5IRE B;  1Q39 A;  1GLN A;  4LFC M;  1W5T A;  4Z8X A;  4DR6 M;  1N32 M;  2QEN A;  2KEB A;  3HJ8 A;  3C58 A;  4G4Q A;  4Z6Y A;  4IBF A;  5ITQ A;  3LVW A;  1HNX M;  3SC3 A;  1KSF X;  3ILK A;  3J27 B;  3KOW E;  5C18 A;  4DUZ M;  2YFQ A;  4LF6 M;  4DR1 M;  5E6J A;  1IN6 A;  4MB7 A;  1JQJ C;  4LGM A;  1E32 A;  1Z59 A;  4DR7 M;  2Z4R A;  1JR3 A;  3GRU A;  2CEA A;  4L8R C;  4LFB M;  4DV4 M;  1J09 A;  4YHH M;  5KQ8 A;  3KP1 E;  3ZH9 B;  3DOA A;  3TWM A;  3T15 A;  3FUW A;  4NRV A;  5FLX S;  3GLG A;  3UMM A;  3M6A A;  2CHQ A;  3T1Y M;  2FE8 A;  1XC8 A;  4LRS A;  2UXD M;  3SAU A;  4FCV A;  1VDD A;  4AQY M;  4MH0 E;  4A3V B;  4AKH A;  1Q3C A;  2ZAO A;  3KW6 A;  4AW4 A;  4LF7 M;  4QOZ C;  2C96 A;  4X66 M;  3KSJ A;  3SAT A;  4GKK M;  1XMQ M;  4AG6 A;  1XXH B;  2RGH A;  5DNY A;  3J7B A;  1OJL A;  8CAT A;  3GLF A;  1N77 A;  4OVZ B;  2G8L A;  5EJC A;  3GQ3 A;  4NXM M;  4GHA A;  3GRV A;  1HNW M;  2V1U A;  2XGN A;  1IBL M;  3TL4 X;  1ORY B;  5A2Q S;  4IBD A;  5DYG A;  5KPT A;  1LV7 A;  3KP0 E;  1IY1 A;  1YSY A;  4IBK A;  2NQ8 C;  4FCW A;  2DWL A;  3GLH B;  3RFW A;  1XMO M;  1IN4 A;  1N75 A;  3AOE A;  1PM5 A;  2XH9 A;  2DZN B;  3J81 S;  3SBJ A;  4I4L A;  1E9S A;  1R2Y A;  2XFS A;  2ZM6 M;  1IXR C;  1R6B X;  4ZPX A;  5ITU A;  3H4M A;  3U6D A;  3M7G A;  3U6E A;  5JI3 E;  2V1C A;  3DFZ A;  3R8F A;  1ZAE A;  4B7G A;  2VQF M;  2CV1 A;  4LJ8 A;  3KS8 A;  1R2Z A;  3KSX A;  4LF9 M;  1XXH A;  3AOE C;  3RE8 A;  2UUB M;  4L78 A;  1E94 E;  3AOG A;  4CHT B;  2R45 A;  2FFJ A;  2Y0Q A;  4BLC A;  3UK6 A;  4B3T M;  4BB9 A;  1HQY E;  2ZAN A;  4GH9 A;  4IBB A;  3PFI A;  3T1H M;  3U6O A;  1W5S A;  5IZ7 D;  4NSO B;  4REZ A;  3KS4 A;  3TE6 A;  4MGK E;  2XLJ A;  4W5W A;  4DV5 M;  1N36 M;  1K3X A;  3A45 A;  1SXJ B;  1G3I A;  4M0D A;  4JN6 A;  3JR5 A;  2F4V M;  4I81 A;  1L1T A;  2UXB M;  2A5Y B;  1IXS B;  2FOI C;  3SYL A;  2XSZ D;  1IBM M;  1OFH A;  4KOD A;  3TWK A;  3I4Y A;  4DR2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...