2M6LA

Solution structure of the escherichia coli holo ferric enterobactin binding protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrienterobactin-binding periplasmic protein
total genus 45
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6lA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6lA02
2R7AA 3MINB 5M3BA 4DBLE 3ZK7A 1K75A 2WI8A 5KOJB 5HDQA 1N4AA 4TKUA 4HMOA 2PRSA 3PSHA 5GGXA 4FNAA 1FP4B 1M1NA 4ND8A 1L5HB 3AEUB 4LJSA 4WNAB 1EFDN 3TNYA 3ZK8A 3MINA 1K0FA 2OV1A 4WZAA 4INPA 4TKVA 3EIXA 2XY4A 5GGYA 2WHYA 4OVKA 5B58T 1QGUB 4MLZA 4OXQA 5BVHB 4BBPA 1FP4A 1M1NB 1G21A 2X4LA 3AETA 4UDNA 3R5SA 4XPIB 5CX1A 1QH1B 3AEKB 5KOHB 1KAHA 1N2CB 2R79A 2XDQA 5I4KA 2XH8A 3HH8A 2OGWA 4TKVB 3TLKA 3MFQA 4FI3F 4G07A 4INOA 3ZK9A 1XVLA 4WZBB 1QH8A 3BE5A 3NU1A 3GI1A 3AERB 4WN9B 4ND8B 4OXRA 5CX1B 1L5HA 4UTPA 4PM4A 4PAGA 3EIWA 5JPDA 2Q8PA 5M2QA 2ETVA 2PS3A 3TEFA 1TOAA 1H1LA 1ESZA 1G20B 2AFIB 1K7SN 3HJTA 3PDIB 4H59A 4K3VA 4WZBA 3BE6A 2XQVA 5BVHA 3AESA 4XPIA 5JG7A 5M34A 2AFHB 1PSZA 1M34A 3MWGA 5KHLB 3K1AB 5M29A 3PSAA 2AFIA 4HN9A 2Q8QA 2PHZA 3PDIA 4TKUB 4WESB 4B8YA 5BVGA 1QH8B 2XV1A 4CL2A 2YNMC 2OV3A 3G9QA 2PS0A 3HXPA 4WNAA 3R5TA 3U7QA 1M1YA 1MIOA 2MINB 1M34B 4WZAB 4MO9A 2XUZA 3K1AA 3ZKAA 3LI2A 3ZTTA 5BVGB 4WESA 2YNMD 1G21B 4HMPA 5CR9A 3AETB 1N4DA 1N2CA 5AFSA 3UJPA 5KOHA 3AEQA 2MINA 1M1YB 1MIOB 2XDQB 4LS3A 2M6LA 5FLYA 3CX3A 4GICA 4IRMA 2QI9F 4UTOA 3AERA 4FILA 4UDOA 4WN9A 1N2ZA 3AEUA 4HMQA 4FKMA 4G09A 1PQ4A 5JOQA 4N01A 2PS9A 2M6KA 1G20A 3U7QB 3MWFA 1KAEA 5KOJA 1H1LB 1QGUA 4M7OA 5JJ5A 4MX8A 3MD9A 5HX7A 1K2VN 3AESB 2OSVA 4MDYA 1QH1A 3AEKA 4NNOA 4NNPA 4H0FA 2O1EA 3LHSA 3AEQB 2RG7A 1KARA 2AFHA
chains in the Genus database with same CATH superfamily
1E1NA 1I4EB 2HCJB 4D9HA 2X58A 3WZ2A 3NJRA 1FFYA 4BRUA 1ODLA 1VL5A 3CISA 3UZUA 1JMKC 2CJWB 5A9SA 2EJUA 1XA3A 4YVFA 3ESAA 4C7BA 2ZYTX 1MC4A 5AD1A 3UQZA 1FU7A 4OHYA 5B1HA 4XWYA 5FOXA 5KVCA 3TSYA 1N7GA 4UNQA 4ER3A 4F9TA 3LC7O 5LZ9A 1KBOA 4BJ1A 4IQFA 1LRJA 1UXGA 4BO7A 3DMGA 5BVHB 1N1EA 3FRIA 3EA5A 1KEEA 3OKAA 4O0LA 3HJHA 2OHVA 2IZZA 4JX9A 1PJZA 2OHFA 1SCBA 1CF4A 2C2YA 4AFNA 2AOWA 4NHEA 4DSZA 3WL6A 4DV0B 2NO7A 1VMKA 3GT4A 4KH1A 4OTZA 2P9GA 3WWEA 4EW3A 3S81A 3U9SA 1VBKA 2HQBA 2P8JA 3OQHA 4HX9A 4BPRA 2QRUA 5D86A 4DGSA 2V9ZA 5LUBA 2QRPA 1I1QB 4ESHA 1C1HA 1EI9A 2R1ZA 1LX6A 3K70D 4CBVA 5DK4A 1TW3A 1E1RA 1KYYA 4FINA 1R66A 4N18A 1RE1A 4BVFA 4Q9KA 1DL5A 3HCWA 3UA4A 4R2XA 4KBFA 3HN7A 1K6IA 2B2CA 2FN8A 3G0HA 5C8ZA 5DXFA 3C70A 3TM4A 1KK1A 1X8JA 1P81A 2RHGB 3DEHA 4FMCF 1MRZA 2EGGA 1JA0A 2WWFA 1GO2A 3EDOA 4NMLA 1TAGA 3OUUA 2CNDA 4WK6A 5CT4A 3BQMB 3H2BA 2QL5A 3TVTA 1MX5A 1EKXA 3QBDA 1L4KA 2VR1A 4MVJI 1ORHA 1HMPA 2IF2A 4Z9FA 1AMUA 2V1UA 2ZROA 3QEMB 3C8DA 1X87A 2FPLA 5DLQC 2H0AA 4F3NA 1P75A 1RW4A 4DM3A 2ORIA 3B85A 4HVCA 2XTMA 1TMOA 3MPUA 3O21A 1SQ5A 2MSWA 2XNCA 2JFVA 1NYLA 4G0OA 5FOVA 4MPDA 1Z88A 1E3QA 3F4LA 4O63O 1UPUA 3OPVA 1XMIA 2PWYA 3UPTA 3GMDA 2JGDB 3D4PA 3AHGA 4I4IA 4R9SA 1T9ZA 4M86A 5CT6A 5L53A 3PXAA 5AM4A 2GKGA 4IDHA 2C42A 1IHYA 3NBMA 3EB9A 4QYSA 1H6AA 2OBLA 2XKBA 1X7GA 4ETWA 1XUOA 5JAZA 1WD7A 4KUGA 1XYGA 4Y7CA 3MEQA 5EEGA 4Z4HA 4DUZB 3U56A 1E9RA 1XYVA 2LDBA 1T26A 4QQ8A 4F5YA 1GAXA 2TRSB 2DWOA 1J2JA 1UFRA 1A96A 3B1WA 3ZLUA 1V4VA 1NU8A 1ZH0A 3Q9NA 1D1TA 1USUA 1NBAA 3DPIA 4REQB 2ODPA 3D6JA 3M6UA 5KBYA 2IP1A 2NO6A 3OUTA 3LHSA 2UYCA 1TU3A 4NP6A 1POXA 4RJJA 3EXG1 3VR0A 3NV9A 1PGQA 1ZR2A 2KE5A 2G9NA 3H5OA 3DV0B 4M0MA 4NE2A 5K8JB 1Y4DE 1O96B 4QSMA 2F3SA 3VGPA 4F46A 1RHUA 4FNGA 4NYMQ 1K9VF 4PW0A 2JFOA 3WRYA 4X6XA 4HDKB 1S0UA 2EL7A 2OLKA 2VA8A 4QQRA 4OUDA 2W9XA 4KAXA 2V7QD 4OFWA 4D9JA 1P5HA 4QUDA 3HWWA 3QUBA 3VSBA 4PQGA 5C7YA 2ZDQA 4W9MC 1CJUC 2FP4B 3IPLA 2FH5B 4CCYB 5TE9A 3R1IA 2O2SA 2DHEA 3DOJA 3G79A 5IEJA 1QIDA 1AX9A 5K4AA 3OQVA 4BQRA 2C5BA 2GZ2A 3K0AA 3M9XA 3WYBA 2A9VA 3JCZA 3K9LA 1QIJA 2Q8NA 4BJ3A 4TYQA 2RGBA 2O7SA 3A1WA 3KDAA 1T0IA 3BORA 1N6NA 2Y2UA 3IBTA 2OYCA 2WHEA 1VHLA 4FDLA 5CCXA 3L8CA 2CNLA 2EJBA 1QOZA 2PLWA 3DW1X 3G8YA 3HO8A 3ZGXA 3GIDA 4C0BA 4D99A 4OGWA 2X42A 5EAIA 2JJ2D 4UTPA 1JLRA 4XAQA 3FPEA 1LDMA 4R83A 1AKWA 4ZT4A 4CR7A 4A36A 2IITA 1VYHA 1WF6A 4ZQBA 3THSA 5AW9A 4KV9A 2OA0A 4WLEA 1SXQA 1OBCA 4Y7DA 4ZU1X 4JA2A 1NFRA 5ITWA 1IHDA 1JFSA 1IMOA 1Q0RA 3AK4A 3N3BC 3ETDA 4MINA 5KDOA 3CR3C 2UU9B 3NTRA 3HUDA 3V00A 2O0KA 4XEHA 4AKIA 2GT1A 5KPDA 4UTVA 3CUYA 1U1EA 4Z9AA 2IYOA 3KQUA 4XRGA 5AJYA 1PDVA 3QKUA 4DA8A 2E3JA 1YZTA 2NTJA 4XWGA 2C8VA 2PQ6A 1ZC4A 3D5QA 1P29A 3G13A 4U6SA 5H83A 1RWWA 2RB4A 3OLCX 5E1MA 4ARAA 3TG8A 1AKRA 2V0CA 4TKMA 2B36A 4S1VA 2X6RA 2GEDA 2CXUA 4GS5A 4IMIB 4RJ2A 4BZQA 4C6SA 3K2QA 4BXOA 2WVHA 5JVDF 3JQBA 1Y6RA 3VI3B 1MG0A 1RAEA 5FR1A 4I4TB 2I3AA 2WJZB 3ZV7A 4UCQA 2CB9A 3D7KA 1LUAA 1XJ5A 4PSDA 4WFKA 4Z1MA 2BE7A 2F1IA 3R0JA 2OD9A 1L1QA 3P9SA 1PS8A 4IGFA 1GN9A 4IJUA 4ZCQA 1KXZA 2YNMD 3ST7A 5FUMA 3SYKA 1C4OA 5AFSA 2VP6A 5AVWA 1JDSA 2G6TA 5B37A 2RDMA 5H1YA 3PV0A 4GZ5A 2GAAA 4IXWA 5AKEA 5J2UA 2GVZC 2CFCA 2OCYC 4P86A 1U0JA 4UM7A 6Q21A 2HMTA 1RXCA 1Z0UA 1K5HA 4M6WB 3R41A 5B36A 3WGQA 