2M6OA

The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
48
structure length
48
Chain Sequence
QAVEYACEKGHRFEMPFSVEAEIPPEWECKVCGAQALLVDGDGPEEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 5
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.270 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m6oA00
2M6OA 2M4VA 2M6PA
chains in the Genus database with same CATH superfamily
3M4OL 2XJRA 4POFA 3LWQB 1LKOA 1PFVA 3LNLA 4Y52L 1JYBA 5C4XL 1RYTA 1YK5A 2KKDA 1BRFA 2RDVA 1VZGA 2JA8L 4AHZA 3GTPL 1NNQA 3GTQL 1YV1A 4AHWA 2XJPA 1RWDA 2A6HD 3M3YL 5JVH1 2NVYL 5AI3A 2CKCA 2JI3A 3K7AL 5GAHc 1DVBA 3S1RL 3HOYL 2JA5L 2WB1P 1S2ZA 4A3DL 3H0GL 5IP9L 1BQ8A 2Y0SP 1RB9A 1PFWA 3H97A 1R0HA 3NFPI 1IU5A 3ZG6A 2PSMC 2KN9A 3P8BA 4UY81 3MSUA 4AHYA 2AUSB 1VZHA 1B2JA 1K83L 2PPTA 1QCVA 1I6HL 3KYUA 3PKIA 1B71A 4B8CD 4JAGA 1S30A 2XJUA 2ERJA 4C3IL 4AHXA 4Y7NL 2C6AA 1SFOL 3KYYA 1RYQA 1R0JA 8RXNA 4X6AL 1FHMA 2APOB 3KYXA 4JAEA 5MF6A 3RZOL 1FHHA 2CR8A 2PYAA 3LWPB 3PIP1 2V0EA 1BQ9A 1QQTA 3H9CA 1QYBA 5AI2A 5EINC 4V196 5FJ8L 3P2AA 2ERSA 5M5XL 2JA6L 3RYGA 2NVTL 4AYBP 4XGHA 4C2M1 1SMUA 3QQCE 5M5WL 3HOUL 3IU3I 2R92L 5IYCL 2R7ZL 1PFUA 3HOWL 1TWGL 2XJQA 3RZDL 1NXGA 5K2ME 2M4YA 3LWVB 3S14L 4AI1A 4A3KL 5IYBL 3GTLL 3K35A 3RZ6A 1ZRPA 4ME3A 1NXEA 3HJWB 1PZXA 1BE7A 2ZIXA 4BY7L 1YUXA 3J7Y1 2HVYC 3S1ML 1P7PA 4YWMA 4AR6A 5GAGc 2M6OA 1WCML 2J9UB 4AI3A 4A3EL 1R0GA 4BBRL 1H7VA 5AN9H 5IYDL 1DX8A 3HOVL 4A3ML 1T9PA 4BY1L 3GTGL 3MQKB 4AR3A 4JADA 1TWAL 1IW7D 4U671 2XJSA 2NVQL 5RXNA 5GADc 2E2HL 5M5YL 1WJVA 2M4VA 1E8JA 4BBSL 1BFYA 2L0ZA 4A93L 3PZAA 4LHLA 1VZIA 2VUML 5C3EL 2JI2A 3KYWA 3PKJA 1IROA 4ZN3B 2AQCA 4A3JL 3S17L 3S15L 5MGNA 5IY0A 5DM61 2E2IL 4BXXL 1TWFL 3H9BA 3PO3L 5MFZA 2JI1A 2C6BA 5C44L 3LWOB 2NYDA 3A44A 3HOZL 2XJTA 4A3IL 4C3JL 2YU9L 2RFKB 4AR5A 2HR5A 3WWNB 3PO2L 4RXNA 3HKZP 2LCQA 3I4ML 1B13A 2A68D 7RXNA 4ZN1B 4C3HL 4E6YA 3GTKL 5IP7L 3KYVA 1SMWA 3WWLA 4A3LL 4XXBB 4AI0A 1Y1WL 5C4JL 2M6PA 5DM71 2CKAA 3S2DL 1R9TL 