2M6LA

Solution structure of the escherichia coli holo ferric enterobactin binding protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrienterobactin-binding periplasmic protein
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 45
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6lA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6lA02
2WI8A 3AESA 5M3BA 1PQ4A 4WNAB 1H1LB 1N2CA 2M6KA 3AERA 5KOJB 1G20A 3CX3A 5FLYA 3LI2A 5KOHB 4BBPA 3GI1A 1FP4B 2R7AA 4DBLE 3AEQB 2XDQB 5KHLB 4HMPA 3PSAA 2R79A 3TEFA 2OGWA 5JOQA 2WHYA 4H59A 3MINB 1QGUA 2QI9F 3UJPA 3NU1A 4FI3F 3AETA 4WZBB 3HXPA 4G09A 4IRMA 2ETVA 4WNAA 2AFHA 1M34A 5BVHA 4FNAA 4WZAB 5HX7A 4UTPA 5JPDA 4N01A 5KOJA 4TKVB 4NNOA 3AEUA 2M6LA 1QH8B 1L5HA 4NNPA 2XDQA 1PSZA 4INOA 1KAHA 1QH1B 4XPIA 1G21A 2PHZA 4HN9A 1TOAA 4H0FA 5M34A 4OXQA 4INPA 4WESB 4M7OA 3AEKB 4MDYA 4MX8A 3HH8A 4WN9B 5BVGB 3U7QB 1MIOB 2XH8A 2MINA 2YNMC 3PDIB 4FKMA 1M1YB 3K1AA 2RG7A 1K7SN 4FILA 4ND8B 3ZK9A 4TKUB 3BE6A 4PM4A 4UTOA 5I4KA 3EIXA 2AFIB 3MWGA 5AFSA 1H1LA 2X4LA 4G07A 3AESB 3R5TA 1QH8A 1ESZA 4UDNA 2PRSA 1N2CB 5KOHA 2XV1A 5M2QA 1G20B 2Q8PA 1FP4A 2OV1A 3MFQA 3AEQA 1M1NB 2XUZA 1KARA 3TNYA 5JG7A 3MINA 4ND8A 3R5SA 1N4AA 2PS3A 2Q8QA 4WZBA 5B58T 4UDOA 2PS0A 3ZKAA 4LJSA 5JJ5A 3MWFA 1XVLA 2XQVA 3AETB 3EIWA 3MD9A 5CX1B 3ZTTA 5M29A 4WZAA 2XY4A 1M34B 2AFHB 5BVHB 4TKVA 3BE5A 1K0FA 1KAEA 5GGYA 3G9QA 3TLKA 4OVKA 1K75A 1K2VN 3AEUB 1N2ZA 2YNMD 4MLZA 1M1NA 4PAGA 3AERB 1L5HB 3LHSA 2OSVA 1QH1A 2O1EA 4GICA 4HMQA 2PS9A 5GGXA 3ZK8A 4MO9A 3PSHA 4HMOA 4WESA 4XPIB 1G21B 3AEKA 4WN9A 3HJTA 5BVGA 3U7QA 1MIOA 3PDIA 4CL2A 1N4DA 1M1YA 4LS3A 5CX1A 1EFDN 4TKUA 1QGUB 3ZK7A 2MINB 2OV3A 3K1AB 4K3VA 5CR9A 5HDQA 2AFIA 4B8YA 4OXRA
chains in the Genus database with same CATH superfamily
4X9XA 1Z5ZA 4FLEA 3ONVA 1B8UA 1DRKA 3GFGA 1T43A 4EG3A 1C9KA 1VDZA 3SDBA 3NFYA 1CVRA 3H1FA 4H1TA 4NOLA 4CLRB 1IMOA 3OT5A 3B5JA 4MK4A 1YK1A 5KOHB 4LW8A 2AIRA 1PS0A 3KQLA 3JALB 4MV8A 4KQ6A 3MAJA 4DLKA 3ZJVA 4DDTA 1WW3A 1FRNA 2HTFA 4Y2SA 4KWHA 4J0KA 4O4JA 3A2MA 2AOTB 4IPTA 1GRNA 1JHUA 4QOHA 3JR3A 3ROZA 3RYIA 4BNKA 2ZSJA 5I3ZA 1P45A 3M3HA 3TRJA 3UJ7A 1MVOA 1P44A 2QGZA 3WLNA 3WBJA 2CXSA 1Y37A 4R8SA 3NU1A 3KRTA 2JI9A 1RRCA 3J7TA 1SHTX 4D02A 1Z28A 1P3Y1 3BJEA 3OIWA 4G09A 3IL2A 4EKNB 4D3FA 2PGOA 3JQDA 2A0XA 3AO0B 2VA9A 3R5KA 1KXJA 2IW1A 4R1UA 4AMZA 5KNBD 3HJFA 3SKYA 1P6UA 4F8JA 1T1IA 3HYLA 2LUOA 1KDVA 1ZJZA 3KB1A 1PZFA 5FFNA 1S7CA 3OZIA 4CF6A 3OCYA 1JG2A 1D1TA 1U65A 2ZJ6A 4BNVA 1PJQA 4AP5A 2P2CA 1C1HA 3GP5A 4D26A 4JYAB 4XOIA 1I7DA 3I92A 4MR9B 2ZAYA 2JASA 2WAYA 4EL0A 1CNFA 1FSZA 1S4QA 4HAOA 2EKLA 3WKCA 4M7OA 2IEZA 3WBFA 3DO6A 1F5SA 4HI0E 1C30B 2VF8A 3QIAA 3W9SA 4QDTA 2CGEA 1PP4A 2ZBVA 4HEHA 1YC5A 2KM1A 5ITVA 1TQDA 3ICOA 3E0XA 1GUFA 1JWAB 2BJVA 2AFIB 1GUAA 3PEWA 3D6NB 2WM9B 2JIZD 2VSNA 1EZ1A 2C8LA 4FD2A 5ALEA 4ZK2A 2ZI9A 3UK6A 4HDMA 4IH4A 1WCIA 3CLUC 3VDRA 2I54A 3K2QA 2W2KB 3RRFA 2D1YA 1FP4A 2W7TA 4MW2A 2QBYA 2D2VA 3ENQA 3BXHA 4N4AA 1EJ0A 1QVAA 1V1MA 3QVJA 3QBJA 3SC3A 3R3SA 1JUDA 4HUQB 5FLEX 4OHUA 2PUCA 3CT6A 4CPDA 1A1SA 1NKTA 2X0IA 1XROA 5JJIA 5JD4A 1FFXA 1GTG1 1QO0A 2R8BA 3RJTA 4BLPA 1Z6QA 1KEKA 1NDHA 3HG7A 2YW2A 4LJSA 3L4EA 1V7ZA 4U7DA 3IP5A 3Q15C 4UTZA 3E9CA 3TH5A 3ESQA 1KPIA 3PGVA 1L7AA 2F1OA 3H3XA 1O5TA 3DVAA 3S5UA 1II9A 2FWBA 1T4MA 3PNQA 1J24A 1KMNA 1CR2A 5DGCA 4CL0A 1UEXC 3PT9A 4V1CA 3K96A 4QYTA 5LCXA 5EHZA 5LQAA 4B6JA 2O2GA 2FVYA 3BJZA 3FUXA 4GI5A 3D3QA 1W88B 1XR3A 3PNPA 4NK4A 4IVRA 1L5QA 4YJFA 4YJ2B 4IEFB 1WP9A 5DYYA 4JL6A 3VVMA 4D0LB 2HRBA 1WL8A 3A25A 4MI3A 4URXR 1ZZGA 3COSA 3WQQA 1GQQA 4FLFA 4KLAA 2UZIR 2LDBA 1K7CA 3IIKA 1HDCA 2HEGA 3H97A 2EQ5A 4I3GA 3RVBA 4HC4A 1EBUA 4YO7A 1DFGA 3TDKA 2ZSAA 4EA6A 1QQAA 2EFHB 4EYQA 4YQEA 2A0YA 1RM3A 4JLAA 1AUOA 1A4UA 2XYPA 4OQPA 1EEXB 1WXXA 5BNZA 1KO1A 1V3UA 5HEKA 3O2JA 3GJQA 3MVEA 3UWKA 5HKKD 2BAGA 4GHWA 1C50A 3K8YA 3CW2A 2B37A 4V0RA 2RHDA 3KD3A 3U2QA 1TVMA 2QDXA 2YYSA 3NM4A 5JUWA 2VYND 1T0HB 4MCHA 1MAUA 3ICVA 1N1GA 1WY5A 5K3BA 2ZSUA 5C3MA 2G0NA 1OH8A 1AQIA 3QUQA 1IQ0A 3NV9A 4AZVA 4II3A 1ZVJA 2D8AA 3QWHA 3PIIA 3LQYA 1XT6A 2R79A 4O2AB 2FR1A 2X40A 1NDUA 3GEPA 4DIKA 4GPIB 3QU2A 4L8YA 3NT4A 3O9VA 1BW9A 4DGSA 2TSYB 1J8QA 3HU1A 5IH3A 3VHQA 5KYYA 4DV7B 3RF6A 1NJGA 1R6AA 3TR6A 4Q7JB 4LF9B 4KRFA 2BVNA 4LOIA 3BFKA 1X92A 1F17A 1WBDA 2PBZA 3UXEA 1C9EA 4PPQA 2XWJI 4K28A 3FKQA 1EPUA 1NLYA 4B4KA 1I94B 3PV0A 3AR5A 4LRWA 1MAVA 2PL3A 3SY8A 3V2IA 5B7NA 4C4TA 5FPTA 3T94A 4AT1A 5CDFA 1D6MA 2NW6A 4C89A 5I6DA 1JR2A 1QB7A 3IT3A 1E1QA 1L5SA 3C41J 3SF0A 2X6TA 4C0KA 1N0UA 4GBED 4M9UA 1Z15A 3CUTA 821PA 4P0QB 1LPAB 2E48A 3W2EA 1Q77A 4CDGA 3C1OA 1UPUA 3V4VB 1Q0TA 4TWRA 1KYQA 2H5IA 4K5QA 4OKNA 2A9JA 1CZHA 2ZSKA 4ZICA 1PUJA 1E77A 2LGJA 2JIBA 1THMA 3HDJA 5AK6A 1UFVA 4BJ6A 1S2IA 4FSXA 4QRDA 2JKZA 3NHLA 3OFND 1TI7A 5LBUA 2QUAA 4IIGA 3UGQA 4PTYA 4D41A 2I4NA 4NE2A 5H3HA 2F43B 2V3CC 4MVYA 4RA6A 4QPJC 3R0JA 4AJOA 3Q7PA 2Q5IA 1GT6A 4MV3A 1Z56C 4JBHA 3JQAB 2GAIA 3IR7A 5FNVF 5FWDA 3W0LB 2BH9A 3IH5A 4C3OB 1CUDA 1UPAA 4E31A 4N8DA 5F1KA 5DNUA 