2M6PA

The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
b'PRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Mb2076
publication title The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase.
pubmed doi rcsb
source organism Mycobacterium bovis
molecule tags Transcription
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.270 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m6pA00
2M6PA 2M4VA 2M6OA
chains in the Genus database with same CATH superfamily
2JA6L 3HKZP 3RZDL 1BRFA 2L0ZA 1TWAL 1S30A 1ZRPA 5JVH1 2JI2A 3K35A 3K7AL 2M6OA 3S1RL 3H9CA 1ODHA 3S17L 5M5XL 1WJVA 1SFOL 1YK5A 1PFYA 2HVYC 1T9PA 3SS2A 2Y0SP 1RWDA 5M3FL 2C6BA 4AHYA 1VCXA 1FHMA 1K83L 3KYVA 4YWMA 2NVQL 4AR3A 3WWNB 1S24A 2HR5A 1NXGA 2JA8L 3RYGA 1LTLA 1PFUA 1RB9A 2LCQA 5EIOC 5IP9L 4BBRL 2CKCA 1PFVA 1JYBA 1Y1WL 4AR6A 3LWQB 5AI2A 3GTPL 3PO2L 4A3FL 4A3GL 3S1QL 4JAGA 4U671 4Y52L 2V3BB 3RZ6A 2XJUA 3PWFA 3ZG6A 2XJRA 2XJSA 3LWVB 4GS7D 3B08B 2APOB 4AHZA 1BQ9A 2AYJA 3PKIA 2NYDA 2CKAA 2DSXA 3J7Z1 3GTQL 3QQCE 3FDJA 3GTKL 3I4NL 4JAFA 3KYXA 5K2ME 2M4YA 1OWBA 2A69D 1RYTA 2B5ID 3LPEB 4POFA 1NXEA 3H97A 2NVTL 5H1Sc 4POGA 1LKMA 4AR4A 3S1NL 5MGNA 4AHWA 3HOZL 1E8JA 3PO3L 1YV1A 2V0FA 3KYYA 4ME3A 3S2HL 2RDVA 2GMGA 1R0JA 2PSMC 4AI2A 1TWGL 3S16L 3LWOB 3P2AA 3IU3I 1SMMA 3JR7A 1LKOA 1PZXA 1SMUA 4AI1A 4C2M1 1TWHL 3MSUA 3PKJA 1YUXA 5GADc 4A3KL 3PIO1 3KYUA 4A3BL 3CQZL 2NVYL 1B2OA 1VZHA 2JA7L 4A3JL 2YU9L 1I50L 3HOYL 3PZAA 3HOVL 2XJQA 1BQ8A 2VUML 2PVXA 3KYWA 5C4JL 1NNQA 4A3LL 3GTLL 1BE7A 2A6ED 5IYBL 4BY1L 2K2DA 4AR5A 2A68D 3PL5A 1RDGA 4AI3A 1PFWA 3M3YL 4K9FA 4BXXL 5FJ8L 1VZIA 4A93L 3S1ML 8RXNA 2Z3RB 3FKIL 2J9UB 2PPTA 5GAHc 3MQKB 4E6YA 2BE5D 2O5JD 1H7VA 4A3IL 4A3DL 2JA5L 4JAEA 4TPUA 4AHXA 4A3EL 2XJPA 3QVDA 4B8CD 4ZN3B 3H99A 1P7PA 1S2ZA 3LWRB 2AQCA 1FHHA 2C6AA 4JADA 1TWFL 3HAXC 4C3IL 3NFPI 2R7ZL 3S2DL 2WAQP 3LNLA 4BBSL 4YWLA 2E2IL 1I6HL 3B0AB 1T9OA 4V196 4Y7NL 2ZIXA 1YK4A 1IU5A 1WCML 2H12A 4XXBB 4AYBP 3RZTA 2ERSA 1QYBA 3A44A 5M5YL 5DM71 1DVBA 5GAEc 1R0GA 1F4LA 1OWCA 1RDVA 3GTJL 1YUZA 1IU6A 2JI1A 2Z3QB 1CAAA 4TVMA 5JVG1 2E2JL 2PYAA 4A3CL 2E2HL 2NVXL 2PMZP 1VZGA 5C4XL 5C3EL 1B71A 3HOWL 1QQTA 2EY4E 4LHNA 4AI0A 3GTOL 4LHLA 5C44L 1CADA 2JI3A 2AUSB 5GAGc 3S14L 1C09A 2WB1P 3LWPB 2PVEA 1R0HA 2XJVA 1B13A 3HJWB 5RXNA 1LKPA 5AI3A 5DM61 5MF6A 5IYCL 3PIP1 4X6AL 1R9TL 2ERJA 2VL6A 4QIWP 2RFKB 3I4ML 