4AR4A 1PFYA 1VCXA 2PVXA 5M3FL 1Z92B 2GMGA 3FKIL 1S24A 1OWCA 3MPSA 3B0AB 2R93L 2E2JL 3S1QL 3RZTA 2NVXL 2WAQP 3B08B 5MFPA 3H99A 4WFN1 5M3ML 4AI2A 3PWFA 2AYJA 3I4NL 1LKPA 1R0FA 3HJYB 1CADA 3H3VM 4GS7D 4A3GL 4JAFA 1CAAA 5GAEc 1IU6A 5EIOC 2O5JD 2B5ID 3SS2A 3VPBE 2H12A 2QL0A 5JVG1 2V0FA 3FDJA 4A3CL 1LKMA 2EY4E 1C09A 1ODHA 2A6ED 1TWHL 5H1Sc 4A3BL 2DSXA 1B2OA 1TWCL 1I50L 1RDVA 1LTLA 3S2HL 4YWLA 4QIWP 2Z3RB 2VL6A 3LWRB 5MLC3 1YUZA 3S16L 1SMMA 1T9OA 6RXNA 2PVEA 3QVDA 4LHNA 3S1NL 2BE5D 4K9FA 2Z3QB 1F4LA 2JA7L 1YK4A 5FLML 3GTJL 2K2DA 3J7Z1 4G6BA 3GTOL 2V3BB 3GTML 4POGA 1I3QL 1R0IA 4A3FL 2PMZP 3PIO1 3HAXC 1IRNA 4TVMA 3JR7A 1RDGA 2XJVA 2B63L 3CQZL 3HOXL 4TPUA 2MS3A 3LPEB 1Y1VL 1T9QA 1OWBA 3PL5A 2A69D
chains in the Genus database with same CATH topology
1QYBA 2XJRA 4POFA 2L0ZA 3PZAA 1LKOA 4LHLA 3LNLA 1VZIA 4AI2A 3PWFA 2JI2A 2AYJA 1JYBA 5AI2A 3KYWA 3PKJA 5EINC 1RYTA 1YK5A 4V196 1LKPA 1R0FA 1CADA 1IROA 2KKDA 1BRFA 4ZN3B 3P2AA 2RDVA 4GS7D 4JAFA 1CAAA 2ERSA 5MGNA 1VZGA 3RYGA 5GAEc 5IY0A 5DM61 1IU6A 4AHZA 4XGHA 1NNQA 5EIOC 2O5JD 2B5ID 1SMUA 1YV1A 3QQCE 3SS2A 5MFZA 2JI1A 2C6BA 3VPBE 2H12A 2NYDA 2QL0A 2XJPA 4AHWA 1RWDA 3IU3I 2A6HD 2V0FA 5JVG1 1LKMA 3A44A 1C09A 2XJTA 5JVH1 1ODHA 2A6ED 5AI3A 5H1Sc 2CKCA 2JI3A 4AR5A 2XJQA 2DSXA 1B2OA 5GAHc 1NXGA 1DVBA 2HR5A 3WWNB 5K2ME 1RDVA 2M4YA 1LTLA 4RXNA 4AI1A 2LCQA 4YWLA 2Z3RB 1B13A 1S2ZA 2VL6A 3K35A 2A68D 5MLC3 7RXNA 3RZ6A 1YUZA 1ZRPA 4ME3A 1SMMA 1BQ8A 1T9OA 4ZN1B 6RXNA 1RB9A 1NXEA 2PVEA 4E6YA 3QVDA 1R0HA 3KYVA 1SMWA 3WWLA 1BE7A 2ZIXA 3NFPI 4LHNA 2BE5D 1IU5A 4XXBB 1YUXA 3J7Y1 4AI0A 3ZG6A 4YWMA 2PSMC 2KN9A 3P8BA 4UY81 3MSUA 4AHYA 4AR6A 4K9FA 5GAGc 2Z3QB 2M6OA 2M6PA 1VZHA 1YK4A 2J9UB 1B2JA 4AI3A 5DM71 2PPTA 1R0GA 2K2DA 3J7Z1 4G6BA 1H7VA 2CKAA 1QCVA 2V3BB 4POGA 5AN9H 1R0IA 4AR4A 3KYUA 3PKIA 1DX8A 1VCXA 3PIO1 1B71A 4B8CD 1IRNA 4JAGA 4TVMA 2PVXA 1S30A 1T9PA 1Z92B 2XJUA 2ERJA 1RDGA 4AR3A 4AHXA 2GMGA 4JADA 2XJVA 1IW7D 2C6AA 4U671 1S24A 1OWCA 2XJSA 3KYYA 3MPSA 5RXNA 1RYQA 3B0AB 4TPUA 1R0JA 5GADc 8RXNA 2MS3A 3LPEB 1WJVA 2M4VA 3RZTA 1FHMA 1T9QA 3KYXA 1E8JA 1OWBA 4JAEA 5MF6A 1FHHA 2CR8A 2PYAA 3B08B 5MFPA 1BFYA 3PIP1 4WFN1 2V0EA 2A69D 1BQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6O A;  2M4V A;  2M6P A; 