5T4EA 3WL4A 1A96A 5JXGA 3I1IA 4KBYA 4CLOA 3AUTA 2YWXA 1ZK4A 3G6KA 3M6LA 4LXUA 5A04A 5DLYA 2G06A 4G0NA 3P0IA 1IK4A 4KQGA 4BNLA 1GTJ1 3GBSA 1TYAE 4J43A 2PSEA 3ONWA 4UZFA 3DE2X 3RHZA 1BE1A 2VEDA 5AVOA 2I6UA 2BFAA 4GGPA 5IJXA 2JG3A 4J07A 1DJMA 4KJXA 3R8CA 4WXYB 1H2WA 3PSHA 1XSEA 4EW6A 1KIMA 3DE5X 2G9RA 5CFMA 3U3ZA 3WK8A 3FCEA 1P1IA 4REMA 3W7AA 2JFWA 2C20A 2C98A 3JD2A 1YACA 3CNOA 3TKAA 1BXKA 3EZ6A 4B31A 3C5CA 1R3UA 4Q9KA 3UUFA 1XAJA 1CS4C 4MKZA 3MWYW 4R1QA 2Q3DA 5AUOB 6AT1A 4OUKX 1GGEA 4LQCA 1K7FB 4YI3A 4JSTA 4RELA 1WXIA 1RAAA 2GI4A 2UZ3A 4A0QA 1XYYA 3DFUA 4QE3A 3GJ7A 4D8UA 1J8DA 4UHJA 2I65A 4BZZA 2FX5A 3ZZ1A 2DZDA 5B6PA 3U19A 4CV1A 3OQ6A 3M83A 4EG0A 2YASA 4NWIA 2PPVA 1KFKB 2AMJA 2OGWA 3OI7A 4NABA 1QQ7A 1BQ4A 3K2IA 5L51A 1Z4IA 2R8PA 3ERCA 1OA0A 3DSRA 1X1BA 5DBFA 1KYWA 1VI6A 1U4NA 1MXFA 2VZLA 1R74A 3W04A 3V7NA 2RGWA 2I62A 3F6YA 3I2HA 1MW8X 1WU8A 1ND5A 2VAPA 3B7GA 2HT6A 3LUBA 4KH1A 5TEVA 3RT7A 5BVHA 2M6SA 4YMUA 4ER3A 4WXEA 5TQ0B 2ACKA 2YVLA 1XD9A 3VPFA 3B70A 4M54A 2VQEB 1PU2A 2W98A 2XITA 2NTYC 4AUKA 2J3DA 3SLKA 5BSGA 3D1LA 1LF0A 3HA5A 1G21A 2CMDA 3NOVA 1PHPA 1XEWX 1WHTA 1UBEA 4XM0A 4EH1A 4KKVA 5L3QB 2ZIGA 3B6MA 3MC1A 2YV4A 1A9XA 3KAJA 1HXHA 1MJFA 2CXPA 2ZRLA 1VHWA 1WM1A 3MWEA 1N3YA 2QTMA 1K7SN 3C6ZA 1IK6A 3OPYI 1IZZA 3STUA 4HRVA 4LC0A 3DA8A 3RC9A 3ZWQA 3PZRA 3GFQA 4FFLA 4TSKA 1JQEA 3B3QA 3DBLB 5EP3A 1G8FA 5HMMA 2V6MA 1PYDA 2FEAA 2HCRA 5F4BA 3WYBA 4B6SA 1U4OA 3VR4A 2GA8A 3R6TA 4BBAA 5HCNA 1JZTA 3LK6A 4IJKA 4LF7B 3OSUA 4CMBA 1L9KA 3HCOA 3WDLA 5ESRA 3VO9A 1PG5A 3F98A 4HDNB 3FBWA 4WEOA 4D0RA 1XD8A 4DCJA 1JI0A 1Y6QA 1ZLXA 2OD7A 4A23A 2ZS7A 2JIMA 3IDOA 2HYDA 5F2EA 4YJGB 1LI4A 1L4FA 2KYRA 1V11A 1ETHA 3P19A 4MV6A 5JZSA 3VC2A 1S0UA 1P0PA 4CT0A 3THOA 1SUDA 1I3CA 2B1RA 2OZLB 2JB9A 4JVNA 3U40A 5TEWA 1AZTA 2B21A 2H52A 5KX5A 4DLSA 3SU8A 1VL2A 3QYPA 2I6QA 1ISMA 3EF0A 4CN9A 3CINA 1PJTA 4NH0A 1ND6A 3A1SA 2OK7A 1Z2DA 1QU2A 1UMCA 2B3TA 2ZIFA 1ZH2A 3QNWA 1LQUA 4XRGA 4RZ2A 1XWIA 2UU9B 3ZDXB 1KVTA 4R5MA 2AXQA 2HNBA 4PPFA 4E1AA 5I48A 1X7YA 2NO4A 4R41A 3QPUA 2NQ2C 3CY6A 1FK8A 1QK4A 2OD2A 3CEJA 4CKCA 1ECLA 3CKYA 1QF6A 1E3MA 2NO9A 3E7PA 1HNZB 3IHLA 1MDBA 3R0ZA 2OVFA 4BVBA 4HJRA 3PZBA 1HNXB 2NXNA 1UDBA 1GKUB 1TIPA 3DPUA 3G49A 3TYXA 4DILA 3MGKA 1UZLA 1VKZA 1LTHR 4OLFA 5IDVA 1EUCB 3F73A 4IH1A 3WYCA 2BFCB 3I2GA 2QE6A 2BFMA 1EQAA 2FV8A 1EEHA 3CG4A 3ECSA 4KXXA 3KO8A 4GUAA 3TD6A 4BXOA 1LNZA 2YIJA 5NLLA 3R7DA 4PLPA 2WKPA 2ZSFA 1DKNA 2C77A 4KAJA 5CCXA 3KQNA 3C1TA 3G23A 3JTMA 1HOXA 3UT5A 3GLGA 3AF2A 3Q0IA 3JWEA 2XA1A 2ZJBA 4TZ0A 2QP4A 3KC2A 2FFBA 1XRSB 2P9YA 2ZRNA 1OX4A 3OJXA 4D45A 5BWMA 5EUBA 3WQRA 1ACJA 4Z86A 2BMJA 1FRFS 1KFBB 2W4IA 3R3VA 4IX1A 2JGJA 1IG0A 1RWOA 3IKMB 2QN2A 2DY0A 4N01A 3TKLA 1FUIA 3U1VA 5LWQA 1ZIPA 4FXPA 5FBZA 4G86A 1JMKC 3X1XA 3Q7SA 2WIDA 5AK5A 3E2IA 2AQKA 3AF4A 4H17A 1TUBA 1AZSC 1N5OX 5AUQA 1U2RA 1EYZA 1M54A 4WBSA 1E4VA 3T3IA 5M7EA 4CUJA 1TYBE 3EHEA 2X22A 3AEZA 3G9ZA 2IU0A 2W4QA 1CLEA 1KY2A 4EQZA 3DXZA 1BC5A 3C7DB 3VYRB 5SYAA 4O8ZA 5B30A 1N36B 3Q9LA 2QG6A 4MYTA 1MIOB 4UUPA 5ARCA 4AROA 2EP5A 3IMGA 4HLQB 3F6CA 3FJ1A 4DG5A 2AOWA 3HI6A 4TRJA 1ST3A 2D0IA 3H13A 3OQHA 3G9XA 3P32A 1ECBA 1I3MA 1E6CA 4NV1A 3WTBA 3PP8A 1IHYA 1U0HC 2X1MA 3SLGA 3EXEB 4ZI7A 2ODPA 2A14A 4O4HF 4CM1A 1JEQA 2QW8A 4RZUA 4QHSA 3AVOA 5EG5A 2YJ4A 5H3CA 1ZHFA 3UT0A 1I5OA 4ZCSA 5SZJA 4CF5A 1TZCA 3OZDA 1IBKB 5JTUA 4TV9F 2VDWA 3OCWA 1LJ8A 4HAUA 1UMCB 4EHNA 3U9TA 3O95A 4IFIA 5EP1A 5GPBA 1AKWA 1L7BA 16PKA 1YFLA 3FW1A 5CB8A 4GLLA 5HTOA 3KV1A 5KAMA 4C08A 2PA3A 4HAXA 3S55A 4P0TA 2OP0A 2VUHB 1NXXA 3JR7A 4OUDA 4Q0MA 3KVOA 5KAPA 5HCUA 2WYWA 1G1MA 1UBRS 3BGSA 3RFCA 1XZHA 3MD0A 2RHOA 3JQFA 3LW8A 5EUQB 2WTMA 3FJOA 3ZCQA 5JROA 1JA0A 2DR3A 2IZZA 1RYZA 5BQ3A 1HORA 2CL6X 4FYMA 4AXXA 1JKXA 4HL6A 1J25A 1T36A 4F3RA 2C5GA 1ZK0A 4GOKA 2QVCA 1ZGJA 5EJ6A 3RFTA 1A72A 3EIEA 4WLNA 4HQ6A 7REQA 3UAZA 3DMDA 1QF7A 1NI3A 3QVGA 1E2BA 4BFCA 4FZJA 5KJ1A 2G4LA 3ETGA 4OYRA 2V5AA 2Y66A 3C43A 4XFJA 3ZZNA 1P1HA 3FHTA 1RPJA 3U7IA 1DAHA 3L1HA 4J3JA 2RCNA 2AX3A 4G89A 4QTZA 2AKEA 2V5VA 3PT5A 1I6MA 3LQ1A 4X95A 1Z7EA 1YI1A 1GUYA 4RU1A 1NJ5A 4LYFA 1MX9A 4JJGA 3KTFA 4F86A 2AC4A 1X1TA 3CVXA 1YDMA 3A2KA 1H2BA 1RXUA 3KUUA 1IXRC 5CIQA 3WYFA 2GPWA 1A5TA 2NACA 1Z07A 1G20A 5JLJA 3LI2A 4I5IA 4O4IB 4J1NA 4PYOA 1M7GA 3ASZA 3QBDA 4ZVMA 2X2EA 1U1DA 1GA4A 1ZCAA 3EXG2 3ENVA 4LWOA 5KHLB 3C6KA 3CC8A 4HDRB 4I2VA 2H54A 2E82A 1F8FA 1NT4A 2QTVB 3ESCA 5KMGA 1NVGA 2RJNA 3PFNA 4GPTA 1VSVA 4INJA 3H5WA 4YRLA 4JLOA 2ILTA 4JUAA 4BP8A 3LX6A 5F5XA 5LQKA 4RHFA 3KOOA 5LYJB 2PSSA 4TTQA 3U31A 4OA8A 4AX8A 2YW9A 2X8WA 1RJ9B 1W19A 2BEVA 2DYKA 2H1FA 4TV8F 3ILXA 1O9GA 4D6YA 3ZI0A 5AVZA 2YKGA 1UJCA 3CPEA 4JJ8A 4ZCMA 2GCOA 1ULSA 2BT4A 4TL6A 1KAOA 3L1IA 2JLSA 4JH0A 4ON9A 4OGLA 3S29A 3TFOA 4PNPA 2DFKB 1RXIA 3EZ9A 3HA3A 2EC5A 2O8CB 2FW8A 4AL4A 1J70A 2Z5VA 5HGXA 1A8PA 2F62A 4RQUA 4K2AA 1JNXX 2NPIA 1YIDA 2NXWA 2Z2JA 5FPHA 5LD2B 3CMMA 1CZNA 1GNPA 1XEXA 3HL0A 3OTQA 2CLKB 3AEKB 2ZZNA 4AS2A 4JD5A 3GG9A 3UY4A 2YWFA 4EB6A 1VJ5A 5HK9A 1PKEA 1RJDA 1MQ9A 1X19A 1G3MA 