2HT1A 3SQXA 4JD5A 3FD8A 3RYHB 1GZ3A 3U4AA 4E2WA 3E3LA 2VK8A 4PZZA 1C8VB 4LGVA 4ADSG 2HHJA 4O2BB 3RNLA 3ROPA 3AF3A 3ZHQA 3DTVD 3IESA 5EINA 4PBSA 1DKMA 4YLGA 1XOIA 121PA 3UV3A 1L8QA 1STOA 3O2SB 4IIJA 4E30A 1RHQA 3D1JA 3OIWA 3PE4A 4HLCA 4LC1A 2IPMA 3N2EA 5IC6A 4J07A 4CKWA 4LIPD 1C8BA 2A9JA 3KHUA 4V0LA 1DC3A 2ORYA 1VSTA 3HI4A 2IZ0A 5M3BA 1FMFA 4PNZA 4L76A 3RASA 1T3LA 5FF9A 3A31A 5L95A 4L9SA 1Y3IA 1KY3A 1LK5A 3R40A 1Y8CA 2QUBA 3DFKA 4LHWA 2YOHA 3CUTA 3U49A 4AJNA 2IZ7A 1HQCA 2G5GX 5KQLA 3T5MA 3WFIA 2IXGA 4LSGA 1U9YA 4HQRA 4KN5A 2GFIA 3VHXB 4P36A 3OCYA 4U7TB 1EXDA 1LY1A 4UC0A 3K9QO 2CE2X 4BB6A 3NAMA 2DULA 4Y6PA 4OGFA 2DBYA 4G8CA 2NZWA 5HM6A 1QRSA 4IQ0A 1FJGB 1TCVA 5EIWA 1OXMA 1D1PA 1JA1A 4PQRA 1Q0PA 3EZYA 5JBIA 3BSYA 4ZVLA 3SC2B 2QHXA 1UBHS 2J4DA 4FVTA 3NHAA 1PJSA 4YFYA 4AP5A 2N9UA 2DJ5A 3EUAA 5LKAA 1W88B 2CJFA 4G6ZA 3GI1A 1FYEA 3S70A 3WO1A 1BXGB 4NBSA 2XGJA 2D7CA 1SCJA 4AI6A 4XD2A 1IUPA 1O8CA 1BG6A 1EUCB 3N2NA 4P54A 1QNLA 1Y9JA 2FMIA 3E4DA 2P2NA 2AFHE 3IOYA 2LWIA 1FTYA 4XX0A 1CWUA 4C89A 4G0PA 1H0HA 4V24A 1JAHA 4B73A 1CQWA 3PDCA 2Q5OA 1A5ZA 1QAOA 3MCVA 2CV2A 2WE8A 2O05A 1YO6A 2ERXA 2H1WA 1P19A 4RHYA 1GG2A 1Y7LA 3ZN2A 4AG5A 4BLTA 1U8EA 2ORED 4PR0A 2BEUA 3E9CA 4R40A 1P0MA 3R0ZA 2X6QA 1GA1A 3ZJUA 2O5RA 1D1QA 2PMWB 2DX7A 1YVUA 3L0YA 2VUIB 2JNWA 4DA4A 3DGFC 4C7XA 1ABFA 1GYQA 3STUA 1GPLA 1B2LA 3TQOA 3TRJA 1E5VA 1B3BA 1Z2DA 4I6EA 2XUZA 4RCZA 2XDYA 1P0QA 2ZSFA 1VTKA 3LI2A 2ODAA 4URFA 2IV7A 1JQDA 2BCGY 3EIEA 1LNQA 3E58A 3SDBA 4RESA 2FPWA 3MGGA 1ITZA 4JI7B 1XAGA 2ZS8A 4KYUA 2DTEA 4ME6A 3D4IA 4MQBA 3VOTA 2O8EB 2OB1A 3DYBA 3SCZA 2BFMA 1VKRA 3PQ8A 3W77A 1Z82A 1XTRA 1U2ZA 1D2EA 4H31A 2ZCUA 3PC3A 2O48X 4JJ4A 5ALRA 5BUZA 3VI4B 2VRBA 3K35A 2XT6A 1G0OA 2GPJA 3IDQA 3QBVA 4HR7A 5CTJA 4CZ2A 1G9XA 4R7TA 3GK3A 4W9RA 4NBNA 1BCSA 4F4JA 4Q7MB 1C0EA 3OJCA 4Z4EA 4R51A 1PGOA 5HTKA 4AX8A 1QU2A 2AI1A 2VCEA 1V8DA 4Q3NA 3LE8A 2ODNA 2Z2XA 3IQXA 3L0PA 3DVAA 3L79A 2RIPA 3GLIE 1EVKA 3QOWA 5EXEA 1B43A 3RAEC 4LY3A 4NKRA 2OCIA 4ZYLA 4Q48A 2Z5GA 2NOAA 4RIEA 4YS6A 1CUBA 1T6XA 4ZC1A 5GQSA 3EW7A 3M3DA 5JNTA 3BB4A 1GU1A 4HYQA 1QMGA 4TGLA 1Z5PA 3WGJA 1L2TA 3B6EA 3BREA 3HDTA 3AKDA 4PG8A 5HK8A 2Q9BA 3H6KA 4LHXA 2FSHA 2PX3A 2F7SA 1AUXA 3A4IA 2BV3A 1W94A 4K05A 1IBLB 3OIFA 5FL7D 4D80A 3SR4A 3OHPA 1XRNA 3TR6A 5CJ2A 4O4HA 3GA7A 3W3AH 3RFCA 4DLWA 1XTQA 1G17A 1R9GA 4FQ5A 5B58C 3BRWA 1SK9A 3WGVA 3DP9A 2M1ZA 4KPUB 4U7HA 1ADCA 2G4CA 3A6ZA 2XSZA 4I36A 2F55A 5THKA 5ICMA 1JHDA 2IU3A 1NVMB 2NXNA 2GS9A 1Z5NA 2REQA 3HCBA 3QPUA 4DJEC 5JBNA 3AFHA 2GB4A 3G5LA 4GD3Q 4NZYA 3BXHA 5DXJA 2CVQA 3M4YA 1ZLXA 3ER9A 3PE3A 4B4WA 1GTJ1 4BGVA 4CR6A 3HTXA 3NMUF 2FX3A 2QTAA 3AP1A 2PLRA 4H77A 5TQ0A 3VR4A 4AKEA 1VRWA 3K73O 4TMKA 1QRDA 1LTKA 1U7ZA 1DCFA 3PD1A 4Q02A 2P4QA 4YLYA 3F4BA 3F9IA 3OHMA 5I4IA 2E87A 4PSAA 4QOIA 5DSXA 4MROA 1JP7A 3FNQA 5GPBA 1PEDA 5UKDA 5I7OA 2WSBA 3CW8X 3GBVA 3KU1A 3E1SA 3FZEA 7YASA 4CVNA 1PDWA 4X66B 5HKBA 3CXRA 1JHUA 4JGGA 3UT0A 2AZXA 1XHEA 2G9VA 1E92A 1KZYC 1VJTA 2B8EA 2MSLA 2R7KA 2TECE 1MC5A 2XZDA 4GMFA 4X97A 1CF2O 2EFJA 3WGZA 1IL0A 1U8ZA 2GI4A 1I14A 3C3BA 4P6VF 5BXQC 1CVIA 4OH1A 3O3OB 4FGLA 1LI5A 3K70B 1Z22A 2NNLD 1N2SA 3F5FA 2I8CA 1EGHA 2IPLA 4NR0A 3I8OA 2Z5FA 2YQZA 4BN4A 3PVCA 3KU4A 4G85A 4Z3DA 2BBTA 4WNIA 5KDLA 2CFOA 1JG6A 5I4CA 1U9JA 4BVAA 1QFSA 5CITA 4RSHA 1YF3A 4DWOA 4UM9B 2PKQO 1DJPA 3COSA 5SV2A 2ECQA 2GTHA 1ND5A 4C4OA 4WCVA 3BIOA 3LQKA 1Y7PA 2Q29A 5ALLA 3HR4A 4P92A 4X95A 4ZDIA 3DXXA 4Y6GB 2LKDA 5BYAA 1FUYB 5CYFA 2B1RA 3GZJA 1JHZA 1TUBB 3LRXA 1FRQA 1GQYA 4FDMA 4OJKA 4YJ2B 2C99A 2R68A 4Z49A 3DWIA 1N6HA 4GGOA 5K0SA 1GG9A 1N3BA 2ATCA 1SXIA 3K4QA 4HB3A 4P83A 3ULKA 1FP1D 2FSPA 3IDOA 4RW0A 3DZJA 4RMHA 1C7FA 1AZWA 5DHPA 4EJSA 3TNYA 3HUEA 1WZUA 3DT6A 4DBLE 1RJGA 2FZKA 3O7MA 1EFKA 1VHQA 1JJVA 5DM2A 3REGA 4MVJD 3PYLA 4NS4A 2Q49A 3PGMA 3AW9A 5DGIA 5KWSA 2LP4Y 4N6NA 5EFOA 1NQWA 1O0BA 3ROZA 1JSLA 3T1QA 4JKIA 1OWMA 5HDBB 1MPXA 5EE3A 5DSZA 3INNA 2BFDA 2I4RA 4FGSA 1IZ0A 3UJBA 1A82A 4LDZA 3SC3A 3KVOA 1OXSC 4TSFD 5FOTA 1YE8A 5TQJA 3QVGB 1LPSA 2IYQA 4Z0HO 4J0GA 3NNDA 4FMDB 1A8UA 4H0CA 4JFRA 2G76A 5LQCA 4RETA 5TNXA 2IU0A 3WBKA 1Z75A 4P4GA 3TLKA 3WSVA 1Z29A 1L7DA 2IYLD 1DBSA 1XCLA 1M2VA 1R4NB 3COZA 4KQFA 4QASA 3ZVLA 5AESA 1L7OA 3A3PA 3BDVA 3BXEA 1SCNE 3PKJA 4LK2A 4BZZA 1UJ4A 5BSRA 1Z63A 4YECA 4EQ6A 3R3XA 3WZMA 3DVLA 2HKIA 3E1GA 1UBRS 2NSLA 3I04A 3LCJA 4TRNA 3A26A 3M2PA 4P8RA 3M34A 3NIDB 2X0EA 1DBVO 4EUHA 1Q0LA 1MO3A 3IQGX 1J2YA 4Y67A 3W3ZB 2R7NA 2FW9A 3HJAA 4OFBA 2GAIA 3VR5A 1CDDA 3OLVA 4XPIA 5AW6A 2WG0A 2IE8A 3AI7A 4XIJA 4ZCLA 5B7PA 4GKKB 3VH1A 4HWRA 1D2MA 1DX9A 1E2PA 4X60A 1Q7GA 3WKAA 4FSDA 3CRW1 2FPIB 1B14A 2Q7XA 5EHGA 5GJVC 2IHTA 3VPBA 5FTJA 2EWVA 4N1AA 2DMRA 2FEMA 1U1DA 4AICA 1FMLA 1R3UA 1YZNA 4QNRA 2P9CA 2GK7A 1FX0A 3L6OO 4XWTA 4JVMA 5IDVA 3UWDA 5EYPA 2PBRA 4DMGA 2JGRA 3R5TA 4Z4GA 3LGSA 4FE7A 3ZBPA 1X77A 5G3YA 1CUSA 1SQ6A 2QE7A 4LDAA 4OSOA 3OZIA 1N75A 1KH3A 3H04A 2H06A 2YWHA 3LNTA 2ECFA 2J3JA 3FW1A 1E79D 4YRJA 1YMUA 4EHLA 4OA5A 3HBMA 4LVCA 3PDHA 4J0JA 5KOHA 1A9XB 1ZR4A 