4BY7L 3HOUL 3HOXL 2V0EA 5IYDL 5AN9H 1R0IA 2B63L 1QCVA 5IY0A 1Z92B 5M5WL 3H3VM 2M4VA 1IROA 1R0FA 1SMWA 4C3JL 3J7Y1 5MLC3 3M4OL 1RYQA 3VPBE 3MPSA 2R93L 2R92L 1Y1VL 2M6PA 4A3ML 1T9QA 6RXNA 4XGHA 2MS3A 4G6BA 5FLML 2KKDA 7RXNA 3S15L 2QL0A 4UY81 5IP7L 2CR8A 3P8BA 5M3ML 5MFPA 4ZN1B 3GTGL 4WFN1 3RZOL 4C3HL 5MFZA 2A6HD 1TWCL 3GTML 1IRNA 5EINC 1IW7D 3H0GL 1B2JA 4RXNA 2KN9A 2XJTA 1I3QL 1BFYA 1DX8A 3WWLA 3H9BA 3HJYB
chains in the Genus database with same CATH topology
2Z3RB 2J9UB 2PPTA 5GAHc 1R0HA 4E6YA 2BE5D 1OWBA 2A69D 2O5JD 1H7VA 2XJVA 1B13A 5RXNA 1LKPA 4JAEA 5AI3A 4TPUA 5DM61 1RYTA 5MF6A 2B5ID 1BRFA 3LPEB 4POFA 1NXEA 4AHXA 2L0ZA 5H1Sc 4POGA 3PIP1 1S30A 2XJPA 3QVDA 4B8CD 4ZN3B 1ZRPA 5JVH1 2ERJA 2JI2A 2VL6A 3K35A 1LKMA 1S2ZA 2M6OA 4AR4A 5MGNA 4AHWA 2V0EA 1ODHA 2C6AA 1FHHA 4JADA 1E8JA 5AN9H 1WJVA 1YV1A 1R0IA 1YK5A 2V0FA 3KYYA 1T9PA 1QCVA 4ME3A 3NFPI 2RDVA 2GMGA 1R0JA 3SS2A 5IY0A 2PSMC 1RWDA 2C6BA 4AHYA 1VCXA 3LNLA 1Z92B 1FHMA 4AI2A 4YWLA 3KYVA 2M4VA 1IROA 3B0AB 4YWMA 1T9OA 1R0FA 4V196 1SMWA 2ZIXA 4AR3A 1YK4A 3P2AA 1IU5A 2H12A 3WWNB 4XXBB 3IU3I 5MLC3 3J7Y1 3RZTA 1S24A 1SMMA 2ERSA 2HR5A 1NXGA 1LKOA 1QYBA 3A44A 1SMUA 4AI1A 1RYQA 3RYGA 3VPBE 5DM71 1LTLA 3MPSA 1DVBA 5GAEc 1RB9A 2LCQA 3MSUA 3PKJA 1YUXA 5GADc 5EIOC 3PIO1 2M6PA 1R0GA 2CKCA 3KYUA 1B2OA 1VZHA 1JYBA 1OWCA 1RDVA 1T9QA 6RXNA 4XGHA 4AR6A 2MS3A 1YUZA 1IU6A 4G6BA 2JI1A 5AI2A 2KKDA 3PZAA 2Z3QB 7RXNA 1CAAA 2QL0A 4TVMA 4UY81 2CR8A 3P8BA 2XJQA 5JVG1 1BQ8A 2PYAA 4JAGA 5MFPA 4U671 2V3BB 3RZ6A 4ZN1B 2PVXA 3KYWA 4WFN1 2XJUA 1NNQA 3PWFA 5MFZA 1BE7A 3ZG6A 2XJRA 1VZGA 2A6HD 2XJSA 1IRNA 1B71A 5EINC 2A6ED 4GS7D 3B08B 2K2DA 4AR5A 1IW7D 4AHZA 1BQ9A 2AYJA 2A68D 1RDGA 4LHNA 4AI0A 1B2JA 3PKIA 4AI3A 4RXNA 2KN9A 2XJTA 2NYDA 4LHLA 1BFYA 4K9FA 2CKAA 2DSXA 1CADA 2JI3A 3J7Z1 3QQCE 1DX8A 3WWLA 5GAGc 4JAFA 1VZIA 3KYXA 5K2ME 2M4YA 1C09A 2PVEA 8RXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6P A;  2M4V A;  2M6O A; 
#chains in the Genus database with same CATH topology
 2JA6 L;  3HKZ P;  3RZD L;  1BRF A;  2L0Z A;  1TWA L;  1S30 A;  1ZRP A;  5JVH 1;  2JI2 A;  3K35 A;  3K7A L;  2M6O A;  3S1R L;  3H9C A;  1ODH A;  3S17 L;  5M5X L;  1WJV A;  1SFO L;  1YK5 A;  1PFY A;  2HVY C;  1T9P A;  3SS2 A;  2Y0S P;  1RWD A;  5M3F L;  2C6B A;  4AHY A;  1VCX A;  1FHM A;  1K83 L;  3KYV A;  4YWM A;  2NVQ L;  4AR3 A;  3WWN B;  1S24 A;  2HR5 