2ZBEA 4HB4A 1KDTA 3KPVA 3PXCX 3U4AA 3B9PA 4BKRA 3ON5A 3UAYA 2X0RA 3JAKB 3W06A 4EUNA 3L0OA 4FDMA 1EXDA 3OFKA 2H4HA 4B3FX 4FMCB 4BLSA 2OXTA 3EOBI 4IXDA 4WFKA 4NFSA 1D2AA 3TZBA 1S1CA 5BN5A 1GNTA 1TT5A 1ADBA 3E9YA 2VNSA 3QOYA 1UAAA 1Z2AA 4QNRA 4XGKA 3F9CA 5BN1A 2Y1LA 2NLOA 5LP6A 2P3OA 1T36B 1AK9A 2BELA 1W0KD 2R3SA 3HBNA 4BPBA 4JI4B 4P4SA 3WYAA 1F9EA 2BHRA 2W0MA 4HUJA 2PE5A 1BFDA 2RHGB 1J42A 3AWDA 1WLYA 5EIHA 1GZ3A 3PNKA 2IP4A 4GBMA 3LZDA 4ARBA 4CTMA 4EVIA 1TU4A 1WDKA 2HIHA 1SVMA 2QT9A 4BFVA 2DBYA 2Q4EA 1G3IA 2V6BA 4IEEA 4BNHA 3C7AA 4LUCA 3ZHTA 1PL0A 3IQEA 3DLTA 4S1WA 4NEGA 2JGNA 4M6WB 3DOJA 2O57A 3G5TA 3I32A 3NCTA 1FVOA 2HSEA 3ENZA 4NSNA 1NXVA 2GBPA 4DMCA 3MWDB 5FAKA 5CM2Z 1E1LA 3DLBA 2ZVPX 2EKZA 2D6FA 4ZHQF 3V8RA 3O8NA 1B3RA 1H6BA 1L5HB 3GLHE 5IM4F 3L1VA 3UOAB 1HFWA 2Q6VA 3VOAA 4B4WA 1KH3A 4PBRA 1U9ZA 2VJKA 1BX3A 4D74A 1LVGA 4AJJA 3VAYA 1QWSA 1JFSA 2BKUA 2HJRA 5DW0A 4IW3B 2VWQA 1Z0JA 2BONA 2K4MA 1RHQA 1G8MA 1KOFA 2AUTA 3G13A 3L46A 2BKEA 2PN1A 5CP8A 3WIVA 5BQXA 1Y9EA 1APBA 2D8MA 4IKPA 5BOSA 1OKKA 2CNOA 4EEZA 5A5EA 2B8TA 5KWSA 1N6PA 2REBA 1QIDA 3CO5A 2YOGA 3CW8X 4JLSA 4JXJA 4RZ3A 3COYA 3GJTA 5G4KB 3F2VA 4DV0B 3A04A 3VPAA 4CV2A 3OZXA 3SSNA 3AZOA 3ZV6A 4DQDA 2ODWA 3CX3A 2LBPA 5JC8A 1XQ1A 2VH2A 3NWOA 5C37A 2HR1A 2IELA 4YAUA 1UBMS 1GP2A 4OJTA 1D07A 5DNAA 3C14C 5IBCA 1MEOA 2ILVA 3S8YA 3FPCA 1CBUA 3F6PA 5EE1A 1Z6TA 2CZQA 4GO1A 4Y1RA 1FJ2A 4M4SA 3SP1A 3EG9B 2QX4A 3PU6A 4WWHA 4MWSA 3OEWA 3UCEA 4PFSA 2H8GA 4CLXA 1YRLA 1P3DA 2PRYA 5A9SA 2LNDA 4M7WA 1GVNB 5PGMA 4QXRA 1TZBA 2ZBFA 4A82A 1IOWA 3TW6A 3DPSA 3QNMA 4WKBA 1Q57A 1Z2OX 1Z12A 2I4OA 1GPYA 2BUCA 3NMUF 3IRVA 3VO2A 1PO7A 1CUWA 4DLXA 1ULAA 5CTJA 4ZVLA 1NLZA 2HMUA 4C3VA 1ISSA 4R1TA 2F1JA 4M36A 1RS0A 1ML4A 1C1XB 2JHAA 4RV9A 1DFHA 1UJ5A 4LX8A 2Q5EA 1ZNXA 3EXHA 5H82A 2G9NA 4B4OA 3NC1C 4MWOA 1HLGA 4N8EA 2H9AA 1HM5A 4ZOLB 1CIJA 3WWZA 4IUDS 3MB8A 2J5KA 5J43A 1K68A 2PMFA 2QUBA 3JQQA 4E1VA 4E4YA 3W78A 5KWJA 2HT1A 2AJCA 2GD0A 3CRNA 3AVPA 5CLHA 3V7WA 2Z56A 3D6FA 2Z5GA 4LMBA 4KO4S 3IJRA 1XMXA 4AJLA 2HBRA 1B42A 3Q0TA 3KKEA 4JP5A 3T3GA 4YAKA 2A9VA 4HYTA 4BNFA 2XAAA 3HRHA 3IT0A 3T5CA 5IT0A 2RGEA 3VZRA 3P0FA 4AXBA 2ISSD 1U1FA 5C32A 4P38A 2XTZA 3OSZA 4TLMB 3G59A 2PJUA 2H07A 5GVRA 4RZIA 1QYDA 4AN1A 3D6HA 1WXGA 4YASA 3H1EA 1FXSA 2AR7A 1YUNA 4QFMA 1O89A 3FHLA 3VPSA 4O4JF 3EX7C 3N0XA 3NRCA 4RDXA 2ZU0C 2POQX 1JQJC 1M6VA 5AHRA 1ONNA 2HX1A 2FFRA 2X0NA 4FN4A 4J7UA 4EY7A 3TNLA 2FDXA 1GAWA 5IYZF 1VGQA 4P4GA 3ZWKA 5IU6A 1P61B 4JXKA 2REXB 3ZBPA 4D3DA 4FBMA 3JSAA 1GPBA 3GFSA 3T9AA 1IC6A 2GD6A 9ATCA 2GD2A 1K7YA 2R2GA 5KDOA 4PV7A 1A9PA 2F48A 3I3OA 4IQ0A 2HAEA 1A98A 3AL3A 4GZLA 9ABPA 1DWUA 3T1VA 1ZEMA 1QH0A 2AD1A 4WT7A 1HDEA 2DBRA 1UP7A 1E3WB 1GCGA 4FYKA 1L1EA 3LCRA 4UBJA 4ZKEA 4JSRA 1MXHA 2X3FA 4YCLA 5C34B 1JQLB 2IBSA 4LYJA 3K0BA 1GCUA 1SBZA 1ZHHA 1QAMA 3BPSA 5A9SB 1F5NA 2GN0A 1TM7E 2HIGA 4MGIR 3A28A 3BCSA 3NJ4A 3VUFA 2ZBPA 5FPSA 1ODIA 2F9LA 1LTKA 2H1CA 4LMPA 4NBSA 4QL3A 4BHTA 1LCIA 4BCBA 2PQ2A 2HQ1A 1IWOA 1LDBA 1YB2A 1UQUA 2R1UA 3DFMA 2P2GA 4TTJA 2FWJA 2OO3A 3SZGA 3T7SA 4BECA 3NKLA 4J3FA 3UV6A 1L7MA 4GOXA 4P3XA 1JLSA 4MYDA 4R9NA 4F4HA 4DCUA 5JSZB 2Q1XA 3MT9A 1LDEA 3GLQA 3LUKA 4QPCA 5K09A 2OILA 4MLPA 4OSOA 3RG2A 4GQBA 2W2OA 2GPYA 3DULA 5DGXA 2GXAA 2PO5A 2CHEA 1A82A 1JV2B 2H18A 2YC2C 4LOJA 1Z45A 3A0UA 4RTPA 1KGDA 4L9AA 1OYVA 1E2GA 4B2LA 2AC7A 1NBAA 3SX4A 2VDNB 2IPNA 4GAEA 5EVCA 3PGMA 3ZIDA 1CD5A 1KRWA 1M3SA 4ZJYA 1LK5A 2VBFA 5JY1A 4QYMA 5J3JA 4MLCA 4CHGA 5E8JA 1VSBA 5E7QA 5FBVB 4YIHA 5JFOA 4UEJA 5DTJA 3ETHA 3WMWA 3OH8A 2A1TS 2ZIXB 4P0PB 2Z9DA 1Q0UA 1KP3A 3VQTA 2PUAA 3OX1A 3ZWVA 2MINA 2H1RA 4KYIB 2QRMA 5EKXA 5AKHA 2DH5A 1R18A 1XTJA 1MAAA 2NU8B 5TMEA 4ZGGA 2A9QA 1S3GA 4GMXA 4AICA 2Y77A 3AU9A 2IIQA 4R9SA 1NVEA 1PNVA 3OQJA 2FGKA 5H9VA 2WC1A 4BX3A 1ZI9A 5EC8A 1YFJA 2OD9A 1X7ZA 4PYJA 5CB4A 4QELA 2YH2A 4GT1A 4NAVA 3IBGA 2Y9MB 4Q3EA 3SM3A 2C1XA 4RK5A 1SY7A 3RAGA 1GQFA 3TOXA 1DCTA 2VK4A 3JASB 3IT2A 3RIEA 4EYKA 4NOKA 4XSVA 5BY2A 4HXYA 4RK7A 1LVUA 1FY2A 1M66A 4UAGA 4ZVTA 4B09A 2FG7C 2C83A 2DB3A 2X1HA 3KYJB 1RKUA 4YAIA 4RF3A 3MWFA 3NHBA 4O08A 1B0UA 5CRIA 3RUIA 5M29A 1JVNA 4ZZ3A 4WVFA 1F4VA 3OTIA 4CIXA 4KE9A 3AJRA 1DHRA 2WM2A 4IF4A 2YWRA 1LS1A 1U4SA 3ZY6A 4R3NA 3I9KA 5EGSA 1B93A 3EZYA 3ASVA 4CKBA 3OAAA 1K88A 4HVTA 2HGZA 5BW6B 3WNBA 3EA0A 4QTUB 1FSSA 2ODAA 5UKDA 1LFAA 1Q83A 2PS9A 3U62A 4EARA 2H4XA 4NBUA 4ZAXA 4D80A 3FAZA 2O8BB 2X0KA 4EEXA 3REQB 4LTMA 4HFMA 2EJWA 1DG3A 4WEQA 4B17A 5BR1A 1I0IA 3E4DA 3BDVA 4MWCA 2AXPA 1GPAA 1I1QB 2J7KA 4YT5A 5K0LA 4C4RA 4YCDA 1BXZA 1NBMA 2AUMA 3EPKA 2BHLA 2IZ7A 2HU7A 4Y98A 5DXJA 4LRYA 4MAMA 1DJPA 5C8YB 3N05A 2AFVA 4DDMA 1OZFA 3EH1A 3DW3X 5H81A 2XZOA 5U4QA 3U5ZB 3RUHA 1LSJA 3JYQA 1RC0A 4YHBA 6ABPA 2KHZA 4X45A 5CNMA 5FPQA 2P6UA 1LX6A 5EJGA 3H65A 1DAPA 4ZCLA 4UM9B 3ZDBA 1VCHA 1JH8A 2XOEA 4IG9A 3VMFA 4EJ0A 3ILVA 4DNPA 4LQLA 1XZCA 5FULA 5TS2A 1B8VA 3W4KA 1B6RA 1RXEA 4AECA 4S0XA 3GX1A 4NZOA 4L6CA 1FMFA 5IJ0B 1LXCA 2Y1WA 3WAGA 4QOIA 1UINA 2WABA 1JYEA 2QTNA 2IHKA 3I2JA 3UJ6A 4NDAA 1T9DA 2YQ5A 