4KO8A 3A37A 5EQDA 3TUJC 4LWOA 4EKIA 5F4BA 1QOPB 1RPTA 5FUQA 4JLVA 4P4NA 1PT6A 2CLIB 3NHYA 4GZMA 2CZGA 4QTXA 3CX3A 3WIUA 3VDNB 4QGBA 1NWCA 3AOEC 4JI6B 3QU4A 5I9BA 2XAUA 2ACEA 5B7GA 2Z6AA 5BT8A 3GFPA 4ZICA 2WHPB 4XM0A 5JSKA 1D09A 5TV2A 1EYZA 2CK3D 3A70A 2IIVA 4CUKA 4LYYA 2ZJ5A 5HS6A 3VJKA 1X7WB 4NU5A 3V2HA 2K7FA 2WF7A 3I64A 3LKBA 3UW3A 2CFSA 2HLNA 2J9GA 3ZOKA 1JR6A 2YZMA 1QAMA 1EE1A 1ZN2A 3NTVA 4NMMA 3BE4A 3WFJA 3BA6A 3QVJA 1AT1A 1AZTA 2ZWOA 4DABA 4D4HA 1Y8QB 3CZ9A 1QS0B 4MIYA 3I0MA 3L84A 3OZ7A 4MMYB 4GOMD 4TTRA 2C78A 5ILQA 2BZ0A 2R97A 1U5BA 5AI0A 3E7WA 5DN6D 4FHDA 3ND8A 2PMEA 2HNBA 2VHEA 4RL6A 2HD4A 1T9DA 3ZUPA 4GOXA 2ZRBA 3SVLA 2J5BA 3LA6A 1F8XA 1UKAA 5GGXA 1MT3A 1SKQA 1ENZA 5T4HA 5MF6A 1VE5A 2RJOA 2GH1A 1XNGA 3PJFA 4DC9A 1B16A 1Z5GA 5GZ6A 2OXCA 3TCKA 4FFNA 4PLTA 5LP6C 2JLWA 3R6TA 2O8CB 1ECGA 4I6GA 3ZDXB 1KI4A 3QKWA 4HDMA 4XD7A 4YJ2F 4YT4A 4ZYUA 1YRBA 3O1LA 2LDXA 1OB2A 1V11B 3D2BA 1FQJA 2GN9A 2HT6A 2H4ZA 3FWHA 3ON5A 1U80A 4QFCA 4YRGA 5CDFE 6ABPA 3QKSA 1XPUA 2PY6A 1VBFA 3RFTA 1AQJA 4PHGA 1PQPA 4B75A 3ADCA 1TJ5A 2W4QA 4RX1A 4EHIA 3VR6A 2OHGA 5GVSA 4FFPA 1H6CA 3R9IA 4TWIA 3SKXA 3QLUA 3JWJA 3M83A 2I6QA 4KDCA 2X5OA 1MFZA 1YAHA 2G1UA 4JYCA 3K4PA 1PJLA 4JB3A 1FSFA 4Q24A 3CFYA 3AR7A 3U4IA 3AIOA 1IQ0A 2X8BA 1EX1A 4O0MA 4R1LA 1TCUA 2XNDD 3OT1A 3X2EA 2PS3A 1DJOA 4B6OA 4FZVA 5JNWA 3AXTA 3VDRA 4BCBA 4AJLA 2NQ8A 3IS3A 4XYMA 4EUNA 4B6GA 3THYA 2YZ7A 3BE8A 3BXZA 1RAGA 3LDFA 4YJFB 2VQFB 3EJ6A 3GLHE 3TNDA 1Q50A 3V97A 4A1FA 2PCJA 3KPJA 4DXAA 1DAOA 1E2BA 4JI8B 4OGLA 3AM3A 3DDWA 5ANRB 5C8YB 4GNKA 4ZOEA 5IM4F 3QLEA 1E1DA 1U3CA 2AFIA 3DZGA 2JJMA 5LCXA 3SYMA 3RS2A 5HR5A 1NXWA 3TXYA 4CODB 3RV4A 3P26A 4YV0A 3BULA 1TT5B 2J5RA 3VO2A 3SJUA 4BB0A 2I99A 1UKVY 1Q77A 1U7TA 2ZTMA 1SBHA 1X15A 2PSJA 4DE5A 4DKXA 5D01A 5FHQA 2JI9A 3VZDA 1WUHS 3MPOA 2H00A 5KVAA 1YFKA 2G67A 3JASB 3U26A 2ZPUA 1BX1A 4FQ7A 1EESA 2XVXA 3AP2A 3UG6A 5IH3A 1HBJA 4FFSA 1EX9A 5BSMA 3UGKA 1JFFB 3NYRA 5KQGA 1WUKS 3P2JA 2JGLA 4UPEA 3S2YA 4FD3A 1OYOA 5BR4A 1ZNQO 3KTOA 3CKKA 4G9BA 1PNQA 2WF9A 4XDGA 3ZDEA 4WRRA 1KJIA 1KO4A 2ZE6A 1N2ZA 2YJ6A 3MIZA 4ND2A 4DLZA 1U1IA 4G09A 5LYJF 3CRQA 4KUHA 4OUDB 2I4NA 1W1UA 1PWEA 4QEDA 1TIPA 3GRKA 3LZDA 3TW6A 3NTXA 4KO3S 3VVLA 3WB9A 4J7AA 3HB9A 1TEZA 2VG8A 3EAFA 3H5LA 4CI0B 3SDZA 1T1JA 3PR2B 4MNTA 3AESB 2Z5LA 2O1XA 3OPMA 1E8MA 4MPPA 2BM0A 4RSRA 3TKYA 4ENSA 4DV7B 3VU1A 3H87A 4BP9A 2CFRA 4WDRA 4FYIA 4RM3A 1S2OA 5EKDA 1SELA 4A8TA 3RUEA 4JLDA 4XGRA 2EBUA 2FOLA 2P7HA 3DE0X 3KWJA 3EULA 2F9LA 2NADA 3MXTA 3R3WA 4RKYA 3SJ7A 4BUZA 4BX2A 4KDEA 1UKYA 3DZBA 1CJMA 1MX3A 2FQYA 2BPOA 3N8KA 4I5FA 3TO5A 3IUSA 5IUJC 3MYYA 3GHYA 4WZAA 4FYMA 4DR4B 2OESA 3HB1A 2Y1KA 3OJ0A 3TNFA 4E4TA 1OLOA 3SYTA 4A2WA 1QONA 2PBLA 5SZHB 3ZW9A 3WGMA 3CJTA 3SKYA 3V1KA 3JWPA 5BWCA 5ER6A 2ZM6B 3HACA 2H7YA 2MU1A 3R5HA 3EQ7A 2WAMA 2ONZA 3DOFA 3C3EA 5BYBA 2HK8A 1ULTA 1YI8A 2CB0A 3WK7A 3MAGA 2CSUA 4LXGA 3KQLA 2IDJA 5DNYB 2OECA 3COWA 3B1FA 4MOWA 5C32A 3HI6A 3EUWA 3CR7A 3WLKX 4AAYA 5FPKA 2Q9CA 2YMPA 4HDRA 2OO3A 3ZIDA 3E6AA 3D02A 3FSRA 3D81A 4ND4A 3RYFB 1NL3A 1Z4OA 2W6PA 3DEFA 4BLSA 2I2BA 4EKGA 2HTFA 5EJ5A 5ALVA 3KSMA 5KKAA 2ETVA 3ANTA 2Y0EA 1JJ7A 4C4XA 2WIFA 3NDPA 4ER7A 3K53A 3SJAA 3E8MA 1IRIA 1DMSA 1BXRB 3FSEA 4DSUA 4RD4A 3KZVA 1DAEA 4IGKA 1UWVA 2ZIXA 1N5KA 3BRQA 4HATA 3ZGYA 3ZWWA 1GFIA 1YL5A 3VOSA 2G25A 5AHWA 3G2OA 2JLCA 4REOA 4EHAA 1SXHA 5FAKA 1L4NA 4JH0A 5BMVA 4J7UA 1M5RA 3PPWA 1WE2A 2G5CA 2I22A 5E6UB 3ZWCA 4LG1A 3KKKA 3QBJA 1A2KC 2NSDA 2CNWA 1F8UA 5IDYA 2Y0PA 5IT5A 3RSSA 3LWZA 1D1SA 2I78A 3E9NA 5G1PA 2D13A 3DFIA 4TQUS 1H8HA 2PS0A 1AQ6A 3M5CA 4BY9E 4YRZA 1W9MA 4N0MA 4BB5A 3OHSX 1TM3E 1VJ5A 2WWGA 3R8FA 5F3WB 4Z6KA 1ISHA 4PHHA 4LFAB 4D79A 1JTFA 4AO6A 2X8JB 3DP7A 5KQPA 3VA7A 3HEMA 1SOMA 4L8YA 2B7CA 4M8NE 3S27A 4CLOB 1Z6ZA 3KPWA 3SHVA 3SEQA 2EDAA 1MO5A 3NWBA 1BA3A 3KP1A 3ZG6A 2JHFA 2J0VA 5CIYA 2H4JA 1EWKA 1DQYA 2NU8A 5ALPA 1QTIA 2QX7A 3A3YA 1XFDA 4GG1A 4R9NA 5LMCA 3KSAC 4W7HA 4RE5A 4UPDA 2REXB 3EK2A 2HA0A 3C7CB 5FADA 3QENA 3QKRA 4YJHA 4E33A 4EYEA 1JIJA 1KMNA 1GTMA 1NV9A 4N8SA 3QWIA 1HLGA 1I2ZA 4PWYA 4RFSB 2R48A 4EI9A 3VV2A 4QRHA 1IAVA 5ITZB 3TNJA 2QLMA 3CWCA 5BW6B 1QTRA 2G3YA 1AB5A 3FLEA 4ZYWA 6YASA 1CJCA 4N7MA 1TUGA 4N3NA 2ZYVX 4KE7A 1T13A 3MBOA 1KJ9A 2I34A 2ID8A 2B69A 4UAJA 3ML1A 1MX9A 3GJSA 1NNSA 5I7VA 1W4BA 5I3CA 2GFHA 3IURA 3ZHZA 1NNEA 4QJBA 5HF5A 3CUVA 2D8MA 2FE4A 1QKJA 4I7EA 4XVRA 4Z0NA 5IAJA 4GPD1 3QLVC 2J0UA 1Y80A 1U7PA 1QE0A 2VDWB 4RVHA 2OXIA 1OUMA 1U2EA 1UK6A 1VC2A 1YQDA 3SEZA 4QFMA 3C43A 2XY4A 3GRFA 1FF9A 4J49A 1CUDA 1P72A 2QY9A 3DE3X 2FJUA 2X9QA 4G4SP 1V3VA 2Q1TA 1A5BB 4YC7A 1QFJA 1Z2AA 4NJEA 4ZOLB 1N2CB 3L04A 4AUEA 3PC7A 1NVXQ 5EP3A 5BUSA 4HPXB 1YDMA 3NCTA 3ILSA 4UHEA 2VT6A 4BEJA 2V3CC 1SD2A 2C3UA 3WLFA 3JQ9A 1Y34E 3V33A 1FFXB 1KP9A 3CMCO 4HZUB 4GE0A 2O50A 2Q1SA 1CNEA 1NVGA 2ZJ3A 1ZJYA 3T54A 4E4RA 2AA3A 3TI7A 1GOTA 1G7RA 1K89A 2JLVA 2FFJA 3C87A 2PD3A 1RP1A 5ALJA 1I4LD 3G0DA 4Z7QB 4UEQA 5ALHA 1NQVA 1HTTA 3ZDQA 2GPSA 5HKAA 3QJYA 1E8DA 1YQEA 2Q2WA 3EYWA 4G5XA 4PX2A 1H66A 4OG2A 