#chains in the Genus database with same CATH topology
 3M4O L;  2XJR A;  4POF A;  3LWQ B;  1LKO A;  1PFV A;  3LNL A;  4Y52 L;  1JYB A;  5C4X L;  1RYT A;  1YK5 A;  2KKD A;  1BRF A;  2RDV A;  1VZG A;  2JA8 L;  4AHZ A;  3GTP L;  1NNQ A;  3GTQ L;  1YV1 A;  4AHW A;  2XJP A;  1RWD A;  2A6H D;  3M3Y L;  5JVH 1;  2NVY L;  5AI3 A;  2CKC A;  2JI3 A;  3K7A L;  5GAH c;  1DVB A;  3S1R L;  3HOY L;  2JA5 L;  2WB1 P;  1S2Z A;  4A3D L;  3H0G L;  5IP9 L;  1BQ8 A;  2Y0S P;  1RB9 A;  1PFW A;  3H97 A;  1R0H A;  3NFP I;  1IU5 A;  3ZG6 A;  2PSM C;  2KN9 A;  3P8B A;  4UY8 1;  3MSU A;  4AHY A;  2AUS B;  1VZH A;  1B2J A;  1K83 L;  2PPT A;  1QCV A;  1I6H L;  3KYU A;  3PKI A;  1B71 A;  4B8C D;  4JAG A;  1S30 A;  2XJU A;  2ERJ A;  4C3I L;  4AHX A;  4Y7N L;  2C6A A;  1SFO L;  3KYY A;  1RYQ A;  1R0J A;  8RXN A;  4X6A L;  1FHM A;  2APO B;  3KYX A;  4JAE A;  5MF6 A;  3RZO L;  1FHH A;  2CR8 A;  2PYA A;  3LWP B;  3PIP 1;  2V0E A;  1BQ9 A;  1QQT A;  3H9C A;  1QYB A;  5AI2 A;  5EIN C;  4V19 6;  5FJ8 L;  3P2A A;  2ERS A;  5M5X L;  2JA6 L;  3RYG A;  2NVT L;  4AYB P;  4XGH A;  4C2M 1;  1SMU A;  3QQC E;  5M5W L;  3HOU L;  3IU3 I;  2R92 L;  5IYC L;  2R7Z L;  1PFU A;  3HOW L;  1TWG L;  2XJQ A;  3RZD L;  1NXG A;  5K2M E;  2M4Y A;  3LWV B;  3S14 L;  4AI1 A;  4A3K L;  5IYB L;  3GTL L;  3K35 A;  3RZ6 A;  1ZRP A;  4ME3 A;  1NXE A;  3HJW B;  1PZX A;  1BE7 A;  2ZIX A;  4BY7 L;  1YUX A;  3J7Y 1;  2HVY C;  3S1M L;  1P7P A;  4YWM A;  4AR6 A;  5GAG c;  2M6O A;  1WCM L;  2J9U B;  4AI3 A;  4A3E L;  1R0G A;  4BBR L;  1H7V A;  5AN9 H;  5IYD L;  1DX8 A;  3HOV L;  4A3M L;  1T9P A;  4BY1 L;  3GTG L;  3MQK B;  4AR3 A;  4JAD A;  1TWA L;  1IW7 D;  4U67 1;  2XJS A;  2NVQ L;  5RXN A;  5GAD