4JQZA 3GZTB 2VQ6A 4KIWA 1S1MA 3UGTA 4TT3D 4ARZB 3BK1A 1JWLA 1FUKA 3HU2A 1WSBA 1HZZA 2V4MA 2ZB7A 1KOJA 1IXZA 1GSOA 1H6AA 1LTQA 2GPNA 4LDPA 5BN4B 4BS9A 5IDQA 5KYKA 2LKCA 4A0HA 5EZQA 1PWHA 1JG3A 3STVA 1ECJA 2BJWA 1FJGB 1DT3A 2QP9X 4MZDA 1U8YA 5JYBA 3VJRA 1C4OA 3EFHA 2M6RA 2PX0A 3KAQA 2X8JB 1SC3A 1VMAA 1DO8A 3KYCA 4ROTA 1SO8A 5M34A 4LGVA 5EE5B 2OYCA 3L84A 1ZH4A 4JBNA 5AJYA 2Q1WA 4G25A 3ZZUA 3G1TA 3JWPA 3QVUA 3B1JA 4LXIA 5BXQC 3I2KA 3I53A 1OFIA 3KBOA 3HLKA 4Z9XA 1QK3A 1KO4A 3PTZA 4E46A 4PC7A 3A10A 1TCUA 1HSOA 5K1ZA 1CUVA 2GR9A 2OBBA 3WNZA 3MPOA 2D2IA 4FFNA 2IHBA 1DTSA 2RK3A 4Q01A 1OV6A 4RWZA 3VR1A 2HA4A 3VKWA 4QFDA 3MS7A 3P2OA 4HDAA 1A9YA 5DTIA 4AO7A 1TYCA 4CM7A 3NYQA 4CKBB 1RYEA 1XQ6A 4U9HS 2VP2A 3DZDA 5CXSA 2VXYA 1QIFA 4EABA 3VR3A 1NW6A 3LY7A 3EPHA 4UNIA 4FE4A 4NJEA 1OLUA 5DKFA 1R3DA 1J8MF 3WRXC 2EGUA 3L77A 4U6QA 3IP9A 1EXNA 1Z26A 2PRKA 2VYVA 1P7PA 1U6IA 3W3AD 5DM70 2HV8A 4NL4H 2O5RA 1CYDA 4YP9A 3EY4A 4PBTA 4EX6A 3WZ2A 4RVCA 5ALMA 3U81A 4KITB 4KQFA 1QGYA 3F46A 3H7IA 3DHWC 1H9BA 1AV7A 3AJ8A 3LRXA 3LT0A 1T3SA 2C9ZA 1WTAA 4GYYA 1CYEA 3FMOB 1CUIA 1WHSA 1P29A 2H3HA 2NZWA 5D5HA 2A1IA 2OV6A 4L5AA 1E2UA 4DBZA 3DWEX 4DM7A 1S3FA 1QV7A 3LKDA 3BA6A 1SOUA 1YRBA 2HPHA 1EK1A 3IE2A 1FP7A 1NFQA 3N7TA 4J0CA 1Y5MA 4NBRA 1ESNA 5DE3A 4OI4A 4UPDA 5FNZA 3OEHD 3TFWA 4YUZA 2PJZA 3C5WP 3LL7A 3A9TA 4Q5IA 1ZIDA 1NOIA 4GOJA 5HIKA 4I3HA 1M6EX 5JNTA 1NSYA 2ACWA 4OK6A 1D2GA 3TSOA 4W63A 4G0OA 4KLZA 4H1WA 1YBVA 4X20B 4GKAA 4OHKA 1PUXA 1P1BA 1KWKA 4FX5A 3J7AC 3F5DA 4ZQHA 3AERA 3FMFA 4BU1A 3UO8B 2FHPA 4MWGA 5IANA 5EPEA 1K4KA 1QQBA 3KYDB 6CHYA 5BR7A 3ONEA 4ZN6A 3IIIA 2IY7A 5FO0A 3TQIA 3D4PA 2VQFB 2G4VA 1QO7A 2PD6A 1NV9A 1PJ3A 2L17A 2ONYA 1N7GA 1PEKE 3PRKE 3PUKA 2O8EB 4XD7A 1U1GA 2Z8XA 2JLBA 4TN1A 1KK0A 4Y9RA 3W7BA 1LJUA 3LH5A 1Q20A 2FWRA 3CLKA 1U0OC 2YS7A 3WIEA 1Y7IA 3BMOA 4NNJA 2HLDD 4HLUA 1S8OA 3ZGVA 2WPNA 2FUEA 3O21A 1JTVA 3ZUGA 2H1SA 3IEMA 1NR1A 3IJ5A 4W5NA 3SHVA 1T4DA 2DHQA 2D5CA 1Q1QA 3BJMA 3WDKA 3ZNNA 3B12A 1NUAA 1PTJC 3KE8A 4QREA 3K9BA 3TXYA 1ZCJA 3KB6A 4IOMA 4WD3A 5DN9A 5KX5F 3N2KB 2F1IA 1QHHA 4XD2A 4ZYXA 3CKKA 1VJ1A 1FX0B 4V38A 3WOVA 1MV5A 4JASB 1X7XA 3BMXA 1P5ZB 4DV5B 1MQAA 2ZKIA 3ODPA 1SD2A 4WESB 1NJ6A 1V6AA 4C0XA 2G80A 1JDTA 1FUEA 5KO2A 4KZKA 3ZY2A 4XFDA 3N2NA 5IC4A 4P4TA 4AKSA 3FTEA 2WD9A 2R1VA 4ZHSA 3N76A 4YRZA 3Q5GA 4V03A 1UBHS 1BZYA 2VDRB 4G9BA 1Q7RA 1VB3A 4Q9AA 4TLLB 4J0IA 4UVHA 3HABA 1L5GB 5E6RA 2VIIA 1N2EA 1YZVA 3SG0A 4LZWA 3FLEA 5HXAA 3I73A 5CDGA 5TE9A 1K86A 4NZMA 2HUNA 2Y0PA 1BWQA 2R6GA 1X0VA 2ZDHA 5GVSA 5I7OA 4RESA 3QV2A 1NMYA 1CFZA 2RJOA 2MHCA 3BZWA 4ZODA 2A78A 4H6PA 4KU4A 4UCWA 4MJXA 4RIGA 1T29A 2A9PA 1KR5A 2F90A 2GEKA 3HCPA 4UHCA 1PW5A 4JX9A 3H2SA 1I3NA 5SYNA 1HE4A 4BFTA 2QMEA 5I7FA 3RSLA 3FNFA 1ACMA 4PZ0A 3GDFA 3VA7A 3ANTA 1ZM7A 4ZO9A 2BDUA 5TT1A 3D6JA 4I50A 3IUEA 5IUNC 1Z82A 2C0CA 2MYUA 3FDZA 4NJOA 1R4MA 3QY9A 4BUZA 3JZDA 1TECE 1V1JA 2Q9AA 1P75A 1WP4A 4GX2A 4HNAB 1ZR2A 4O2RA 1ETUA 2EG5A 3HCBA 3WA6A 2AS0A 2VTBB 4B3TB 1HZZC 1OZAA 3OIGA 1N2ZA 3ADPA 2VHWA 2VDKB 3AERB 3VDXA 3WAKA 1BQ3A 1KDPA 2NAPA 2K7ZA 4EJSA 4DQVA 3QBTA 5I01A 2QD1A 1UKYA 5CGZA 3J81A 4JUCA 4OQZA 4JLKA 3EBPA 1TTHA 4MQ5A 4QEKA 1LNQA 1V95A 1W5SA 3BH7A 5HTKA 4ALKA 1P9OA 2FW0A 1H0SA 1NW7A 3QXJA 1K3FA 1VIMA 3HB5X 5TF0A 1KIFA 1OB2A 3QU4A 4PINA 3KIPA 3PC8C 3ZQ4A 2WE8A 1RWPA 4KPUB 1DT5A 1N0IA 3KELA 4QXPA 3HYSA 3N1UA 4DRYA 2A88A 3L41A 4WKGA 3LKBA 4ZJZA 3RROA 4BJHB 5DM2A 2FFHA 4OHRA 1RI5A 2PWPA 4MRAA 1WV0A 1URPA 4KWTA 4QJ5A 3RUFA 1SB9A 4Q9NA 1KQPA 1QHHB 1Z0UA 3M6WA 3NIFB 4JQSA 3VKVA 3MSCA 3VZQA 1I2CA 1AO3A 3AFIA 4JP2A 1X7XB 4RHXA 4KR7A 1MVNA 2HZBA 2D74A 2JJ8A 3PGXA 3CUVA 5DWDA 2A4KA 2W93A 1OTXA 3DKIA 3T4XA 5EXTA 3UFBA 3HCEA 4BDTA 3PR2B 3PQ5A 1YZUA 1U3WA 3I9V6 4GMFA 3RFUA 3TS1A 1MEEA 3B5IA 3C3AA 1MAWA 2R1VB 3EFOB 1VCNA 5DXAA 5IMSA 1XZQA 2OOKA 1SHJA 4IDDA 3EVDA 5DTRA 4R2KA 1HQKA 1J0AA 2WUGA 2C03A 2XUJA 1SRRA 3O3OB 2X0JA 2OT3B 3QVLA 4FYHA 1E1RD 5DNDA 4HWRA 4ZYWA 3LQKA 3OPXA 4NY1A 3JQEA 2V9CA 2IEYA 5HF6A 3JQAD 1CQWA 1PSZA 2QTTA 2OM2A 3KZOA 4PYMA 3ZBUA 2OC4A 2RBGA 2W2QA 4ARAA 3WQBA 3O75A 3GLHA 1DAOA 3O9MA 1RLUA 4ENWA 3VZBA 2VKTA 5MFZA 2VUIB 2V7WA 3R9IA 3AHHA 1NXSA 2C2YA 2QN8A 1QFYA 3WHKA 3HE3A 3FFAA 4JC8A 1WA5A 1G4HA 2WSLA 4J1SA 4JZKA 4PRKA 3FDZB 3K53A 3CGGA 5D7NA 1RRPA 4Q7KA 2WJWA 4J4TA 3CZAA 4DMGA 3LT5A 1M7BA 3PFBA 3QNUA 4HRYA 4F4IA 3V4PB 4HQRA 5L4SA 4RSMA 3V1UA 1JT2A 2ENWA 4BO1A 1J21A 3T06B 2PV7A 1QDEA 4CI0B 2PZ8A 1WZUA 4QUEA 4UHKA 1RC8A 2WB4A 3HKCA 1E62A 1E1MA 3WIDA 4LXXA 3PVCA 3SQLA 3EVFA 1QJCA 1T6NA 2ZGVA 1M73E 1SCKA 4KQ9A 1DIOB 2R1ZA 5CLQA 3TM4A 2QN6A 4N0EA 3WDSA 5E2IA 4DEVA 3MD9A 1ZGBA 4OM8A 1AMNA 2DFLA 2QX8A 3LHKA 1DC6A 1ULUA 4IP0A 4IXWA 1UZAA 3N8GA 4M1WA 5HFAA 7AT1A 1SVWA 2IIBA 1VL0A 2VHEA 1DPGA 3OUUA 4RS4A 4YUVA 1K0FA 2IYAA 4DR3B 1VL1A 1N75A 1SCNE 2GM5A 2JLCA 2NQ8A 4QFBA 4ZEXA 3W5IA 4MGYR 1CJBA 1QQTA 4F38A 2GJ8A 1MTZA 2XVMA 3D81A 5DI3B 4EUFA 4F3YA 3OEEA 3AW8A 2C9CA 4MMXB 4PRYA 3K0SA 4JLDA 2UZ1A 4E30A 2CVFA 3N86A 5H0IA 1L4UA 5CHYA 4NBNA 2XVZA 1JIJA 1TW2A 3HPQA 