5CVEA 4EK9A 5CFLA 3R6LA 1U8YA 1G42A 4XJXA 3WWYA 1L5SA 5BSWA 2ZRAA 2F90A 4RA9A 5CVCA 3RAFC 1K1EA 5DCLA 4B74A 4UHJA 3SC2A 1DVRA 2QL6A 4Q47A 1GVHA 1PFVA 3TD2A 1XZAA 4WXYB 2GN1A 1GTVA 3CLKA 2Y9PB 3IKLA 4MI1A 4F4CA 1BCSB 4QRIA 1ISIA 1FUIA 5AVUA 5BP7A 3FE2A 1N5IA 4HAWA 1LK7A 4MMXB 3VC3A 5A4MS 2WAXA 1WPQA 2IUYA 1TZJA 4H60A 1VG1A 1KQOA 1W85B 1ZDMA 3EXHB 1KYQA 3VH4A 4BATA 3LTEA 2CV0A 5HF8A 1DLJA 2O2CA 2E4WA 4M7WA 3AW8A 1B1CA 2NYUA 4A6XA 5IX8A 1EB8A 1G64A 2WF5A 3ICOA 1FCJA 2A9FA 2EGHA 2PMCA 1TADA 2WNSA 3EWNA 2RGUA 2VPXA 3SGLA 4D3ZA 4DWWA 1HDOA 4W7SA 3DLHA 5K6RA 2GK4A 2HGZA 2QMQA 4Z4QA 1MAHA 4WADA 5F9FA 2F3RA 1X7HA 2HFJA 2OHXA 1XTVA 3GRVA 3NTUA 3OH8A 2V54A 5CP8A 1JN0A 1QHXA 2AXQA 3S55A 5FWXB 2PS9A 4UXJA 3U3DA 1T4DA 2IXDA 3C7TA 3GLKA 3LO5A 3W2GA 4KXMA 4A73A 4WKBA 5CMLA 3Q6MA 4FJ2A 5LUAA 1NYTA 2VSYA 4WK4B 1EUZA 4IVNA 4ZVPA 1EM6A 2R96A 4IEEA 1Y33E 4JJKA 5IJZA 3K0FB 1KYWA 1NZDA 2IS4A 2YVKA 5L3SA 4XGKA 3K6KA 3O8NA 3ZKWB 5F51A 3KZKA 4DSOA 3K92A 4KBYA 1DAIA 2QEQA 3O7WA 1Z0SA 3K6SB 1WU8A 1PEKE 3UGJA 4HPWA 3U5ZB 1KAMA 2X76A 3NHLA 2AW5A 2XHEA 1GQQA 1Q1ZA 3BWDD 1M1XB 4H7HA 1MOZA 4NMHA 2ZRPA 3CZ5A 4O4LB 4E5YA 3Q98A 3QV2A 3PSHA 2GZ3A 3C3KA 1WQ4A 4FCVA 3DWEX 4Y0VA 3CA8A 4YRQA 2P65A 1X8KA 4I5GA 4A0HA 5GVRA 1XP5A 2OBNA 3ZBTA 3LQQA 3M6VA 3ZVNA 5I3ZA 4CKWB 4F5EA 2GN4A 4EI2A 2XCIA 821PA 1DIRA 2GKSA 1UOQA 3H2YA 3L7IA 3DE5X 2JLSA 4ZDWA 5C53B 4MW9A 4WXMA 2C98A 5ES3A 2PXAA 2PKXA 3F0TA 4IX9A 4EKNB 3LPDA 2ACKA 5FD8A 1FP4A 1JVBA 2A33A 3UAGA 1CY1A 2C4HA 2CLMB 3T4EA 2C58A 4KNWA 1E6KA 1II8A 5IJAA 1EFRD 1YJ8A 4YAEA 5NLLA 1LLFA 2G9QA 1JYFA 4QPNA 2OZPA 1R8SA 1I80A 4MRPA 3V1TC 1MFPA 1U90A 3ONEA 4K5QA 2YHAA 1Q0QA 2V0GA 1HC7A 1PVDA 3C39A 3IMGA 3R3HA 2WJ4A 3TOZA 2RGNA 2Q8PA 3T9DA 4DUYB 1TYCA 3TLEA 1F7VA 1E2LA 2FF5A 2VBCA 4LI3X 4X8LA 2HDNB 3G6WA 1KGSA 5DEOA 1ZS9A 2VH2A 1L7NA 3HXLA 2EHJA 2IZOA 2ZI7A 2EJWA 5DT9A 3EBOA 1ELOA 2VDVE 1JIXA 1R5NA 3A0UA 1E89A 2XQGA 1CK4A 4AYXA 1GXSB 4CLHA 4M0UA 3A2KA 1G2IA 1U2RA 1XVVA 2I7CA 2IU4A 1U0BB 2VLIA 3C6MA 5EE1A 3CT4A 1ZUNB 1JMVA 2IUEA 5DX1A 3MJVA 1LQ2A 1RM3A 5JECA 1HDCA 2WOOA 1Z34A 1K27A 4H1HA 4ISBA 5G02A 2BLLA 2R65A 3BD8A 2XT9A 1K88A 4YLEA 4LV6A 1UMKA 2C5HA 2IYFA 2ZTHA 3OWOA 4JBHA 1UPBA 1ZO8A 2W4MA 1J5PA 4TL6A 3SPXA 2VQEB 3BJRA 1KEWA 3JQGB 3KYCB 1I2AA 4WLUA 3SEFA 4AW9A 5AVYA 3LZCA 1R0YA 2IHNA 5HCNA 4LMRA 3VHRA 2O2ZA 4DIBA 1AIPA 4L7QA 3BXGA 4LN1A 3RKSA 2NX2A 2VWGA 2Z4SA 3HZRA 2OV6A 5EWLB 4GMXA 3GZTB 4JT2A 4YRKA 1JVSA 3U16A 4KGVA 4P82A 2B5VA 1WY7A 1HFEL 1OWOA 2HCFA 1HNNA 4IW3B 1D8TA 1JIQA 2EZ9A 2R6JA 3QTTA 1BDHA 2B4YA 2CFIA 2ZJ4A 1Z8HA 3PEFA 6NULA 1SXGA 4A0RA 3LT4A 4B45A 2AHOA 4U02A 2GZAA 3AF4A 5EZ6B 4IXMA 4CYMA 5L40A 3JTMA 2JJ2A 1I5EA 3C7AA 2EFYA 5A04A 2PRKA 5JU6A 2VJYA 5EUMA 1ZN9A 5DNWA 1QFZA 5SZIA 5BN4B 4S12A 4RY9A 5H68A 4LSZA 3T3NA 3TVDA 2ON6A 5FBZA 1SUBA 1LSUA 3CCFA 2RGRA 3L0BA 3QPAA 2C5LA 3QHQA 3QFSA 1T25A 2HV8A 3RGWS 4C4AA 2FSUA 1OLSB 1JG4A 3WG9A 4M8SA 1FTQA 2J6BA 3DR5A 4RH3A 4U9HS 5DIFA 5E4TA 3FTEA 5HE9A 1IAQA 1MA3A 4DMHA 4Y6LA 2BF4A 1PBTA 3ORFA 4EPWA 3ES9A 5IUKC 3REFA 5LIRA 1QQBA 4FTWA 1VHWA 2H92A 5LYYA 5LYJA 2IYAA 5CDTA 2HEIA 4EQ6B 3B1VA 2JEZA 5EGSA 5ILGA 3BICA 1AUVA 2EX1A 3MOGA 3REQB 1DIGA 1KY5A 1ZZEA 2H51A 2EQBA 3MHPA 4GBMA 4RZ2A 1T5OA 3N8GA 1UBLS 5L4SA 4M53A 3UJDA 3ESZA 1E98A 1EXVA 1U9CA 3R6GA 2ZATA 4WAUA 3MRVA 1QFMA 3IB6A 4F72A 1X8XA 3WMWA 2EF1A 2JIBA 3OQBA 2ZJYA 2H1SA 3OO0A 1ORWA 1TVKB 4Y0NA 4EUKA 2WTXA 4C01A 4MDHA 1T0JB 4TKVB 1E5DA 1N2EA 3CQ9A 2DZDA 4O4LF 1RI1A 5B1DA 3D6AA 2EBFX 1ORRA 1SCAA 2ZTLA 2MDTA 2X6TA 4WN9B 4YTEA 4WBNB 2C9CA 3QLTA 5HIJA 4O4JB 2RI6A 4BYMA 1ZG3A 4A2QA 1T2EA 4TXNA 1II0A 2W48A 2A5LA 2GD1O 1AXGA 4MUAA 3OTIA 4HGRA 3F90A 2X2FA 4FSXA 1ML4A 3IUEA 3R5FA 4L5AA 5EVJA 3VAZA 4M1EA 4PQFA 1GKKA 4B9AA 1TTTA 3BT7A 5A0TA 4BLOA 2LD4A 3LF2A 1SUCA 3LYHA 3PUHA 1WX1A 3C3YA 5KNDA 3RGGA 3IERA 5FP0A 2PZLA 4ZU3A 2HNAA 1CF9A 2IUTA 3V8EA 3RM3A 3V2UA 1PSZA 1S8AA 2QRJA 3VO9A 2UUAB 5IKOA 2AI2A 3LQFA 4P81A 2GSWA 3OEWA 4ID3A 5FYQA 4PN3A 1U94A 4QOEA 2OEPA 5I9MA 2JIMA 1CD5A 1OWLA 1QKIA 3RIYA 3ZLJA 4WOBA 3T3PB 1CQIA 5KJEA 5LQSA 1H65A 3NT5A 2JCYA 2FA9A 1SKBA 4UBKA 3N0TA 3F7OA 1QUFA 1ZMOA 4K6FA 3BMOA 5JVDB 1QGED 3JQEA 1QKKA 2I8AA 3LOQA 5BXYA 3SHQA 1IN7A 1QIGA 2YX1A 4KJZA 1PL7A 1Z4KA 4HGQA 1GSHA 4BRZA 5IANA 1GPKA 1YDHA 1PT7A 1ZOOA 1DEXA 4BNMA 4CKCA 4PYOA 1OXUA 1NI4B 4HMPA 4B3GA 3T7JA 2PR7A 3QFTA 4A5SA 3IHTA 1QP4A 3UUEA 2CCJA 1JR2A 1LS6A 2PV0A 4HZIA 1RYHA 1RCFA 1YZHA 2FPRA 2OCPA 3VSEA 4LTMA 1DOZA 2FPXA 2PWPA 2ZBEA 5FNVF 4C1NA 4QU5A 2PL3A 5BQ5A 3GEBA 1NW8A 4LI0A 1NXXA 4JROA 3BXXA 2XODA 3EG9A 1YL6A 2OQVA 1WHTB 1Y81A 3NBKA 4MP8A 2ZT7A 4DCTA 3LRPA 5BWLA 5F76A 2RHBA 4PC7A 3ZI0A 5I7HA 5REQA 1HYQA 1N2IA 3DV0A 5HILA 2AC2A 5JE8A 2GZRA 3U3KA 1EFTA 2C5GA 3MD9A 1FVFA 4F96A 3DV2A 2ZSHA 3EGCA 5J5CA 1O77A 4HDKA 1NV8A 1EEHA 2OOKA 3R8XA 4NCNA 3SXUA 4RCVA 4LX0A 3VH2A 1BYUA 1HFWA 2QD2A 2Y1EA 3A3OA 4NPHA 1VMDA 1UK8A 4MA4A 1JEYA 3TAHA 4DG5A 1CUYA 4BQFA 5FBVB 1XWWA 4HUQA 4ZVNA 4NF2A 5EJFA 2PU5A 4RZ3A 4P3NA 3PR3A 4LPSA 4GEGA 1OLXA 1N78A 