A;  1NXG A;  2JA8 L;  3RYG A;  1LTL A;  1PFU A;  1RB9 A;  2LCQ A;  5EIO C;  5IP9 L;  4BBR L;  2CKC A;  1PFV A;  1JYB A;  1Y1W L;  4AR6 A;  3LWQ B;  5AI2 A;  3GTP L;  3PO2 L;  4A3F L;  4A3G L;  3S1Q L;  4JAG A;  4U67 1;  4Y52 L;  2V3B B;  3RZ6 A;  2XJU A;  3PWF A;  3ZG6 A;  2XJR A;  2XJS A;  3LWV B;  4GS7 D;  3B08 B;  2APO B;  4AHZ A;  1BQ9 A;  2AYJ A;  3PKI A;  2NYD A;  2CKA A;  2DSX A;  3J7Z 1;  3GTQ L;  3QQC E;  3FDJ A;  3GTK L;  3I4N L;  4JAF A;  3KYX A;  5K2M E;  2M4Y A;  1OWB A;  2A69 D;  1RYT A;  2B5I D;  3LPE B;  4POF A;  1NXE A;  3H97 A;  2NVT L;  5H1S c;  4POG A;  1LKM A;  4AR4 A;  3S1N L;  5MGN A;  4AHW A;  3HOZ L;  1E8J A;  3PO3 L;  1YV1 A;  2V0F A;  3KYY A;  4ME3 A;  3S2H L;  2RDV A;  2GMG A;  1R0J A;  2PSM C;  4AI2 A;  1TWG L;  3S16 L;  3LWO B;  3P2A A;  3IU3 I;  1SMM A;  3JR7 A;  1LKO A;  1PZX A;  1SMU A;  4AI1 A;  4C2M 1;  1TWH L;  3MSU A;  3PKJ A;  1YUX A;  5GAD c;  4A3K L;  3PIO 1;  3KYU A;  4A3B L;  3CQZ L;  2NVY L;  1B2O A;  1VZH A;  2JA7 L;  4A3J L;  2YU9 L;  1I50 L;  3HOY L;  3PZA A;  3HOV L;  2XJQ A;  1BQ8 A;  2VUM L;  2PVX A;  3KYW A;  5C4J L;  1NNQ A;  4A3L L;  3GTL L;  1BE7 A;  2A6E D;  5IYB L;  4BY1 L;  2K2D A;  4AR5 A;  2A68 D;  3PL5 A;  1RDG A;  4AI3 A;  1PFW A;  3M3Y L;  4K9F A;  4BXX L;  5FJ8 L;  1VZI A;  4A93 L;  3S1M L;  8RXN A;  2Z3R B;  3FKI L;  2J9U B;  2PPT A;  5GAH c;  3MQK B;  4E6Y A;  2BE5 D;  2O5J D;  1H7V A;  4A3I L;  4A3D L;  2JA5 L;  4JAE A;  4TPU A;  4AHX A;  4A3E L;  2XJP A;  3QVD A;  4B8C D;  4ZN3 B;  3H99 A;  1P7P A;  1S2Z A;  3LWR B;  2AQC A;  1FHH A;  2C6A A;  4JAD A;  1TWF L;  3HAX C;  4C3I L;  3NFP I;  2R7Z L;  3S2D L;  2WAQ P;  3LNL A;  4BBS L;  4YWL A;  2E2I L;  1I6H L;  3B0A B;  1T9O A;  4V19 6;  4Y7N L;  2ZIX A;  1YK4 A;  1IU5 A;  1WCM L;  2H12 A;  4XXB B;  4AYB P;  3RZT A;  2ERS A;  1QYB A;  3A44 A;  5M5Y L;  5DM7 1;  1DVB A;  5GAE c;  1R0G A;  1F4L A;  1OWC A;  1RDV A;  3GTJ L;  1YUZ A;  1IU6 A;  2JI1 A;  2Z3Q B;  1CAA A;  4TVM A;  5JVG 1;  2E2J L;  2PYA A;  4A3C L;  2E2H L;  2NVX L;  2PMZ P;  1VZG A;  5C4X L;  5C3E L;  1B71 A;  3HOW L;  1QQT A;  2EY4 E;  4LHN A;  4AI0 A;  3GTO L;  4LHL A;  5C44 L;  1CAD A;  2JI3 A;  2AUS B;  5GAG c;  3S14 L;  1C09 A;  2WB1 P;  3LWP B;  2PVE A;  1R0H A;  2XJV A;  1B13 A;  3HJW B;  5RXN A;  1LKP A;  5AI3 A;  5DM6 1;  5MF6 A;  5IYC L;  3PIP 1;  4X6A