4KCGA 3E7FA 4L15A 4YDQA 5KTPA 1YCGA 2GVNA 3GCGA 5IDYA 4CR8A 3LCVB 3TBKA 3EBOA 4GMDA 2ZE6A 2O9JA 3PNLA 3VTAA 3IDSA 4CQJA 3EC1A 5IZCC 2OHFA 5EIAA 2DAPA 1AUPA 1N1MA 4KIGA 3T3OA 1GZ7A 2GM4A 2RGNA 2W58A 2Z2YA 5KYUA 3N74A 2H5LA 1LDYA 2IS6A 3GRAA 4GKBA 3O1HB 2ZRJA 2OFXA 2YUIA 2FEMA 2NZJA 3LNCA 3LTEA 4TQ9A 5EUMA 3QMMA 5EWMB 1USKA 3VZDA 1UXIA 4YT2A 3DPIA 4DWJA 1V7PC 1M0WA 1E4EB 3HPRA 4J4HA 4NMLA 5EWJA 5FADA 4S1NA 3ZGLA 4TS4A 1D03A 1W44A 4KDRA 2NM0A 1E66A 1I0LA 1KYYA 1YFZA 3IVXA 4MB0A 4QVIA 4IGIA 4ACBA 5LDHA 3X2FA 1NYRA 1C8LA 2E85A 2FX2A 4QTXA 5K8IA 5FUVA 3GLHB 3T7RA 2YJGA 3RK0A 1OTHA 4BP9A 4YMVA 3ZZ0A 3M1LA 4Q9JA 4HGNA 3TSCA 1U0JA 2V97A 1PFUA 4C0BA 3DZGA 1XQ9A 1BMFD 1Y9ZA 2GWRA 4WA7A 4BZQA 4FZRA 3JZIA 2WPDA 1R4NB 3NVKI 1UP6A 2FW1A 3OLZA 4ZO4A 2WU1A 1ID1A 3HDYA 4HX9A 1D2CA 3IAEA 3H3JA 4HYQA 1NQVA 1FMJA 1M2JA 4I0WB 4KGXA 5JNVA 3WBKA 1YZ3A 3MPUA 1WPGA 3AVQA 1WWKA 1V47A 3CNEA 3R75A 4ZVSA 3SM9A 4DPMA 3QWIA 5FL3A 3ZEAA 2GUGA 4V0SA 3JD1A 1IU9A 4EJSC 3M3DA 2I3ZA 5BRJA 1D7AA 4P6VF 4M86A 1MP0A 1UZNA 3WB2A 5LPNA 1U3FA 2ZRQA 4RZHA 4ODIA 2Q9UA 4CGYA 4MA0A 5I4BA 2KW5A 1PT8A 1G64A 1LV8A 1R5NA 5IJZA 4E3ZA 2HC9A 1QGED 2PTHA 5TDHA 1YD7A 2YV5A 3UTDA 4YRCA 1PLLA 3BH0A 1VG8A 3IIMA 3WTCA 1E64A 4TYPA 3WWEA 2X4LA 3SSMA 3MZ0A 1U11A 1Y3AA 1W581 3NTVA 3OTWA 5CEJA 1JR3A 2FF7A 5CPBA 5CUQA 5I7EA 2OLEA 5M2QA 2VXBA 3QW2A 4QQRA 3C3WA 1PJ2A 5YASA 5ALRA 1Z0AA 4FSHA 4KK3A 4ZT6A 1ZVVA 4GPD1 1AQNA 2PKQP 4GVXA 4ZZIA 4R8KA 3WWDA 1BVYF 2CT8A 4RZXA 4YONB 4LOLA 2QTHA 4LY9A 4IDPA 1I7QB 3LBNA 3ZKAA 2ZUFA 3IOCA 2H85A 1TPYA 3UCFA 2OAEA 1Q3HA 3JAMA 5B3LA 1R0WA 1V35A 1XRNA 4JYBA 4QATA 5AHXA 2YWGA 5LUBA 2VDMB 4RK6A 1DE0A 3V32A 1FLAA 2XTAA 4IILA 1Y3BE 3WRVA 3JRNA 1L4MA 1UMBB 4QNMA 4XQ0A 2YNMD 1DJNA 3IEVA 3HM2A 4FDUA 3HGMA 5JJCA 2R8RA 5KYWB 1JVBA 2R8YA 2RGAA 7GPBA 2FZ4A 3BMQA 4ZIRB 4ERNA 2HIAA 4RANA 4XIGS 2GYYA 2D06A 5DEIA 3RBVA 3LJKA 3TXXA 3HP7A 3CH6A 2C54A 5FRDA 3U4DA 1WETA 3EAFA 2BR4A 1DUIA 1V1RA 1RWXA 2Y93A 4PWZA 1B2RA 4R3WA 4H35A 2NUTA 1ENPA 1CXZA 4BWVA 1UEIA 4K81B 3MYYA 4MRVA 1PL7A 4U5XA 4CKXA 3P0EA 1QM5A 1ZIXA 1H5QA 5JPIA 4X71A 4NF2A 5DYTA 1EAYA 4R5HA 5ECGC 4A6XA 2WWYA 1E63A 4I08A 1DDOA 4DG9A 1ZRSA 1W59A 2WIBA 4I1YA 3ESBA 3H75A 4HB0A 2R6CA 4HNVA 1Q3KA 4EPVA 5FOQA 4G1EB 2VOEA 4OQ4A 5EXEA 4FYVA 4XX1A 3GUUA 1PBTA 5ALHA 2IITA 1T9GS 3UKJA 4Y2YA 2CFIA 3M5PA 4IL5A 3ZIAA 5JMOA 3EW9A 5DB4A 2B4RO 1DC4A 2GCEA 5ICFA 3TVYA 1OCEA 1DBIA 2PRIA 3AZQA 3IAM1 1CNMA 1RCTE 2QSYA 3LUJA 4KE8A 4LZOA 3FYUC 4ZOQI 4BV2A 1HETA 2Y8EA 4F85A 4FFWA 3A4TA 3A9WA 2V7BA 4WNAA 3R9XB 1ISHA 1KEPA 1F38A 5K3DA 5J4LA 3OPVA 1DIRA 1N6LA 2A5DA 5FWXB 2F3TA 3NBQA 4DPKA 2BZGA 4JUDX 1U7TA 3DMPA 4E11A 5HM6A 1JXQA 3I3SR 4G5QA 1OREA 5J2TB 4RE5A 4DMRA 2W71A 4KTTE 1B8PA 2PD4A 2NVUB 1H2XA 5J58A 4Y6QA 5TPZA 1TK3A 4AMYA 3HKDA 2LCIA 3MXOA 4Q47A 2Q21A 1O0BA 4KMSA 5ALXA 5DSXA 4UEQA 4OXQA 5BSTA 3L8DA 1YGPA 3OU6A 3WK9A 2DBZA 4A15A 4NU0A 3LLMA 4OY3A 5H83A 1LEHA 2JGLA 2YRFA 3ILSA 1M0TA 2VLBA 3GC6A 3DG9A 3NTLA 4G0QA 4HAYA 3IESA 5JYEA 2RE8A 2MSEB 4OLBA 4Z0PA 2GDJA 1M8FA 4QXOA 3UHJA 2OHIA 2XRMA 4ICIA 2RGNC 1QTIA 1VI5A 2EGHA 2IYYA 3CU5A 4QFCA 4RDHA 3RNLA 3X2SA 4Q34A 4F4UA 1OLSA 1IXYA 5GJBA 2OV4A 3K94A 3N3BC 4FCWA 4CMGA 5KTKA 4UU1A 3PHGA 5AKJA 5IXYA 2A67A 1ZBQA 2G5PA 3I62A 4WECA 3LSTA 5BSKA 3UOGA 2WVJA 4M3NA 3H4TA 1J7JA 2G7ZA 1IXSB 3BMQB 3OMXA 4HS4A 2MYNA 1D1PA 2P1ZA 3JPWA 3V9PA 2P2LA 5BR8B 5BT8A 1P74A 1NVAA 2TECE 4XW2A 4FHDA 2D3TA 2JW5A 3GWZA 4FHZA 3T7IA 1RQ7A 3ACDA 3PQCA 1ZUWA 3KJEA 2J0QA 4BIIA 2JFHA 1VL5A 3LT1A 4BAZA 3VZCA 1UDWA 3QE4A 4HN4B 3DDNA 5AW9A 2O2HA 3BE5A 3GHHA 5BO5A 4DQKA 3C5EA 3RREA 1ZZEA 4MW7A 1TPZA 1VBFA 1I4LD 1T2EA 3ANYB 1IY9A 4WVLA 4LXYA 3U1BA 4A8JA 3LBFA 3PA8A 1UPBA 4ADSG 2EBFX 1NZJA 5K6AC 4LSGA 1EHIA 3TLBA 2VUTA 3TRKA 1G8AA 3LPMA 5KU1A 2O6HA 4WN9A 5FUMA 1X2BA 2QQFA 2HA3A 1S96A 4EY8A 3NGLA 2IS2A 4ZCPA 1RHMA 1Y8AA 2XMRA 3GFFA 2H1LA 3QX8A 3P2JA 3SGLA 2YFYA 3RBZA 1IN1A 2HWYA 3DMYA 3E1KA 4HGYA 3TTTA 4LBYA 4ZKDA 1WABA 2ZB3A 4WNAB 1DXHA 1QR2A 4D5EA 4ZCTA 1IAQA 4IZIA 4E13A 1GPJA 2JEZA 1IEXA 1CULC 4EF5A 1YRYE 1XTZA 3JRWA 3JATA 3M9LA 1R6TA 1RE1A 5FBRB 4Y0AA 2I71A 1BXGA 1KMHA 1XJCA 1N2OA 1RD4A 3OZEA 2DPGA 1L7NA 2L42A 5CB4F 3UAVA 5LXTB 1V8PA 2J7PD 5K8UA 1PE0A 2YFHA 3WWOA 2D00A 3QVTA 4BRZA 2BGRA 4WCVA 1IBCA 5DNYB 4OTZA 2XUOA 1SCUB 2F3SA 2GBIA 3F4KA 3FNGA 1QRAA 3HJBA 3PQ3A 4JGGA 4P2BA 4Q1VA 4EKDA 4ENQA 3QUCA 4DQUA 4MH0R 3G17A 3FNEA 3L1UA 4N6OA 3PC3A 3PVZA 5FBLB 3KALA 3M1IA 3ZHQA 2ZJ7A 4TQUS 4YP7A 5IAOA 1C9NA 1ZI6A 4OX9B 5ALSA 4KN9S 1H3FA 1XK7A 1H4TA 1QHNA 4KXYA 4GRAA 2VTKA 3QLUC 1I33A 1GPUA 4YCJA 2FWPA 4XE5A 4FB4A 3ASUA 4INOA 4IOKA 1W9MA 3OESA 3IDZA 2OCIA 2GCIA 1H94A 4XEUA 2ZYWX 3M5WA 4L7QA 4PVCA 1TA4A 2ZIUB 4DLZA 3HP4A 3THYA 5JH7B 4F1JA 3HCAA 4JI6B 4FMBB 4GSKA 2DFVA 2SHKA 3RVOA 2NADA 3HL4A 4PZ9A 3VNRA 4B9EA 4KG7A 1FNCA 2J3QA 3NT2A 5BR4A 3VMMA 4EHIA 4BU0A 4AUNA 1D3AA 3CURA 4HEA1 2FSPA 3FG9A 4IWYA 4JR2A 5COAA 3A1WA 5FOUA 2CZCA 1QQ6A 1G5HA 3USCS 2H2WA 4O1HA 5JHGB 4NMMA 4Q15A 1GQYA 2EWWA 2L18A 2W6MA 3EPRA 1AQ6A 1EP3B 3NEYA 