3KKMA 1U0HC 2IE0A 3AYXB 3RLIA 3U1VA 1JEQB 4GHWA 4CRWB 4OAQA 3H9QA 1DQZA 4S24A 4W82A 4YRPA 3URMA 3B3AA 3FYSA 3ZQ4A 4BO8A 4L4YA 2CXPA 4MVYA 2ZYIA 5TQ2B 3O9MA 4CPDA 2PTGA 1C1DB 1YUNA 4QX6A 1EP2B 1LFDB 1Y48E 3KUDA 4ZQIA 4LYHA 2SICE 3ZX4A 2HY7A 2Z8YM 3EQ6A 3FCAA 2XGOA 2OAQ1 3LKVA 2F4VB 3CR8A 4DR6B 1OI7A 1FPMA 4IHJF 5DHUA 3VFDA 3WMGA 2ZTSA 3L1KA 3QK7A 4M54A 1RI2A 1GGKA 1XNJA 2ZSUA 2HH9A 3OEEA 3GT7A 1YI0A 2H4XA 4OAOA 1U8XX 2I0FA 2DH6A 4UBIA 3WLPA 2UKDA 4AJ1A 2DEUA 3W0LB 5FJJA 2W71A 2VHUA 1JTVA 1P4JA 2ASVA 1P0FA 3CZQA 1M33A 4M0FA 3MJRA 2X13A 2QL7A 1IY8A 3B1YA 4YCAA 3IR6A 3HA2A 4ENWA 2ZJ1A 4XQGA 1H2AS 4B3IA 5L3ZA 3M1YA 3KZMA 5GTDA 4HRAA 3RVBA 3RYCA 1SCKA 4TTPA 2ZGVA 3FMVA 2QL9A 4YRTA 4BXOB 2BZ1A 5AJWA 1L7VC 3L6UA 1WDLA 1Z39A 4IMRA 5H8WA 1B42A 4ARVA 1VGRA 1HDGO 3RRXA 4BV3A 4EA6A 2OQRA 1FNNA 1Q95A 4W9NA 4ZAZA 1P3DA 4MW4A 1E2KA 1NQ5A 2EJVA 1BDBA 3DLCA 1SD1A 2IUSA 4D8XA 3K8YA 4ZHSA 2PUAA 1JDJA 2DUWA 4C4PA 5HFJA 5JSHA 1P61B 4K0KB 1EVZA 1IK4A 1DBQA 1BN6A 2BBWA 2F59A 2QJWA 3HHEA 3T15A 4QKQA 4ZCRA 5AW8A 4J0FA 2CMGA 1J9GA 1KH1A 1V26A 2H65A 2I4TA 1UFOA 1N6OA 4C07A 2XWQA 1O9GA 3W5AA 3ELDA 3WRXC 1YS2X 3ENZA 3A2NA 3MBIA 3NDRA 3RYHA 5J4VA 2HL6A 4H6WA 2C2XA 4BZWA 3IKVA 4F38A 1GSAA 5L45A 2O8FA 3UATA 2OV4A 1DAKA 5CXQA 4B33A 3HZHA 4TWJA 3G8CA 2NUAA 1OFTA 2XCQA 4V2IA 4YDHB 2OKGA 4OSEA 4BV2A 4YA6A 3T35A 1TECE 2JH8A 2QTRA 3SG0A 3MJFA 5I7EA 1JAXA 2WJ6A 3LUAA 4JKOA 5EIOA 4KK3A 1PV1A 2XUQA 4AG3A 2NXCA 5HG0A 5KYXA 2JCGA 3NAGA 4WOCA 4ZZ1A 2J87A 2ID4A 2IY9A 4KGXA 3O8RA 3JY6A 1YR6A 3QE0A 4QU8A 5F5XA 4I1PA 2WSIA 4MKRA 5FUYA 3ZE8A 2V6FA 3L4SO 4ACBA 3MINB 5LDDC 1GTSA 3LX8A 4JXZA 1CRPA 4WCFC 2CGEA 2GARA 2GX6A 2QQEA 1Y1RA 1R8QA 3EW9A 1YQTA 3E1KA 1WXQA 3I1FA 2ZIUB 5IN5A 1C0PA 2Z3WA 1UIMA 1TM7E 4ASUA 2QRQA 3L4BA 5J5VA 1H93A 1I7QB 1RC0A 4Z8XA 4IIYA 4P58A 4EATA 5LD2C 3RU2A 5C80A 1JFVA 2YV4A 4DV3B 1HQYE 3R9XA 1T3TA 5AHXA 1FFDA 1XWIA 3WLLA 2BRUC 1DC6A 6PFKA 1H5NA 3KKNA 5BV8A 2D4HA 3QMMA 2XXJA 1E69A 5FA5A 4FT4A 2D1SA 4Q6WA 5DTIA 4C5AA 1T8SA 2AUMA 1Q0UA 2ZUWA 4G23A 2O0HA 3BXPA 4N6GA 4OQLA 1FDVA 3ZVMA 4UKDA 5D51S 3ODGA 2VNKA 3RC8A 4U1RA 2XCLA 3ROMA 1ZH8A 4GI2A 3PB3A 4AO8A 1R0LA 4IOLA 1XRJA 3LUHA 3PPYA 4O4JF 4Y1EA 3V4LA 3H2KA 1H05A 1YZ3A 2GJ9A 2PGIA 3ONNA 5KYYA 1ODCA 3PNQA 3CG4A 5J4YA 4BNYA 1L9XA 2XBUA 2XMQA 3F1KA 3G0CA 4BPBA 3K9BA 4RY2A 1KI8A 5BVHA 4QAJA 4YQEA 3AVWA 2DHRA 3FHTA 2OGUA 1PD0A 4F6CA 1P44A 3L02A 3FMIA 3T7EA 2X0RA 1Y5MA 1NOIA 4OKSA 3SR3A 3V7UA 1J1UA 4EJSC 1XQXA 2I2XB 3L6EA 3T5PA 4EKYA 1T9CA 5EQTA 3JQDA 2ST1A 4PS1A 4BNDA 1G6OA 3ZDYB 2DF8A 3GVHA 5JIBA 1KETA 2PWZA 1X13A 3OJOA 3WWCA 2HLDD 3S29A 4F3YA 3H2ZA 1DAMA 4KC0A 5LN1A 2VUTA 2HFKA 3QEAZ 3BGOS 2AFVA 2OOSA 4G4GA 4Q00A 5C51B 4WHMA 1TD9A 5TEVA 4C14A 3ICQB 4IFTA 4G0QA 4YAWA 1KGDA 3W7AA 5BPFA 4LC9A 4Y2RA 3T95A 3OQNA 3DLPX 4E0BA 3CUWA 5I45A 3MF4A 3X1WA 4MPRA 3IQWA 3WNBA 5L9AA 3RG8A 2WWYA 1QQ5A 4IVPA 1ZVKA 2R7MA 2YC4C 1Z13A 3CM0A 3O91A 4NBTA 4V3BA 2IYZA 1TKRA 4N4AA 4OYRA 4DCCA 2VHWA 4KNVA 3T12A 3PQCA 4S1PA 4ID9A 2ID7A 3U40A 4XVCA 5KX5B 3THRA 4W5NA 4B1FA 3U61B 3EWAA 5EE5B 2B7LA 3HL0A 2C77A 3AVOA 4QARA 1YBMA 4OQEA 5P8WA 5KHAA 2B4QA 3IVXA 2DH5A 1QPBA 5JPCA 1UM9B 3QU9A 5KNDD 2H1CA 2PFSA 3P5BA 2NYRA 1QHHA 1ZGGA 3K8QA 2CMKA 2NO4A 1Z4QA 2QYSA 1Y63A 1CLEA 2FFRA 4WFIA 4E15A 4YAKA 4K9QA 2LPMA 1UKZA 3LLSA 4QHSA 4PO3X 1DKNA 1PEAA 2H8GA 2JJ8A 4FIDA 2EQAA 1WCYA 4NNOA 4KIJA 1X1EA 2NO0A 2X3FA 4UBLA 2R8OA 2W6QA 5TMEA 4YUAA 4OHKA 1FMJA 1JECA 1YK1A 2JW5A 1BC5A 1FYDA 2WQZA 3SSNA 1LSSA 1N5LA 1YWGO 4FFMA 2F1JA 2C97A 1T4CA 1SBTA 1MH1A 1XKQA 2Z2YA 2LR0A 4JC8A 2QSUA 4R5MA 2JIQA 1NPTO 1WDKA 2W2MA 1U3TA 1X7XA 3RB8A 2XIQA 4YIKA 4ZMBA 2IY7A 4K6GA 1UDCA 1BIFA 2JVKA 2HMWA 4W6QA 1RPZA 3RYIA 1N7IA 2FFHA 3KEGA 3LGAA 4R2WA 4BL5A 2QF7A 1KU0A 5AHRA 3EFHA 5GJCA 4QLBA 5J58A 3M2TA 1C9DB 1BHSA 2AUNA 2HSWA 2ZP1A 3ESBA 5A0FA 1AZSC 1KFEB 2AZ4A 1PKEA 3KTAB 4OU4A 5K0FA 1EIWA 3LPMA 2FSIA 4M60A 4ZA2A 1XEWX 3DMFA 4BNTA 1ZKMA 2QVLA 3BXOA 1OZFA 1DRKA 3JQ8B 2QUZA 3A04A 4OK5A 4UHBA 2IGBA 3ZK9A 2YV5A 4CLDA 4IZ6A 3U9LA 4IEFB 3BE5A 3WIOA 3PX2A 4EG7A 2A5GA 4GLOA 4LOLA 2XB6A 3T3OA 2K87A 3L1IA 4KDRA 4QYMA 4XASA 5CJJA 4YMTA 5A7FA 4QQNA 4E1AA 5J4LA 3T94A 5IAOA 4E5UA 2UVQA 2QMZA 2VJLA 1FS6A 4Y30A 3EZGA 4ZYTA 3ZDFA 4DG8A 5IM4A 3DEAA 5LXTB 4KSCA 3GDWA 3LBAA 3L41A 3T7IA 3WHLA 4HY3A 4PGHA 3AJEA 1B7GO 1G8SA 1GL6A 2QPLA 3JAKA 3GBSA 1VCNA 5IKEA 1M2KA 4XYEA 4AMUA 4CUZA 1DIAA 2J32A 2PT9A 4A0FA 1M1ZA 3A14A 3OM1A 1ICIA 3EOBI 2OILA 5TS2A 4JLNA 2IOYA 3SHFA 1JI3A 4W5HA 2QY6A 3W6NA 4OL9A 2R4UA 4M6WA 1J8YF 1FJXA 3UJ9A 4LVOA 4G0WA 3X1YA 2WUWE 4WGFA 4B5KA 3BFPA 4ZQFA 2O8EA 2Q9UA 4IH1A 3DNFA 4BCDA 4NJMB 3MQ4A 4B82A 3BDAA 1RWQA 4EFMA 4KQWA 1PT9A 5AK5A 1LZKA 3FNGA 4DHEA 1COWA 1B0PA 5KWEA 2GOYA 3LBYA 2LGJA 3PDUA 1A4UA 2Q3JA 4IIVA 4PIMA 4E13A 5JSZA 2BC9A 4NBWA 3U3JA 3L46A 2FMXA 3V1UA 4MAMA 1UPTA 2AJLI 3G5UA 4Y2SA 4OQYA 4I9GA 3EFOB 1GUFA 4IJWA 4MW5A 4CEHB 1E63A 3CLRD 4LWZA 4K26A 2HN9A 4ND6A 1ZCAA 1UZLA 2Y8EA 4J6EA 4XUEA 1UQRA 1M2OB 1V43A 3UANA 4BNVA 1THGA 1J07A 5K03A 4HPJB 2QDXA 