c;  2E2H L;  5M5Y L;  1WJV A;  2M4V A;  1E8J A;  4BBS L;  1BFY A;  2L0Z A;  4A93 L;  3PZA A;  4LHL A;  1VZI A;  2VUM L;  5C3E L;  2JI2 A;  3KYW A;  3PKJ A;  1IRO A;  4ZN3 B;  2AQC A;  4A3J L;  3S17 L;  3S15 L;  5MGN A;  5IY0 A;  5DM6 1;  2E2I L;  4BXX L;  1TWF L;  3H9B A;  3PO3 L;  5MFZ A;  2JI1 A;  2C6B A;  5C44 L;  3LWO B;  2NYD A;  3A44 A;  3HOZ L;  2XJT A;  4A3I L;  4C3J L;  2YU9 L;  2RFK B;  4AR5 A;  2HR5 A;  3WWN B;  3PO2 L;  4RXN A;  3HKZ P;  2LCQ A;  3I4M L;  1B13 A;  2A68 D;  7RXN A;  4ZN1 B;  4C3H L;  4E6Y A;  3GTK L;  5IP7 L;  3KYV A;  1SMW A;  3WWL A;  4A3L L;  4XXB B;  4AI0 A;  1Y1W L;  5C4J L;  2M6P A;  5DM7 1;  2CKA A;  3S2D L;  1R9T L;  4AR4 A;  1PFY A;  1VCX A;  2PVX A;  5M3F L;  1Z92 B;  2GMG A;  3FKI L;  1S24 A;  1OWC A;  3MPS A;  3B0A B;  2R93 L;  2E2J L;  3S1Q L;  3RZT A;  2NVX L;  2WAQ P;  3B08 B;  5MFP A;  3H99 A;  4WFN 1;  5M3M L;  4AI2 A;  3PWF A;  2AYJ A;  3I4N L;  1LKP A;  1R0F A;  3HJY B;  1CAD A;  3H3V M;  4GS7 D;  4A3G L;  4JAF A;  1CAA A;  5GAE c;  1IU6 A;  5EIO C;  2O5J D;  2B5I D;  3SS2 A;  3VPB E;  2H12 A;  2QL0 A;  5JVG 1;  2V0F A;  3FDJ A;  4A3C L;  1LKM A;  2EY4 E;  1C09 A;  1ODH A;  2A6E D;  1TWH L;  5H1S c;  4A3B L;  2DSX A;  1B2O A;  1TWC L;  1I50 L;  1RDV A;  1LTL A;  3S2H L;  4YWL A;  4QIW P;  2Z3R B;  2VL6 A;  3LWR B;  5MLC 3;  1YUZ A;  3S16 L;  1SMM A;  1T9O A;  6RXN A;  2PVE A;  3QVD A;  4LHN A;  3S1N L;  2BE5 D;  4K9F A;  2Z3Q B;  1F4L A;  2JA7 L;  1YK4 A;  5FLM L;  3GTJ L;  2K2D A;  3J7Z 1;  4G6B A;  3GTO L;  2V3B B;  3GTM L;  4POG A;  1I3Q L;  1R0I A;  4A3F L;  2PMZ P;  3PIO 1;  3HAX C;  1IRN A;  4TVM A;  3JR7 A;  1RDG A;  2XJV A;  2B63 L;  3CQZ L;  3HOX L;  4TPU A;  2MS3 A;  3LPE B;  1Y1V L;  1T9Q A;  1OWB A;  3PL5 A;  2A69 D; 
#chains in the Genus database with same CATH homology