3BREA 4DIBA 3NXKA 1UZMA 1E9CA 3TOVA 4OQXA 4BO2A 1D8AA 3ZE9A 3AIOA 3AUFA 5FCDA 4D92A 2WFLA 1MCZA 5DGDA 3U0VA 4PTLA 4BQNA 2FUG1 5CK4A 2GYVA 1DKQA 2QX6A 1ZK2A 2OG1A 2UKDA 3B1KA 4KK4A 3Q2KA 4BPRA 2E2WA 2FRXA 3DM9B 4RDIA 1P1CA 5CVEA 4BC0A 1E60A 1QCDA 3SD7A 1VJ0A 3DE1X 2XZLA 3GN1A 2KX7A 1P2SA 1QIJA 3AETB 1YZLA 3QXXA 1FTQA 1ORVA 1VCIA 4XYBA 5KQSA 1L4GA 2CXOA 2OOSA 5K6AA 1AKMA 4ZXFA 5IARA 2O59A 2UV8A 2ZJ2A 1WW8A 3E4CA 2CJPA 1PVVA 1RBZA 2Q2VA 4YRAA 5AM2A 1OGYA 2OKCA 3HJCA 2YV3A 2FY8A 2I55A 3EUAA 2JJ2A 2WV9A 1AURA 3O1IC 4CR6A 3NKVA 1Z6PA 1X2EA 2ZAOA 3I37X 1M2FA 2JCSA 3P9NA 4HX2A 1VPEA 2ZQZA 4TOIA 1K6MA 2WICA 4R51A 5B2ZA 3CN9A 2Q45A 1U0BB 3UATA 1P1JA 4G56A 4A16A 1PVOA 3HDGA 3F3YA 2BD0A 5HF5A 5K9ZA 1DJQA 4Q02A 2QU7A 3GUCA 5DVZA 3BBPA 2BV3A 1OXUA 2RONA 4WAUA 3NVDA 3R3XA 3GGSA 4G1FA 4Y67A 3OZAA 1B7GO 2BFDA 1X1CA 1Y1TA 2QYSA 3SYTA 1KZ7B 1R6DA 5K0FA 2OY0A 3HR4A 1L4LA 1XCJA 4CU2A 4JLVA 1W96A 5FI3A 4RTMA 4YA6A 3UH1A 2ATVA 4ALJA 5LFAA 2BYTA 3BT7A 4MQBA 4YRJA 4EMSA 2I76A 2AUNA 3JQGB 3A1CA 5E1OA 4PN7A 1H4SA 1SUIA 2CCGA 4ASUD 2QZ4A 1YB7A 2ADFA 4CG2A 4DABA 4DYDA 1EBFA 4L51A 1U2QA 3M6XA 2D2EA 4EB3A 2G9VA 2FZLA 1KNQA 3ANMA 1GR0A 1QB8A 1H3EA 2Z58A 4RPHA 4B79A 3GROA 4G41A 1ZLYA 1RMTA 1M34A 1GLNA 3JYHA 2Q3FA 1O95D 3AYZB 3TLCA 5KZMB 1SBHA 3TZ6A 4UTPA 1RZRD 4HDKB 2GCGA 4NBWA 5HFNA 3AHDA 3BE4A 3E9ZA 1JVSA 3QLVA 3QQ5A 1SRQA 2QMYA 5DV9A 5CXQA 4EQ6A 5AVJA 4PLYA 1C9JA 1I2AA 1PZMA 3OX3A 3RK1A 3WGLA 1Z29A 1L6IA 4AMGA 4ARVA 4AKGA 4D42A 1TYZA 2E18A 1YTLA 5TQ2A 4GI2A 5ER9A 1RMYA 2LRHA 3DAFA 3WGQA 3X1JA 2H0AA 2Q2QA 2X76A 2GN8A 4UPEA 3C24A 4MV5A 1DEKA 2IYLD 1JAIA 1O5IA 1RMQA 3H1BA 1ZH8A 3UG7A 4HP8A 1E4YA 1Q92A 1YR1A 3I34X 2VUUA 3RIGA 4B4UA 4D6PA 1TZ2A 4Q05A 2ZBQA 4MGHA 2NO1A 3SJUA 3NEPX 4AIIA 3ZW9A 1IN5A 4OHZA 4EY4A 3W2HA 2WTUA 4FGUA 3NLLA 2IKQA 3GNQA 4IQ8A 1ITZA 3ETCA 4YAWA 3FUTA 3NIDB 1QKJA 4Q4HA 1NUTA 3AIKA 1GU1A 3AUAA 4UNRA 3ETNA 4D9HA 2DG2A 2CBGA 2HLHA 2DE0X 1JDUA 1IHOA 4IV8A 4KR0A 4NE9A 2WNIA 3HLTA 1YS2X 2XX3A 4X7PA 3E9RA 1CY8A 2V9PA 1CQJA 2AL7A 1TJ3A 4HCJA 4QG3A 4QQNA 1I6KA 5LSAA 4WCFA 2AG0A 3B6JA 3D1JA 3MGAA 3SZUA 1MOQA 1S02A 4QYWA 4R2HA 4WGGA 3T54A 4AY3A 4J9UE 1SKMA 3GRYA 4L0QA 2VJQA 1EFLA 1HEYA 2IXAA 1W76A 2FWIA 3KLPX 5H02A 3AL0C 4N7MA 4F92B 1JQDA 4XJTA 3PHBE 3VPHA 4N0MA 3QUAA 3OZRA 5DSTA 3EIHA 5K0EA 2YYZA 1AT1A 1S2GA 1SVKA 3ML1A 1VKOA 1FNBA 1P4JA 2B92A 4DUPA 3ZQJA 1KJZA 3OIVA 1KMMA 2QXTA 2NO7A 1PR0A 3WZLA 4ENRA 3H11A 4BVEA 4LEIA 1WF6A 3H5LA 5ILQA 4DCSA 1Y6RA 4CMIA 3UGKA 4BQFA 3JAWB 4IM7A 5A2QA 1KO8A 4ZGWA 1XCLA 1K5GA 3LUCA 3SWWA 4UQOA 1ZQ1A 4HNRA 2P3QA 3JQ9C 1PQPA 3L6BA 4TTSA 2QT0A 3HVKA 5CW2A 4DMMA 4F91B 1ZJJA 3KEGA 5BPFA 2OHGA 3NDPA 2H2FA 1N0WA 1O2DA 2TRSB 2ZEJA 4E5YA 3KXPA 3T38A 1JYFA 4RQBA 1YZTA 1M2NA 2AZXA 4FX2A 4TTPA 5AK0A 3EQ8A 2Q0SA 4E12A 5IF9A 5JAZA 1GJRA 1OUMA 2FFJA 1FVXA 2VYCA 3IA7A 3NWPA 1NJ2A 1XXHA 5FT9A 3UQZA 1VFNA 1OH6A 2EJTA 4IIBA 1N9KA 1UOOA 4H4CA 2BGIA 4BJ5A 4EJ6A 1M76A 1ZK1A 4XB1A 5FJIA 1NL3A 4YXWA 2ZUSA 1Z22A 4MICA 2EF0A 3CT4A 3G2LA 1E98A 4XLTA 3G68A 2W8BA 4CMEC 1XQWA 3VH4A 3GLIE 2Z1DA 3BRQA 2PR2A 4YWHA 4WBNB 2PANA 4RXTA 1L5YA 3FTDA 4HPXB 4G8JA 2YWCA 3CUKA 4HH3C 3L0BA 1L8LA 3F71A 3OVMA 1V8BA 2G63A 4I50F 2GPBA 2JJYA 1KJQA 3AU8A 3D8BA 3HC7A 3OQ1A 5JEDA 2XDAA 5CMLA 4LIPD 2G72A 4TLCA 4MJ7A 3WHPA 1BDHA 5JMPA 3L7BA 4CT4B 3ZZMA 1E0AA 5J4YA 3O94A 4RMGA 4CQMA 1AIPA 4Q4HB 3FCOA 3A32A 4CEHB 5LQNA 4Z3DA 2JBAB 4MQFB 4RGBA 2O20A 3TOCA 4U0JA 2NV0A 2PWAA 1GFZA 5HMLA 3IAHA 2YNMC 1XCBA 4MW0A 4QDZA 5AVXA 1E5XA 2AOXA 2P6MA 4RMIA 2QOEA 4FGWA 1OXMA 2VEOA 2R7KA 4HNTA 5K0ZA 1MRNA 3C1AA 2C9DA 2RKWA 3B85A 3DE4X 2IH4A 3K5WA 4K86A 1G38A 2BEKA 4FIDA 1XLTA 2VAWA 1G5IA 2AH5A 4TXHA 2WAXA 5CJJA 3N6XA 3P52A 2W2XA 4MB6A 3IE0A 1YFKA 2J08A 2ZJ3A 4H2DA 2ZANA 5GONA 3ZIUA 1COZA 1UJ6A 3QKIA 1YNOA 3AB7A 1WR8A 1M1UA 1NOJA 5LQUA 4O5OA 4UKDA 1YBMA 5D5PA 3CCBA 3IV7A 3F6RA 5HOEA 3FGZA 4RFSA 2P11A 4L9SA 5EJ4A 4NEQA 2JFGA 4J0FA 2ZE5A 1JA1A 3DTVA 3GGDA 2VQ3A 1VSQA 4G4SO 3UH0A 2C8KA 3ER8A 1Y4DE 4UM9D 3WGYA 3N58A 3O4JA 4ZARA 2H17A 2WSSA 2RFLA 1XPJA 2PSHA 1DX9A 2GRJA 3HUDA 3AY7A 4AZ0A 2ODQA 2BDTA 3EMVA 1YBAA 3VKGA 3HJHA 2FMIA 1MZPA 3GAFA 1S8NA 1PWXA 1WAMA 1SU7A 5HYVA 3VC7A 2WJIA 4PLWA 2RK4A 1UK9A 4YP0A 2OFFA 4RL4A 3SYRA 2RI1A 3WWYA 1B00A 4LS3A 4RMNA 5H59A 2ZJYA 4XUDA 3T9FA 1CJVC 3FB4A 4PZZA 3BH6A 4GGMX 3R7WA 1UJ2A 5ELMA 3U7FB 1Y7TA 2R9VA 3H1PA 4KFCA 2F67A 3H8WA 3OPYB 4ALIA 2DUNA 1JR4A 3RIYA 2GESA 3IBSA 1JA9A 4RMJA 2AYZA 1V7QA 3RKUA 4R1MA 4YNBA 2O8FB 5IN5A 3U9SA 2YVQA 3ZNPA 3W1WA 1E7MA 1Z63A 2IHYA 3X3HA 1Z18A 4D9BA 4TYWA 4DCVA 1PBNA 4EF6A 3EBLA 1TJNA 3DTTA 3GH3A 2FYTA 1GZSA 1NUQA 3LNTA 4BZWA 4TZ6A 4BNWA 1WNTA 3EUEA 4P4UA 3KZNA 1DO2A 1KAQA 4H3KB 1KI6A 4PO8A 10MHA 2MIIA 1KSFX 3A1TA 1CP2A 4MR8B 1T8RA 4I2NA 3U39A 4AYTA 4MV7A 2RGCA 2AXNA 4DC9A 1Q1NA 4IIDA 2MT9A 3GJYA 5SY4A 1QP4A 1N2BA 3GNLA 3LUHA 4RCYA 3SNHA 5AVRA 2ZCJA 3AC0A 3WGVA 2NUPA 1P9WA 1R2QA 5TPWA 4DLBA 2NYUA 3EUFA 2X14A 3PQDA 3ZV5A 2BGUA 4LRSB 1QDLB 2X6RA 5ALLA 1GV1A 1P72A 1QFJA 4IDEA 5LQMA 3AEUA 3D3WA 3N5KA 1ONSA 