3FCYA 3LL7A 3QLUC 4DRXA 3N2YA 2DCUA 3AQ4A 4R1MA 1XELA 5ALQA 5I9SA 4MV6A 4LHEA 5ALGA 2Y1DA 3T3HA 4N01A 1FK8A 1EK1A 3AVPA 2B3TA 3FFAA 3CIOA 3P2IA 5I7WA 1UXHA 3Q8LA 5DKFA 4HDCA 1PU2A 3ZIAA 1KAEA 2AWNA 1TXGA 2ZETA 4CMAA 2ISSD 2CWDA 1NT4A 2JK1A 3IUNA 1E4EA 2DWQA 1N0VC 2PMFA 3F7NA 3SJCA 1K3TA 4MUXA 2I3DA 2VJCA 3ETHA 2NV6A 2INGX 1NI3A 4E51A 4R2IA 2IHZA 3EASA 1WTCA 3CRZA 2O2YA 4URXR 4GX2A 5ITVA 2IHUA 2LVBA 4C4YA 4AMGA 1CUWA 4IDDA 1A9RA 3NUQA 4LMAA 1SVWA 1VP9A 4UVIA 3N86A 3WOVA 4DS3A 4EMBA 4TRJA 3TZKA 3X1DA 1V25A 5HKKD 1RRGA 3BMCA 2W6JD 2NPIA 1L6IA 4AZ3B 5HF6A 2VAVA 2V3WA 2EEZA 4WQMA 4LRWA 5EZSA 2DG2A 3ZHXA 1D6NA 3IX7A 4KQIA 4YHHB 1Z0DA 5D1HA 4TV8A 3KJFA 3RVJA 3NM6B 4BMDA 5D7NA 4FYPA 2X4LA 1TLFA 4DW8A 3ZLTA 4F9FA 3L82B 3NRJA 3IOEA 2PMDA 5JZSA 2VSQA 3FYHA 3L05A 2QLJA 4TT8A 1O03A 3EF1A 1CVLA 5AW5A 3I9OA 4FYXA 3PNYA 2J9FB 3GDHA 4I08A 1XD8A 5JJLA 5J2UF 2OGSA 3PNVA 1WBJB 4MWCA 1NXSA 2FR0A 4UE2A 5I8PA 2WWRA 3VPDA 3JQ6A 1ZHOA 1ML3A 1ADFA 2FEPA 4MAAA 3L92A 3SAJA 2ZZNA 2I87A 2WJIA 3HCOA 2CXOA 2AK3A 1JLSA 1NRJB 1GGFA 1RMYA 2G80A 4N40A 4W9NC 5BNIA 3RAPR 4DXHA 5HIAA 2ATXA 1PRYA 2XUKA 1EQUA 3OPYI 3HDJA 1XFAA 3CE9A 1WV0A 5JWOA 1P5RA 2FJPA 4XGIA 1PDOA 4HWKA 4ZVVA 4HJRA 3DJYA 3H83A 4M1SA 1AQYA 1NN5A 2HWUA 3PJDA 4RABA 4GE3A 4JLPA 4H0NA 4NOJA 2GZHA 4KL8S 1WCXA 1QYIA 2CUKA 3KB1A 2PZEA 2ZU6A 3ANLA 2BHTA 4G0ZA 1L5QA 1PGPA 3FCXA 4ARZA 1BH2A 3DE6X 3L18A 4OMUA 3UHJA 1QVWA 3HADA 1D4FA 1QZZA 1KRHA 2EHDA 2ZRQA 3K30A 4BNNA 4F91B 1WKVA 1G8MA 2HHAA 1CU1A 5TEWA 4KQXA 5C4IA 1QPGA 3H13A 3AF5A 3IILA 1T43A 1WEHA 1CLUA 3RIMA 1E77A 3BMXA 3DOIA 2XYVA 2NTEA 3M6MD 4IXNA 5CR9A 3TK1A 2BYTA 2Q27A 2GSDA 1CUGA 2JDIA 1YQQA 2Q3HA 4RZUA 1T5DX 1HETA 1N0IA 1ECBA 2Q3FA 3DOOA 5LBUA 3DCJA 3SXJA 3OU6A 2WNIA 3TYXA 3CBQA 2PO7A 3IE2A 4JU9A 4EY4A 2VXBA 4GP9A 4M49A 4TM8A 5KMGB 4BNXA 3G2PA 3ID6C 4JI2B 5C9ZA 2AR0A 3RSQA 4NFHA 3OOYA 2Q28A 4FS8A 4ZRMA 3MMSA 5FEMA 5LQNA 3F73A 4KGZA 4IV5A 1QK4A 3R77A 3RJMA 3HY3A 4I55A 1HQKA 2QAGB 3GP5A 3GT3A 1R88A 5AVJA 2HHCA 5HA5A 4WTOA 2HDWA 2PVPA 2QTLA 1P18A 4GSKA 2WWXA 4H7JA 2ZITA 4WEQA 2YHSA 1RAAA 5T8KA 3CZ4A 1LGYA 2MSKA 3D64A 2BRUA 1NUQA 1R6AA 1TLTA 2YIVX 4XJVA 1Z8DA 3WV4A 1UMBA 4A1OA 4BQPA 4C0KA 3MTGA 4MS3A 2QU8A 4PYLA 6ADHA 2YWDA 5IT0A 2QIPA 3L5KA 4XB1A 1GNLA 1PNOA 1WB6A 2NSYA 2VF8A 3NBZC 3IP6A 4G5HA 5FI5A 3UH1A 4FWTA 3MTBA 5FBWB 3F71A 2H5IA 2A3RA 4R8KA 2QV0A 4ZYZA 5I5EA 5I47A 3I83A 2RSLA 4E11A 1Z6TA 1W75A 4A6PA 1JR3E 3HSKA 1NYQA 4L8LA 5IF3A 1PUIA 2CUNA 3SY8A 2FWBA 3GA0A 3G0BA 4H4DA 3WLIA 2QSYA 4G0MA 2WUGA 2RAUA 2UZAA 5ILOA 3L40A 4JQSA 1HO3A 4H3SA 2WE7A 5B2FA 2ABWA 1YONA 1OLSA 1JQEA 1GKLA 1U3GA 3JQ9C 4KLNA 1MGPA 3FYUA 3NKFA 3STWA 1S01A 2DGDA 3JD4A 1VKHA 1QRTA 3IEPA 2R8XA 1GPMA 3CEMA 3FHJA 3LUJA 5F1PA 1KI6B 3V1YA 1Z5UA 4YYZA 4LOIA 5E9WA 4Z0TA 1PQWA 2HU5A 1IM5A 1KHHA 2FQXA 2Z1DA 1E9CA 3LW7A 4KEAA 4NPAA 2I7VA 1FXUA 2QQGA 2VDJA 3FMOB 3O6VA 3SFTA 3ZE1B 5M5BA 3UOGA 3CH5A 3GYBA 1C9EA 2M2IA 3P9QA 4K8RB 2A57A 1TMYA 4AJHA 4F3KA 3CH7A 3OP4A 4GR5A 1L9KA 2YIMA 1T6NA 3EZ2A 4O2LA 3T5DA 5CFNA 1P2TA 4FC7A 4QTZA 1IN5A 3TW8A 3GLSA 3HKDB 3OLYA 4WKCA 4IKOA 4F6RA 1FDTA 1UUFA 2IEDA 1T5LA 1TK9A 1Y8RA 2OZEA 1EP9A 1B73A 1RBMA 2GBCA 2V4MA 2VZEA 4WUTA 4YJ3F 2RHTA 3SQLA 4C0XA 1PJQA 1AK2A 2YVQA 3JAWA 4GXNA 4B4OA 2EJTA 2WEKA 3C16C 1JDTA 1KJZA 1M75A 2VBGA 3GQBA 3I5MA 3MRXA 1MQ9A 4AYWA 5A3RA 2XQKA 2CT8A 3QXJA 4QRDA 1HLFA 3CB4A 4GPAA 3UWMA 4GI5A 1Z26A 2FPSA 4FEGA 4I0WB 1MOQA 4J2OA 4F92B 5HP4A 2GBPA 4K46A 1WUIS 4C0QC 1L4UA 1ZYUA 1LWNA 1RWPA 1Q7EA 2CCKA 2GPWA 2IIPA 2O5VA 1K8ZB 2XZPA 1VECA 3AEZA 3O8LA 3PUJA 1NLFA 5FOWA 5TT1A 3RBZA 3K0AB 4KLRA 1OX5A 1JBKA 4XOUA 1ZJ5A 5IAEA 3MA0A 1RJFA 2OUKA 1HGXA 3KB8A 1JNXX 4N5IX 1DO0A 1G8PA 3WYEA 4DFDA 2CXSA 2R86A 4UBOA 2QTVA 2JI8A 3OZWA 1KOFA 5IHXA 2NVUA 2VJDA 1WHSA 1L7PA 3S8MA 1WZ2A 3KTFA 3BRWD 2ZRMA 4R0NA 1CKEA 2H11A 2X15A 1QHFA 4O8ZA 3AT1A 4P5EA 2TSYB 4MGYR 4G84A 2H2WA 4D45A 1AA9A 1WSDA 2QTVB 2WWHA 3IKTA 3P1JA 5A9SB 3CX4A 2ZYGA 3K32A 1SUFA 4M2LA 2CCGA 4MYDA 4RIIA 3EQ8A 1U8CB 4YREA 3KJQA 5KIAA 3IMFA 1CSEE 1G20B 4R1QA 3VGJA 3FOZA 4NK4A 2GLXA 1F4VA 1ZA2A 5TB5A 3M4NA 1L8OA 2R25B 4QUAA 3I2FA 3VR4D 1M2VB 1E1CB 1YS1X 2ZYWX 2CHVA 1PR6A 4ZAVA 2JFBA 1KMHB 3FVVA 4CCAA 3DS8A 1IY2A 4GEKA 1JU4A 2WWTA 2YJGA 3OURA 5E0OA 4CKBA 1I4DD 4FYWA 3VVCA 4A92A 2AMLA 2QMHA 5CPBA 3LAWA 3O75A 4RIHA 4S1NA 4GECA 1NG1A 3MUNA 1CZLA 1M66A 1V8BA 2W58A 3F6EX 4R16A 2ZBGA 2W2VA 3OA2A 3GB9A 3IT2A 1E7WA 1E4OA 1R6DA 3JX9A 1CUJA 1A9OA 1WMFA 3L8MA 3BBLA 3WYNA 4BO2A 1SKUA 5MFPA 4KO2S 3ORRA 1QOQB 5IK2A 1ZGCA 5C7IO 4E5KA 1KI1A 1RRMA 2AEEA 1KL7A 4TOIA 4XPIB 5J4HA 4PYKA 4G9EA 1EVQA 1Y1PA 3L5OA 5AW7A 2DHDA 3R3YA 2JLXA 4FI3F 5FBHA 3FSGA 1XA0A 2JBWA 1JJBA 2F1OA 3N6XA 3AFIA 4D1YA 1BXRA 3IP5A 3PFFA 1BOFA 2GBLA 4JC4A 2XVYA 1SXJE 1X74A 4ZJYA 2FWRA 4DSTA 1LK0A 3GAMA 2RH5A 4EJ2A 2BJWA 3KVYA 4Y2GA 3NAZA 3CSSA 2EU8A 1RXSA 1EFPA 1WPGA 3DBVO 1FNSA 2FAXA 2HHLA 3C2QA 2AF3C 3DF7A 4DQVA 5DM0A 3LFHA 1XTIA 4CE6A 3I12A 4KHPB 1E9SA 1BEZA 1FZQA 1N3IA 3T4PA 1JQKA 3MUOA 1G1AA 2AC4A 3F6YA 1XLUA 3QVGA 