 1QYB A;  2XJR A;  4POF A;  2L0Z A;  3PZA A;  1LKO A;  4LHL A;  3LNL A;  1VZI A;  4AI2 A;  3PWF A;  2JI2 A;  2AYJ A;  1JYB A;  5AI2 A;  3KYW A;  3PKJ A;  5EIN C;  1RYT A;  1YK5 A;  4V19 6;  1LKP A;  1R0F A;  1CAD A;  1IRO A;  2KKD A;  1BRF A;  4ZN3 B;  3P2A A;  2RDV A;  4GS7 D;  4JAF A;  1CAA A;  2ERS A;  5MGN A;  1VZG A;  3RYG A;  5GAE c;  5IY0 A;  5DM6 1;  1IU6 A;  4AHZ A;  4XGH A;  1NNQ A;  5EIO C;  2O5J D;  2B5I D;  1SMU A;  1YV1 A;  3QQC E;  3SS2 A;  5MFZ A;  2JI1 A;  2C6B A;  3VPB E;  2H12 A;  2NYD A;  2QL0 A;  2XJP A;  4AHW A;  1RWD A;  3IU3 I;  2A6H D;  2V0F A;  5JVG 1;  1LKM A;  3A44 A;  1C09 A;  2XJT A;  5JVH 1;  1ODH A;  2A6E D;  5AI3 A;  5H1S c;  2CKC A;  2JI3 A;  4AR5 A;  2XJQ A;  2DSX A;  1B2O A;  5GAH c;  1NXG A;  1DVB A;  2HR5 A;  3WWN B;  5K2M E;  1RDV A;  2M4Y A;  1LTL A;  4RXN A;  4AI1 A;  2LCQ A;  4YWL A;  2Z3R B;  1B13 A;  1S2Z A;  2VL6 A;  3K35 A;  2A68 D;  5MLC 3;  7RXN A;  3RZ6 A;  1YUZ A;  1ZRP A;  4ME3 A;  1SMM A;  1BQ8 A;  1T9O A;  4ZN1 B;  6RXN A;  1RB9 A;  1NXE A;  2PVE A;  4E6Y A;  3QVD A;  1R0H A;  3KYV A;  1SMW A;  3WWL A;  1BE7 A;  2ZIX A;  3NFP I;  4LHN A;  2BE5 D;  1IU5 A;  4XXB B;  1YUX A;  3J7Y 1;  4AI0 A;  3ZG6 A;  4YWM A;  2PSM C;  2KN9 A;  3P8B A;  4UY8 1;  3MSU A;  4AHY A;  4AR6 A;  4K9F A;  5GAG c;  2Z3Q B;  2M6O A;  2M6P A;  1VZH A;  1YK4 A;  2J9U B;  1B2J A;  4AI3 A;  5DM7 1;  2PPT A;  1R0G A;  2K2D A;  3J7Z 1;  4G6B A;  1H7V A;  2CKA A;  1QCV A;  2V3B B;  4POG A;  5AN9 H;  1R0I A;  4AR4 A;  3KYU A;  3PKI A;  1DX8 A;  1VCX A;  3PIO 1;  1B71 A;  4B8C D;  1IRN A;  4JAG A;  4TVM A;  2PVX A;  1S30 A;  1T9P A;  1Z92 B;  2XJU A;  2ERJ A;  1RDG A;  4AR3 A;  4AHX A;  2GMG A;  4JAD A;  2XJV A;  1IW7 D;  2C6A A;  4U67 1;  1S24 A;  1OWC A;  2XJS A;  3KYY A;  3MPS A;  5RXN A;  1RYQ A;  3B0A B;  4TPU A;  1R0J A;  5GAD c;  8RXN A;  2MS3 A;  3LPE B;  1WJV A;  2M4V A;  3RZT A;  1FHM A;  1T9Q A;  3KYX A;  1E8J A;  1OWB A;  4JAE A;  5MF6 A;  1FHH A;  2CR8 A;  2PYA A;  3B08 B;  5MFP A;  1BFY A;  3PIP 1;  4WFN 1;  2V0E A;  2A69 D;  1BQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...