3BEDA 1PVDA 1UZUA 2PUTA 4HRXA 5K2OA 3BFPA 1GV0A 5CIYA 3H87A 1C29B 3WHLA 1GTVA 2REQB 2WSYB 4O6VA 4Q4DA 3GUYA 4GVPA 2WLSA 3CLHA 3E70C 4HDSA 3C3PA 1Y8QB 4P1ZA 1U2EA 2JFOA 1M1YE 4M87A 2IU3A 3VC3A 4KQHA 3THXA 3HWX1 3FOWA 2J6IA 2W2LD 3LLCA 3OA2A 4Q48A 2IDKA 2V7TA 4UEKA 4JLNA 1RBMA 3BE6A 3ZHCA 1OI7A 2CVQA 3NHFA 4GEKA 3A4IA 3M34A 4Q39A 4EI9A 3PITA 4I19A 3COPA 1NG1A 4BEVA 2C9BA 3UG6A 2Q8NA 1KR2A 5KQLA 5BWCA 4KNWA 1QHFA 3IUMA 3G85A 1PZEA 1NMQA 2VNIA 3OOWA 4JI0B 3IPCA 4JP3A 4OH1A 4G5OA 3IB6A 2FSVA 2M9MA 2OCAA 3L0CA 4AZ0B 3NDRA 4BLRA 5IAAA 1KJ9A 1V5WA 2VJDA 3BFVA 3ZI7A 4GLOA 3N2GA 4AJKA 2P6OA 3O3NB 4NAUA 4JI7B 3I5YA 1H42A 2WKRA 3DLIA 3ULKA 2W8ZA 3S44A 3WNQA 1OR8A 3RO7A 2H7XA 3UMVA 1W94A 3DF9A 5CFOA 2CCJA 1EWYA 1T8SA 2VF7A 4YO8A 3BSFA 5E4JA 1IOVA 5JR3A 2PTGA 1YWGO 3V42A 4RVOA 1XALA 1YQWA 2CK3D 4V1CI 3RAFC 3RJZA 5DULA 4QULA 1Y8CA 2WOOA 1KZ9A 1KSJA 4R1SA 1NW8A 3B20A 1Q17A 5EZ6B 4Y18A 2FW9A 3ZJ4A 1T2AA 2XWQA 1U81A 2B30A 2GN1A 2R7LA 3IYLW 4LVNA 3FOEC 1Z0KA 5AI0A 3TX6A 1FYDA 2B1GA 1ISRA 3UAGA 3CB2A 1JEYA 1UDAA 4M1TA 2WKQA 4ALNA 4PHTA 1PKXA 4WPGA 5J4VA 4YY3B 2C1EA 2GF9A 4J7CA 4N49A 4K6HA 3Q2IA 1CIVA 3EC7A 3Q88A 4P7JA 3IE1A 2RHJA 3TW8B 3DDOA 4LZJA 1IWBB 2ZJ4A 2R65A 3LGAA 5T3YA 4AF6A 5J47A 5JMWA 1GZVA 3BXOA 4A8PA 4LNAA 2NUPB 5ECYA 1KYZA 1JPVA 4QAJA 2B7BA 4EZEA 3X1ZA 2EERA 4RA9A 1SHLA 1JDBB 1CQIB 2XMZA 2Z4TA 2BIFA 3G02A 2VNJA 3GUVA 2I4RA 4L8FA 1R15A 2WNHA 5D1NA 1JDJA 1GG8A 1R66A 4BMSA 3DS8A 2GXUA 2X3YA 1Z4KA 1ZUNA 1T2FA 2WAOA 4RZSA 3UN1A 3ZHBA 1RQGA 4BO8A 4PAQA 4UOZA 2ZRAA 4OSPA 2NSYA 3M3PA 1G9TA 2WJ3A 4LQ4A 5DX1A 4ZANA 2AF4C 2OCLA 2Y05A 4D57A 3GPBA 4Q6BA 1GN8A 4PQEA 4GPBA 3WV4A 2B0CA 4N48A 3CE9A 1YRQA 3O4GA 2VP6A 3CNBA 3DNMA 1QF9A 4JFAA 3TCKA 1ZOPA 2I1WA 3CRRA 2XOKD 4UCXA 1EUQA 2ETVA 2PS1A 2R4TA 2J3JA 3H1TA 4MLDA 3ORYA 2P5YA 3OZVA 2BFEA 4OXYA 1SVNA 4IDGA 3AB8A 4QYIB 4C4YA 1OT5A 4DDVA 3ZDQA 3B7WA 2KBFA 4Z51A 2OORC 3EHDA 2XDYA 1D6JA 4WLFA 4Z4FA 1LBQA 2HHHB 2OSBA 1O5OA 5KI6A 2I2BA 2GRAA 3EXFA 3HMQA 4I7EA 1ZGHA 2QTRA 4DC1A 1FFEA 5BSMA 3S2ZA 1E6WA 3VM6A 2WP8J 2PD3A 1DKUA 2WKWA 1HYGA 2DGDA 4M98A 4YN3A 1NJSA 4QZVA 1BH2A 4FGLA 1N2HA 1YTUA 2GN4A 4UQPA 1MRSA 3OIDA 4QHTA 5KYVA 1HKUA 1CTQA 1W1WA 3LY9A 2HF7A 1DCMA 1RBQA 1L7QA 1TC2A 2O05A 2H0QA 3EZLA 1QBGA 1Z3IX 2IW3A 2YV1A 3O7MA 1UUFA 3LPCA 3QF4A 1CZKA 4HWKA 4JP8A 3NALA 4D79A 2ICAA 4WLUA 4XVRA 2JI7A 1SG9A 2BI7A 2QLLA 2G08A 2IPMA 4MS3B 5BW5A 2ZBUA 4XD7D 3SBDA 3ER9A 5ALUA 1K6JA 4C6TA 1RPNA 4N5HX 2XGJA 3RABA 4F96A 1ST2A 4MA4A 4CXMA 1EK0A 3OU2A 1BN6A 3QX3A 1WMEA 3NIGB 5BW4A 2G8LA 2XYVA 2A5GA 1MGPA 4OJKA 1QHEA 3O4VA 2ZYIA 4EMUA 5TQVA 4GGOA 4IVNA 4QOSA 4BP1A 3GFBA 5IVIA 5KVAA 3FJYA 3OWHA 5DHFA 3KPYA 2BFPA 5U1PA 1X8XA 2RHHA 3CZ5A 4RA9B 4LFCB 1M1NA 2ZI4A 4I3FA 2QN7A 4Z1MD 4ER5A 2P9ZA 4ZO8A 4HF7A 2IXDA 4R8LA 3DFIA 4UU7A 3RVSA 1NVBA 1O95C 4ZC8A 2WZDA 3K0CC 3SIPA 1HBJA 1KKMA 2XGGA 4LWZA 2FUKA 3ZLUA 3MWLA 3I23A 4PYRA 5K0CA 4XIYA 4NK5A 2G76A 1FDTA 1WPQA 3MJRA 3N8DA 2O23A 4R98A 1HNWB 5IT5A 2TYSB 1Z39A 3FH0A 2ZRMA 3QMVA 1COWA 3BRWA 4L75A 3VJKA 1MO2A 1Z8FA 4IJMA 2AOUA 1X94A 2P2DA 4Q3OA 4CKEA 4HGZA 1RIIA 2FPRA 3E53A 3I2FA 4HWSA 4MW9A 2CBXA 4ZVPA 1JAYA 3BF8A 4F5ZA 2QQ0A 2GPAA 4AJ1A 4LWPA 3IPYA 4TUYB 2BBOA 3UMCA 5EJEA 5M04A 3W1VA 4Q3KA 3EYAA 2BFEB 4TYQA 5AJHA 5EKSA 1R0XA 3VNQA 4ETWA 3U60B 1NW3A 2PVSA 1R9JA 2IZ0A 3K5HA 4B7XA 1TCAA 2QYOA 5JDIA 1D4OA 1UMDB 4YP5A 5AM5A 2Z6QA 2HQOA 4H3SA 3SXJA 3AWIA 3PLNA 2ECKA 2AVNA 4U6SA 1G291 4AG6A 4EJMA 5B12A 1YS4A 1GPH1 4PY2A 3P8ZA 1QO9A 2WG1A 1OTYA 4JL5A 4KIFA 3GJ0A 4WOBA 3BMNA 4Q12A 1QZXA 2AN1A 4PPYA 3T8YA 4DNFA 1T10A 4Q93A 2LCQA 4I9GA 4ERXA 4Q3NA 5LZ7A 5AM4A 3FDFA 4MNTA 2C2OA 5K3FA 1SXJC 4JB0A 1E92A 3BGWA 3DBHA 3OIUA 4RSRA 4ZQEA 4K2HA 5EXDA 4MVJA 2FOLA 3THRA 3OTHA 4DWVA 2PXHA 2A9OA 2VSXA 2GDZA 1C1YA 3UF0A 4ZC1A 1F0NA 1O8CA 3WA7A 2Z8ZA 4W9NA 3RS9A 3IKTA 1EFAA 4MQUA 1IZYA 5DIFA 3HCCA 3TL2A 1KQGA 2UVQA 1Y4ZA 1CKEA 1E32A 1NURA 1YV9A 4WY2A 5DU2A 1I4DD 2X7XA 3HUTA 4UEWA 1NONA 3R3HA 1WUTA 3IAS1 3NYWA 3MK31 4I4TF 1J5XA 5AVVA 3UC9A 2QM3A 4HLCA 1HTWA 4H7HA 3KTOA 1QX3A 1AA9A 4L3WA 1MG0A 1TYDE 3VGPA 1W5TA 1R4AA 3F97A 4CCYB 4YPOA 3IS3A 5BMVF 1HMPA 4LYYA 4LJYA 4E5VA 4JC4A 1FQWA 1LI5A 4TMTA 3LXRA 1OC2A 3AESB 4WHMA 3R9KA 4AJ2A 4ISBA 2IPAB 1TADA 5IBQA 1VBNA 4D5GA 4W5TA 2HJWA 5LKRA 3ZY4A 1M5RA 2IEDA 2Z30A 3OT1A 4OV6B 3SKVA 1M1NB 4EKGA 3I45A 2FZ5A 3E61A 5C9ZA 3BMCB 2I2WA 3MOSA 4URZR 3A0RB 2IJGX 2ARKA 3MINA 4FW9A 4OHOA 3N9IA 4HAVA 4N6NA 1QRDA 4NEHB 5D3MB 5KSPA 5KNDA 1DTWB 2GOYA 3AIIA 5A0TA 4DYVA 2PKWA 1POXA 4UARA 1PJCA 2XMSA 4AURA 4JLBA 2Q5FA 2PR7A 3EIWA 2XEDA 4IJ5A 4LHWA 2I7DA 5L7TA 2NVBA 1YOVA 2R8EA 2ZETA 5C35A 1KK2A 2AOUB 1MB3A 3DW1X 4IHJF 3QU9A 1RAHA 4JA2A 4QJ4A 2XDWA 3V8EA 1PRYA 1R6UA 4B7AA 5BPHA 1GYPA 4BNDA 3I2IA 3KV3O 2AN3A 4I9NA 3KQHA 4IIJA 4BCCA 5A0VA 2W6IA 1SM4A 2YC4C 2VN8A 4UHDA 2J4DA 3PFGA 4Z49A 4C7OB 2Q6LA 3ZWMA 3A27A 4QECA 3OOYA 5E6UB 3SOPA 1DEXA 2HJSA 1DGQA 4WZBE 2GBLA 4LJAA 1KEEA 3BD7A 5ARBA 2BBSA 4IMJB 1LW6E 1EM6A 1GZDA 1P9LA 1S2LA 2ZWVA 4G8DA 4Q6WA 1I6LA 4QPPA 5BMOA 3K9FC 