3QJGA 1GZ5A 3M3PA 2JGJA 5JT1A 1KDOA 5TMPA 5HRCA 4XCQA 2E5FA 3H9BA 4FYYA 3WSTA 1COWD 1PEYA 2E85A 3EEFA 3U0BA 4BMOB 4NL4H 1HLPA 1V1MB 5LMNB 4U7JA 2HWKA 3AKZA 1B4DA 5LZ8A 5AI5A 3QEOA 2JHPA 3CNOA 1K5DA 4MWOA 5AVOA 4OLHA 1TFUA 1X7WA 1RSZA 2HTEA 3USES 3IHLA 4Q34A 3EIOA 4DCPA 4FFOA 3T9AA 2P35A 5E7IA 4IDGA 1S7GA 2P2CA 1YC2A 4OBBA 3ESQA 4ETIA 3P27A 1K4YA 1O7JA 4RADA 4TSKA 3FDFA 4FI3C 1G9SA 3WK5A 5SYMA 5JEDA 4OOFA 1K4KA 1LPBB 4J3FA 2F64A 2IX9A 3G6KA 3OY2A 2OXEA 3DXFA 2DLNA 3CF0A 4LJ7A 4YRMA 4D6XA 1E4YA 4ROSA 1GDHA 3B5IA 4PO1A 3BWCA 4ZRDA 1F0PA 1PJTA 2EWWA 4HQOA 4IJ5A 3P9ZA 2GM5A 3VU8A 4N3AA 1Q7RA 1TZBA 2OAGA 2Q5LA 4LRQA 3WGLA 1ZH6A 4QHTA 2NU9B 5ALDA 2VTBA 1BQEA 1M6WA 5T4EA 4KMOA 2GXAA 1MXFA 3ZCRA 1T1IA 2FW6A 4U5QA 3OZSA 3MRSA 4JI0B 4I1YA 3BMNB 3OT5A 1AY0A 3TOVA 1FLDA 3OECA 4JKYA 2CLCX 1RLJA 1Z7WA 4AROA 2C0PA 4RVSA 2AFHA 3EGWA 4TL8A 2AMYA 4XM1A 4DC1A 1NVAA 3OQ1A 2C7VA 2IIBA 2OENG 3DFZA 4LZWA 5K7SA 1OFGA 1EFHA 3AM1A 1M8GA 2YWCA 4ND1A 2H18A 4TMWA 1ULBA 2E1RA 2D54A 1E7MA 2V9CA 3TQFA 5DHTA 1IVSA 3OM0A 3WMEA 2H8KA 2IOQA 2YL2A 4U2EA 1ZOPA 2H5EA 3HSSA 4UMDA 1PG0A 1XEAA 3D2LA 3EIXA 4NEHB 4LXXA 2EG5A 1Z6YA 2G1KA 4QODA 3RU9A 4HNUA 1RIIA 1L8AA 2P8SA 3CVJA 4LF4B 1SOWA 1O57A 1UXIA 3NWEA 5C1IA 1M54A 2P40A 2AKEA 5AT1A 3T0IA 2Z95A 3J80A 1M1YE 4MULA 1IOLA 3A32A 5D87A 2ODWA 3F6RA 1BE6A 5BORA 5D5HA 3PEYA 1G9TA 3IBGA 3ZU5A 4EG1A 1M2JA 3H5AA 1W4RA 4YAOA 5TS3A 2QP3A 3V4FA 4JCCA 1F6BA 3TJMA 4HTFA 2EBWA 3RADC 4JOCA 2GZDA 2IZ5A 2HU2A 4W1QA 1E1QA 3SN6A 2X0KA 2RGWA 2XF8A 2HRQA 1CPYA 3QU2A 5BMVB 1ZWLA 4UXIA 4YO8A 5LJLA 2DC1A 3L7LA 3UQYS 3R0IA 3IOCA 4TZ0A 4JODA 4L5IA 4QM6A 4WVLA 2GBFA 3QKSB 1WQ3A 3DULA 5C5EA 4LHZA 4B6FA 1KPHA 1IJFA 1IEQA 1VLHA 3FB4A 4Q39A 4RSGA 4YJ3B 4BX9A 4QQKA 1H2ZA 3Q11A 4FLMA 4AB1A 4CR8A 5IASA 4MQ4A 4HGPA 2IH5A 3AVTA 3VKGA 1NW6A 1OV6A 1AD2A 5JXHA 5IC5A 2ZBPA 4JQCA 3ZGZA 1G3UA 2DFDA 2AIRA 2JAXA 3Q7QA 3EPPA 1RQ7A 1OJ7A 3INGA 3RF6A 3D8UA 2KB0A 4BNZA 1TQ6A 1URPA 1GRQA 4QLOA 3NANA 4M1YA 5ALTA 3C3JA 4UBNA 2IEIA 2NZYA 3BD9A 3ZU4A 5DEIA 4KNYA 2XF2A 3O93A 3TECE 1LLUA 2VJBA 1QCDA 2DSNA 2JHGA 2D7DA 4GR4A 2ZUDA 3L9WA 3ZJTA 1L3BA 4MUNA 1HYBA 1FJHA 3CNQS 3BGWA 2XKKA 4JUBA 1IOZA 3OTOB 2HPZA 1YMQA 5KWIA 2EYQA 2HSGA 3EOAI 1WETA 2DYKA 2EWMA 4LNUA 1MKYA 2ZYDA 4ED9A 1QIIA 3RLFA 3P9PA 4WY2A 3CLRC 4CMJA 4Z8YA 1V9SA 1M6EX 4KRGA 3VQTA 3UK7A 4NMWA 4A8JC 5T4FA 1EAMA 2J6CA 2QM3A 2AHRA 1ZZGA 4N47A 2QW1A 3ZNOA 2BGRA 1ECLA 1FMCA 4OQMA 2UYGA 4U39A 3BAFA 5JW6A 4D0SA 5JD3A 1SUIA 5J23A 3M1IA 3FYTA 3CRVA 1BWPA 4HBZA 4O5AA 4U3JB 3FDJA 4KYTA 5EEHA 2VS1A 1E18A 4WVFA 4CMHA 4D4LA 1O95C 3QPBA 2V9PA 3DXYA 3NR2A 2QB5A 5DCYA 3F6BX 4HX5A 1QORA 9LDTA 5I6DA 1M1NA 3AJDA 3EF0A 1U7UA 4AMVA 1U04A 1QZXA 4BQEA 3CT6A 4JLKA 4JUDX 1U0GA 2H2IA 5DBGA 5JV5A 2CXHA 5T8KC 4QU0A 2QD5A 2Z08A 1R0SA 1UT5A 4XM2A 2XMRA 1DXQA 1TJYA 2DBQA 3E53A 2DPGA 3MT9A 5FPPA 3I62A 3PX3A 1UZMA 2CE7A 4FZ5A 5AKHA 5FWAA 3MBKA 1TKAA 1ECCA 3ROKA 3TIFA 4WDQA 5JY1A 2YIDA 2BAGA 3UY4A 2B78A 1KJ8A 2F00A 2V7BA 3QFCA 2DSTA 2WU3A 5IBCA 3GPIA 2DERA 3GZNA 4G3XA 1T9KA 3AZOA 1WDTA 4TTIA 3HYSA 1ONOA 2Z9BA 1W93A 2BP7A 3HJGA 4MH0R 3ZWYA 4H7KA 4WBNF 4DT1A 3ADKA 4CETA 5DNCA 3JZIA 3HYTA 1L5GB 1E2EA 2A5YB 1M0TA 1A4XA 1CJSA 3BN3A 1TO2E 3T5BA 4YACA 1EA7A 1P9WA 2BONA 4IMJB 4EHNA 2D1RA 3RWOA 3GZNB 2EX4A 3RROA 2HBZA 1JBQA 1JPUA 1DRUA 2QROA 2R00C 3NFRA 1DZ3A 1XRMA 2R4QA 3E81A 4NYJQ 3T1VA 1CEQA 3GRPA 1SFRA 1PZFA 1VPWA 1RYBA 4WECA 3SICE 3T1OA 4AURA 5YASA 5AIBA 1ZC3A 2UYOA 4INZA 2EKLA 3MIIA 2Q1UA 2KYRA 3D3WA 3LHFA 3FI9A 5GM2A 4DDTA 1HSOA 2B25A 4MVJH 3LT5A 3VR3A 1XN4A 4JDUA 4L08A 2WP0A 4Q9JA 5C46F 5CH3A 5JMPA 2YDXA 2C4MA 3FPBA 3FSGD 1LTHR 2CUTA 1EFVB 3GJ0A 3DL2A 4DUGA 1KZ1A 2YXDA 3GEDA 6CHYA 5JZVA 3HZZA 1ISRA 3AF0A 2EG9A 4MHSA 3S6JA 5K8CA 3HBLA 2AF4C 2Q5FA 1X9GA 2ET6A 1W47A 2B9VA 4JC5A 4W1SA 4UUPA 4MCHA 3A1TA 3PRJA 3TL6A 3UICA 1PK7A 5FH9A 1DSSG 3PXXA 1CXZA 2GM9A 2YXEA 3FPGA 2BHNA 5H80A 5E9QA 4NY1A 3LUKA 3V1NA 1XDGA 2C7GA 2IXTA 4FEAA 1F2UA 1N8KA 1KOJA 3Q7PA 4UDXX 2QTWB 4RK1A 1OFVA 2EYUA 2FN4A 1SC9A 3ICPA 4ZAGA 3TQSA 5ELMA 2DWUA 2VDMB 1ZJWA 2G5PA 4IO1A 3GARA 2XNJA 4GKAA 1CQJB 4IZOA 4UAUA 1K6EA 1E3LA 3GROA 4F1KA 5THXA 4DLYA 2VRNA 1D9ZA 3KOWA 4UULA 3W9YA 4HNVA 4HWPA 1YRYE 3NLLA 1C50A 1HWYA 1WKCA 1PW5A 3ITEA 3OP1A 2ZPTX 3G9XA 4CFSA 4UM5A 4D2IA 2VRWA 1WZEA 3JU3A 5AVKA 1VSVA 4WGGA 4IGIA 1YU6A 2IEAA 3PD0A 1U0LA 1A9YA 2RHJA 4OAPA 4PX9A 1JV2B 4B7UA 3K0SA 1F9AA 4N9WA 4FUQA 4BB9A 1UT6A 4E2XA 5B1EA 2BH2A 4M0KA 3H0KA 1JE1A 4KI7A 4J8PA 2ANBA 2HSEA 2GZSA 5FI0B 2IELA 3ET5A 4JNKA 4CMEA 4IIHA 1E0JA 1Z6XA 3HCFA 3JQQA 2X4DA 5E1BA 3CTPA 3FLAA 5AOAA 4BGEA 5B7NA 5K5EA 1ZIYA 3W79A 3WGIA 1TW2A 3G2MA 3RIGA 3AVUA 2JARA 4YWJA 3UAZA 4RORA 4BUJA 3M89A 3WE7A 4HFJA 3H4TA 3OM9A 4CG3A 2HPVA 4BGIA 1TVKA 1J8DA 3KEMA 4L8WB 2PG3A 4URHA 3FCCA 3OCUA 3L7AA 5F7JA 4AZSA 2HUPA 2P7IA 3WIDA 2GEJA 1TEHA 2REQB 1K4MA 2J3LA 3EDCA 4UAGA 1ISMA 4IHJA 4X92A 1A9TA 1W88A 2ZT5A 4MQMA 1OZAA 4MJ3A 1MDBA 5DGCA 4EMUA 1XVUA 4MR8B 2FSVC 4Y2HA 4M9XA 4Y9SA 5BSFA 4CEIB 5LZ7A 1KO1A 3GAAA 2I2WA 1U3WA 1TQ8A 1XU9A 3EDQA 4Z86A 4A0SA 5KOYA 4RA9B 4AD8A 9MHTA 3M49A 1FFGA 2WJVA 4INJA 1E3IA 2VPZA 2JFWA 3B60A 2PDAA 3CZMA 3E3NA 1TGYA 4JR1A 4PLHA 3H18A 3N76A 1IQPA 4Q1FA 5EZYB 1YOBA 3EN0A 3AERB 4AJOA 4F06A 3ZJ4A 1DO2A 4MR8A 1JE0A 4Y6SA 5JFGA 2Y1XA 3CLSD 3UCEA 4A8JB 1PWYE 3H2SA 5JAOA 4QBGB 1Y0BA 4CGYA 1T6YA 1K98A 2CVHA 2O9JA 1GGVA 4NV0A 4QIHA 5I9NA 3W1VA 4WACA 3ZX5A 1RLTA 1ZOLA 5K0GA 1SB9A 2JGEA 3GIWA 5LPNA 5C7LO 1IEVA 2Q41A 4ONEA 1FZTA 3IQIX 1CFJA 1F8GA 2V7QA 3G9TA 3HRIA 1JVNA 3QF7A 5CDSA 2OSBA 1Y98A 4I8XA 3ZJ5A 5H9VA 3UJHA 4W8OA 4TQGA 3FWPA 3AFMA 3ZIUA 2FR8C 1LC0A 4JXKA 1CERA 3B12A 5KTKA 1CQZA 3UMCA 4CL8A 4YB8A 4QDZA 2POCA 3WNVA 4AJ4A 1FPQA 4KN9S 4M21A 5LXTA 3PEWA 2AZMA 2BR3A 1IHUA 1XZPA 2V7VA 2XV1A 2FPGB 1NI4A 1G55A 2NGRA 3EIFA 3KXDA 3LCCA 4PYRA 5IVPA 1ACJA 3ETJA 4JFAA 4X3CA 4GZLA 1V5GA 4WKNA 3PNMA 1I32A 4C88A 3JAMA 4B3MB 3OSZA 3HK2A 4NZZA 4JBIA 1XAIA 2P0AA 3S28A 2WSSD 2V6MA 1ZM4A 4F60A 3H6GA 4CLXA 5MDHA 3FUXA 5DE3A 4E6EA 4MEBA 4EUFA 3VJMA 5LQAA 4NLLA 3N8HA 1JZSA 1NRIA 1OU4A 1R0ZA 5H70A 2P2DA 1ADBA 1CIVA 2SBTA 3CGWA 1C9MA 2VZLA 4X94A 4ZTUB 1N77A 2NQ2C 2VOJA 1H2WA 1TUBA 4HTAA 5JO9A 4GGMX 4KFSA 2UYHA 4BP1A 3UAYA 3JQPA 5A3QA 5K05A 1HT3A 2XRFA 4MPJA 3KL4A 3E9YA 1FRVA 1P8JA 2W2XA 2YWGA 4LJKA 1XMQB 4OP2A 3BMQA 4V1CB 1D0VA 3OT1B 4A03A 1PWHA 1R0WA 1SNYA 3R3JA 1A8HA 1NURA 4WLFA 3PENA 4YROA 1KFJB 3FCSB 4HSGA 1WM1A 1CY7A 1UZAA 1B93A 1E58A 2QN7A 1G291 2PMKA 3MXOA 2FDXA 4Y6QA 5CM8B 3IUJA 4WZ6A 1W85A 4BS9A 4ZIRB 4IBOA 3IMKA 5EQFA 1O08A 4NHOA 3L7CA 1Y1TA 4NS1A 1KKMA 2O1EA 1TQ2A 2ZBQA 4BC1A 5KUTA 4Y3UA 5H0IA 1XCPA 3G1WA 1GPYA 4G2TA 3FKJA 4JZKA 4P0TA 3ZK7A 4P3KA 3FA2A 4EB3A 3DMPA 3PGXA 5KU7A 2WTNA 4J4TA 1JLKA 5LIPA 2FPPB 3RSCA 4R3UC 4ZWNA 3QI2A 4F85A 2RMKA 3HBJA 1JG3A 4WJKB 3ZHTA 1E7YA 2P1RA 4IMPA 4F4UA 3ZK8A 4Q5IA 2HLDA 2ICAA 4TVOA 4XQCA 4BEWA 3DLBA 3HVIA 1GFWA 2F2TA 3AHDA 3CKYA 5CA0A 4JY7A 4KMRA 1M0SA 1YNSA 5EIEA 1WWKA 1GAEO 4LTNA 5DNVA 3QITA 2ZUUA 1KP2A 2BFBA 1JXMA 3SS8A 1P4SA 2CW5A 3E7PA 3X1JA 1USGA 4X8HA 2Z0MA 4NZMA 4O4JA 4UOZA 1O6BA 3B2NA 2KX7A 3BH7A 4P7GA 1FFSA 5HJ2A 3H9UA 5TPWB 5ERGB 1HE3A 2VDPB 4B87A 1Z47A 1A72A 1ZICA 3K2IA 2J08A 3NBFA 4EGCB 2AI3A 4LY6A 4CM9D 3AJ9A 1LJLA 3CS3A 4PGGA 4WZAE 1X1CA 5E1OA 3NU1A 1SB8A 3W05A 3WDLA 1KAQA 4X90A 1YZFA 1A98A 1BEEA 3N8DA 4AM8A 1L7XA 3RFUA 1CS4C 4Q9DA 2QV7A 1N6LA 3AILA 4C4RA 2PSFA 3G0IA 3NQ41 5M2QA 5CLLA 2VPYA 1IBKB 2WT4A 1DEKA 3WC4A 1SPBS 4G1UC 1ES9A 4R2MA 4AJ9A 5FTLA 5KTMA 3IQZA 2XQVA 3EGXB 2SCUB 3HCCA 3NYIA 3QYJA 4HNHA 4PR3A 4PNPA 5LBIA 1H6DA 1OIVA 3GEHA 4NQRA 3DDUA 4PG4A 1RKQA 2DLCX 1Z08A 4H3HB 3WJ2A 3LOPA 3B2QA 1R7RA 3NH9A 3QVKA 1QANA 1ZNZA 1H2RS 5LD2B 4I81A 1L5YA 3VR2D 3Q0TA 1RZVA 1T2FA 4V03A 4AC9A 3FYUB 2EZUA 2QW0X 4HS4A 1KYXA 5EZYF 1JXOA 1VQ1A 1Z74A 2HXSA 2V6BA 5C0OE 5C18A 1WMSA 1WHSB 4MW2A 1W2WB 4PZLA 3MB5A 5BN3A 1N1DA 2RHHA 4OD0A 3HA7A 3II6X 4A7PA 3OIYA 2A1TR 1C4WA 3EZNA 4JU8A 4WZAB 1U81A 1ZGZA 2Z56A 5DW0A 4BP3A 5IT4A 1KZ6A 4X93A 4MWZA 3JQAA 4JLOA 5IXSA 4EJMA 2R85A 3QY0A 4G8JA 1XHFA 4RZSA 4S35A 3UK2A 2P9BA 2I1QA 3G2HA 3I4LA 4UQPA 4RVGA 4PAQA 4YI5A 3FGNA 1R0XA 2OP1A 1GXSA 1EHIA 2IWRA 1MORA 3TSOA 3COJA 3DW3X 3NATA 5KX5F 4EL0A 4PYQA 3HCAA 2XDQB 3SIPA 2NU6A 1HDEA 4OXNA 3C3CA 4S2UA 5EIHA 4R6XA 3C6YA 4ZU6X 2NZJA 3A6KA 3D31A 5EP4A 5FO0A 4MRMB 5FLYA 1IPEA 5I7AA 3T99A 4DR3B 2FQ1A 5C4MA 3PDWA 1AO0A 1I94B 2BLNA 2WFAA 1G5PA 2HJWA 1N2BA 3G7SA 3GT0A 4B2PA 2W2NA 2XLCA 4TTQA 3OKFA 2YJZA 1UC9A 3NRBA 3ZH2A 2AG1A 1FSPA 5DTMA 4DUGD 2DR0A 2MSCB 2OG2A 1J0EA 2YY6A 5HRAA 1OQAA 4RBNA 2BMDA 1KYZA 2FUKA 2C4UA 3MD0A 4OHWA 5HOEA 2GF2A 3VC2A 1QGUA 1JI0A 3F3MA 1SKYE 4R0VA 5JMTA 4G0YA 5JTUA 2ODTX 3MT8A 2PKRA 1L5RA 4JSYA 1EHYA 1Z07A 3SQDA 4BHTA 1P9LA 2HSZA 3C3PA 1MUUA 3AKEA 1UDWA 2H7CA 3RD5A 5JWRA 2OBYA 2B21A 1XMSA 1NVTA 2QR3A 1W8DA 4XQEA 1FQKA 2XSZD 4AIIA 4NPCA 4NZ9A 1BRMA 1EGAA 3B1JA 4GL4A 1MVOA 1ZCFA 2PH5A 4QOJA 2O3UA 3TEMA 3SF8A 4DIOA 2NVUB 1QHYA 4EUSA 3L7KA 3AL2A 5FA8A 4AZ0A 1C1DA 1QVVA 2P5YA 4M1TA 2G71A 4YV7A 1C9NA 4ZPXA 1Y1QA 5JDIC 1KC1A 5INTA 2AJDA 3FX2A 2O6LA 4D8VA 4UCWA 1ZSNA 3JD2A 2ATVA 3L1JA 3SC6A 1PVOA 4YHBA 3GUYA 3KLMX 4ROTA 1D07A 4TVBA 1H2BA 3L01A 1N2GA 1JEAA 9ABPA 4MVWA 2XCSB 4TT3A 1Q44A 1VG0B 1IE3A 3IH5A 4A10A 4J6FA 1FDUA 1DADA 3G2NA 3RARA 2PT5A 1IYZA 2CY0A 4XXHA 3UT5B 3ZR4B 1SR8A 3LLMA 4HKTA 3HH8A 1MHTA 1GTL1 4GDFA 2VN8A 4XR9A 1A76A 1EZ1A 4QGGA 4GOND 3DAFA 3FOWA 5HZMA 2BGIA 1MB3A 3AHEA 4M38A 4JIMA 2NPOA 3E9EA 2GA9A 2OWDA 4G5FA 4YJFA 5DBHX 1GU7A 3FPKA 3GJ4A 4AMYA 1LZLA 4EO4A 5B5SA 1LLCA 3SNHA 2I3GA 1XHLA 3OE7A 4B47A 2C2MA 2BDEA 4P3XA 4WUVA 1HKHA 5CVVA 3TDKA 1F14A 2H2DA 2QRHA 1KY2A 4E2FA 4XZ3A 4YGXB 4RTSA 1BD4A 4N12A 4KSBA 5C35A 5LFAA 3RRFA 3EXFB 3HDQA 3IXMA 4J03A 2Q3MA 1NJSA 1XDUA 1NW7A 5FI1B 1IQUA 3SOPA 2D1YA 3O2NA 2VYCA 3OFKA 1I7LA 1N0WA 1NSTA 3CWQA 5J9FA 4DJ5X 2JLBA 1O97C 1RJDA 4TKUB 4HXFB 2HJ9A 3RSGA 2HQRA 3AUUA 2C07A 3D8BA 1UJ6A 1FL9A 3BF8A 3AR4A 2E2WA 2LKCA 2NUPB 2H1VA 2YNMC 3DD5A 3HB4X 3SSMA 3PKZA 4OYYA 4EPXA 4LEIA 3U7QA 2WKQA 4KQCA 1IDN1 2XMPA 1X2BA 1UDBA 4DB4A 4BO1A 2Y67A