3RAEC 4C0JA 2NYAA 4TRMA 2G71A 2DQ4A 4P7KA 4UE2A 4ER0A 3GFOA 4F2DA 2FPGA 1YL7A 4H7KA 3FI0A 4X8MA 3QY0A 3HBFA 2QLTA 1YA6A 4KXWA 5K51A 2O1WA 2OBYA 4YCAA 2AEEA 1BA2A 2ZK7A 5CH3A 6YASA 3PKIA 2C2KA 2FR8A 4JJKA 4WK4B 1NU6A 2C7GA 2FPIA 2QR3A 4NENA 1FNDA 2KS6A 4MW4A 1SR8A 4GC9A 1L7DA 3K15A 4Y2PA 3CF6R 5DHRA 2ONCA 1D0VA 3EVZA 2GK6A 4WIAA 2LWIA 2WDPA 1FPMA 1ZS9A 1JLMA 2X4GA 3E6AA 4JAVC 4R16A 4TXJA 1ZR4A 5A9RA 1RC1A 3CZ9A 1ISIA 1GWNA 1QHIA 2CD9A 3CNQS 3V1NA 1WW2A 1ZONA 2Z8YM 5HGJA 5CFZA 1EFPB 2HCJB 1Q6YA 1ZL2A 3R5FA 2VUSA 1N7IA 1M1XB 1AS2A 4TVOA 1UDXA 1CPYA 1EFVB 4IDBA 4ILKA 2WQ6A 2HA0A 2NUAA 2WIKA 2UZAA 5TJHA 2FZKA 8AT1A 1K97A 2OXRA 4NYIR 1JJVA 1KJ8A 3C3BA 1G7CA 5HX7A 1FNMA 1N5JA 3CTPA 3GEEA 2Q4BA 3HDTA 4QEZA 1WDTA 3R0QA 3U4CA 3W4IA 1Z2CA 2VSOA 3L06A 5CA0A 1SGWA 3BEOA 2HU5A 3HO8A 3UW1A 4IFBA 4F84A 1AQJA 3W3AH 2DCUA 4KLNA 3GMSA 3UWDA 4LRXA 3F5MA 3WGKA 1GQSA 4X1YB 4N0QA 5BWNA 2XQGA 1A5BB 2DQZA 3R3YA 3RS5A 4UD2A 3TIGA 3VDNB 4DN6A 2JLZA 3U7QB 4MRNA 3LT4A 1IN4A 1K5HA 3IVAA 1ACLA 3LGSA 4GMHA 4JEHA 1BNCA 2O3TA 2JC3A 1RE0A 3VU9A 4E07A 5I7UA 4QUBA 4W1QA 2BFOA 3F7MA 9LDTA 2PUHA 4QGFA 4YLYA 2W5UA 2IS1A 1WEHA 5FQNA 7MHTA 1F6WA 2IVZA 5EKTA 4MV1A 3B48A 4I9UA 1UXOA 1NQXA 1YOVB 2GERA 2BTQB 2N42A 3FMGA 3EQ6A 1Q0PA 3PXUA 4M1MA 5F1YA 4J1TC 3SKXA 2JGRA 3Q3EA 4M9ZA 1YQXA 2XE4A 1AKEA 4AZTA 3VYSB 2A4MA 2HTEA 3GL9A 4LY6A 4BNDB 2Y3IA 1GRVA 1A2KC 1AM4D 1G55A 2GWHA 3TAXA 5L95A 2NT3A 3NGMA 5LQRA 2H5EA 1LLFA 1C8KA 1L1RA 3MS2A 4JVOA 1MLDA 2F8MA 5JS6A 4UBKA 3SXPA 1ODTC 1RM5A 1PYOA 1P7WA 2PKRA 3HFSA 3U0BA 4BMPB 5JYDA 4FZ3A 1HGXA 1S01A 3UJAA 3OEYA 4MKXA 4WX2B 2YBDA 3HR7A 3WYNA 3SQXA 1PF7E 5AJUA 2OC9A 3MBOA 3GLIA 1IJKA 1HDYA 2W6PA 3A31A 4PIPA 4MGZR 1VPTA 2ECPA 4WLEA 3N8KA 1LDNA 5AOVA 2R66A 3ID6C 4JROA 3VX4A 2CNWD 4E5KA 4XWOA 4CCWA 2C5LA 4HZUB 1BVRA 1EVQA 4H16A 4UUNA 1EM8A 5AM0A 4E09A 3OJLA 5AWFC 3GQBA 4ESEA 2PJDA 2BGNA 2Q2WA 3JQ6A 3FR7A 3S28A 1YB1A 3V1YA 4EYGA 2GX6A 4MR7A 4YRIA 4FCCA 4MGKR 4WV3A 4P3OA 3LV8A 4W9NC 1VRWA 1J39A 1OC4A 4UM7A 1C7QA 3CX8A 4DXDA 2ZUCA 2UYQA 1SCBA 4GS5A 3V8MA 2FN4A 1S5PA 3IOEA 2Q6OA 2P69A 3KUKA 1FFWA 1DQPA 4X1IA 3TQSA 3IILA 2DUWA 2YXLA 5AW8A 3ADCA 2VJMB 4WXHA 2AB0A 4I81A 2NP6A 2HCTA 1SD5A 1W46A 4F7WA 4DLYA 2JLRA 2DULA 1QE3A 1ZMXA 2JD0A 3A1UA 1Z5WA 2P5UA 3M6FA 1MNAA 2EZ9A 1ONBA 2ST1A 3KU4A 2WP0A 2FQQA 4Y7DA 1SC4A 2ID8A 3TSAA 3MTQA 2OHXA 1KBZA 1F7UA 5I8ZA 3G8CA 3D6VA 3O74A 4GR9A 5TLSA 2R1TA 5JQGB 3LM8A 1R27A 3ZWYA 2XOXA 1LBIA 2PGAA 4K6CA 3UK2A 4XDHA 2YIMA 5KSOA 3I5XA 5LLTA 4K26A 1SG0A 1YASA 2JHCA 4I4IA 1ZD3A 3DHNA 2IXGA 2OPBA 2W2TA 1GZUA 2CYBA 3O8QA 1CVIA 4HNHA 4NATA 1DKPA 2WKSA 3ZDFA 5B1YA 3W34A 1PQWA 3WRYC 4BNIA 4MUJA 2JFFA 4WTOA 3O1JC 1EBBA 1JALA 2IU6A 3V1KA 3DLHA 3C45A 1H9CA 4KPYA 3G2MA 1V48A 3AF0A 4L9WA 1GILA 1T4CA 2ZIZA 4FZ5A 1RWKA 4UXHA 4JI5B 4BFYA 4P31A 2PT6A 2FZCA 2C2GA 1L4YA 2JCGA 4XIIA 4OHVA 1QG0A 3ANXA 3WB9A 4B81A 5MN4A 2GN6A 2V7XA 2FTKE 5FPPA 1XZEA 3KWFA 1RDFA 5ALYA 5J63A 4BO3A 4BE4A 5J2UB 1NY6A 3O4IA 1U7WA 4PZCA 1P81A 3B1FA 2PZBA 3EEBA 4M1YA 4I6EA 3K0AA 1UOPA 4RD1A 5AIAA 1LSSA 1S2NA 3HB7A 3OBBA 3E0QA 3ZLJA 2I3GA 4MP8A 1IH8A 1DBSA 2XNKA 3QBVA 3GLVA 1CUSA 2NOAA 1G0OA 3RYCB 3BDAA 3ED5A 2JHFA 3II6X 1SKBA 3EGVA 5EXSA 3S1AB 2OBNA 5ENVA 4LC9A 2FOIA 1EM8B 2RH8A 1MPXA 2HNKA 2Y68A 3KUDA 3J81k 5DYGA 2XQFA 4CKWB 3QVSA 4KGZA 3WJAA 1RI3A 3DUFB 6GPBA 3U3OA 4WFJA 3TNJA 2WYOA 1CRZA 3K8OE 3AOEA 1EB8A 2Z1NA 2QW0X 4WXRA 2OYRA 1HFKA 2YDXA 4XZ3A 1MB2A 4MMZB 2HJVA 4IFEA 1L5ZA 1U3DA 2QM7A 4H60A 4FC7A 4GZ6A 5CFQA 3KBBA 3MMZA 4X1IB 3HB1A 4AU1A 5K8CA 1BA3A 2I2DA 1ZHOA 2DWPA 4CWAA 3E84A 3Q7EA 1CR1A 1Z2NX 4IEIA 3TTVA 3GLSA 3AKCA 1W93A 2VOJA 4C29A 3JZMA 2CW5A 2J9FA 2P40A 2V7QA 4MUGA 4B3XA 3PIRA 4G85A 3FCSB 4QNNA 4JNCA 1SUPA 3WISA 1BO6A 3DM5A 1PR4A 4P7FA 3ZHSA 3G0DA 3ZDEA 2GAFA 2XMCA 1F1JA 1M1YA 3GW8A 3U3JA 2QPTA 2GCNA 4Y9DA 2PX5A 1X1AA 4OBXA 3WLJA 1ZJWA 1LBSA 3PWSA 3CWZA 2XD9A 4BX8A 2WJVA 2IWHA 2L0XA 2V7PA 3ONFA 4UBIA 1DTEA 5JQWA 3M6MD 3H1AA 1E1KA 2E1PA 2EF1A 4JKIA 4MUKA 5EPOA 5KYTA 3T5PA 1BAPA 1Z0SA 4KI7A 4RV5A 3W3ZB 4PC3A 3A6LA 3MJVA 1DIGA 1QUEA 1VIVA 3RYHA 2VSYA 2IK8A 3OM1A 2NSDA 3H2HA 3I8XA 5K0GA 4OQNA 1E7YA 3GLUA 2ID4A 2A0WA 3N2IA 5CLJA 3GFTA 2Q0XA 4DG8A 1CJCA 2MTBA 2WHEA 3FTPA 5EEGA 1XZLA 4S1VA 1CHDA 1TM5E 2G04A 2X41A 3ZJ5A 1RWBA 3MSXA 3PS9A 1U8XX 2O4CA 2ZQYA 5GONF 3D7MA 4Y2UA 5IRCD 2R68A 3CJTA 3GEIA 5BT9A 1A7AA 1HY3A 2VHCA 4GBJA 3BZBA 5H7XA 3UFXA 5AJXA 1D2EA 3LOUA 5TJ9A 1T0PA 1VYTA 2XGOA 4TPKA 3ZXIA 4OQLA 2EBHX 5C8ZA 5IASA 3K9LA 1FNSA 3PUWA 3R3UA 3TK1A 3ZWNA 1ZAYA 2HSDA 2O19A 3SBEA 3D5QA 4OXNA 3CZMA 1F60A 1K27A 2H4FA 3K9HA 3MJEA 1ISJA 4W8HA 3DKRA 3K32A 4KX5A 3OPNA 2PX8A 3L5KA 3F7TA 1RHKA 2HA6A 4B75A 3REGA 3H8SA 1ZC3A 2WF6A 2FNAA 3HV2A 2WT8A 3ENKA 4ONEA 1E2FA 1Z7GA 3MUNA 2ZXFA 4PG4A 1PZGA 2IYQA 1I7NA 2VPYA 2GAJA 3VOTA 3GBVA 1BWRA 5E6SA 1JBEA 2RDMA 1NVDA 1R6VA 2PGIA 1EDOA 4PSAA 3TN7A 4N3GA 5FQOA 1R6BX 3E3NA 3UK0A 2HMSA 4HZGA 4R1PA 1CK4A 4EM6A 1A4XA 2RB4A 4X0EA 4BNNA 5D84A 1EK2A 1JKIA 3CLSD 3LK7A 3QF7A 1C4XA 1VHJA 4QHYA 5DOZA 2CBZA 1BN7<