L;  1R9T L;  2ERJ A;  2VL6 A;  4QIW P;  2RFK B;  3I4M L;  4BY7 L;  3HOU L;  3HOX L;  2V0E A;  5IYD L;  5AN9 H;  1R0I A;  2B63 L;  1QCV A;  5IY0 A;  1Z92 B;  5M5W L;  3H3V M;  2M4V A;  1IRO A;  1R0F A;  1SMW A;  4C3J L;  3J7Y 1;  5MLC 3;  3M4O L;  1RYQ A;  3VPB E;  3MPS A;  2R93 L;  2R92 L;  1Y1V L;  2M6P A;  4A3M L;  1T9Q A;  6RXN A;  4XGH A;  2MS3 A;  4G6B A;  5FLM L;  2KKD A;  7RXN A;  3S15 L;  2QL0 A;  4UY8 1;  5IP7 L;  2CR8 A;  3P8B A;  5M3M L;  5MFP A;  4ZN1 B;  3GTG L;  4WFN 1;  3RZO L;  4C3H L;  5MFZ A;  2A6H D;  1TWC L;  3GTM L;  1IRN A;  5EIN C;  1IW7 D;  3H0G L;  1B2J A;  4RXN A;  2KN9 A;  2XJT A;  1I3Q L;  1BFY A;  1DX8 A;  3WWL A;  3H9B A;  3HJY B; 
#chains in the Genus database with same CATH homology
 2Z3R B;  2J9U B;  2PPT A;  5GAH c;  1R0H A;  4E6Y A;  2BE5 D;  1OWB A;  2A69 D;  2O5J D;  1H7V A;  2XJV A;  1B13 A;  5RXN A;  1LKP A;  4JAE A;  5AI3 A;  4TPU A;  5DM6 1;  1RYT A;  5MF6 A;  2B5I D;  1BRF A;  3LPE B;  4POF A;  1NXE A;  4AHX A;  2L0Z A;  5H1S c;  4POG A;  3PIP 1;  1S30 A;  2XJP A;  3QVD A;  4B8C D;  4ZN3 B;  1ZRP A;  5JVH 1;  2ERJ A;  2JI2 A;  2VL6 A;  3K35 A;  1LKM A;  1S2Z A;  2M6O A;  4AR4 A;  5MGN A;  4AHW A;  2V0E A;  1ODH A;  2C6A A;  1FHH A;  4JAD A;  1E8J A;  5AN9 H;  1WJV A;  1YV1 A;  1R0I A;  1YK5 A;  2V0F A;  3KYY A;  1T9P A;  1QCV A;  4ME3 A;  3NFP I;  2RDV A;  2GMG A;  1R0J A;  3SS2 A;  5IY0 A;  2PSM C;  1RWD A;  2C6B A;  4AHY A;  1VCX A;  3LNL A;  1Z92 B;  1FHM A;  4AI2 A;  4YWL A;  3KYV A;  2M4V A;  1IRO A;  3B0A B;  4YWM A;  1T9O A;  1R0F A;  4V19 6;  1SMW A;  2ZIX A;  4AR3 A;  1YK4 A;  3P2A A;  1IU5 A;  2H12 A;  3WWN B;  4XXB B;  3IU3 I;  5MLC 3;  3J7Y 1;  3RZT A;  1S24 A;  1SMM A;  2ERS A;  2HR5 A;  1NXG A;  1LKO A;  1QYB A;  3A44 A;  1SMU A;  4AI1 A;  1RYQ A;  3RYG A;  3VPB E;  5DM7 1;  1LTL A;  3MPS A;  1DVB A;  5GAE c;  1RB9 A;  2LCQ A;  3MSU A;  3PKJ A;  1YUX A;  5GAD c;  5EIO C;  3PIO 1;  2M6P A;  1R0G A;  2CKC A;  3KYU A;  1B2O A;  1VZH A;  1JYB A;  1OWC A;  1RDV A;  1T9Q A;  6RXN A;  4XGH A;  4AR6 A;  2MS3 A;  1YUZ A;  1IU6 A;  4G6B A;  2JI1 A;  5AI2 A;  2KKD A;  3PZA A;  2Z3Q B;  7RXN A;  1CAA A;  2QL0 A;  4TVM A;  4UY8 1;  2CR8 A;  3P8B A;  2XJQ A;  5JVG 1;  1BQ8 A;  2PYA A;  4JAG A;  5MFP A;  4U67 1;  2V3B B;  3RZ6 A;  4ZN1 B;  2PVX A;  3KYW A;  4WFN 1;  2XJU A;  1NNQ A;  3PWF A;  5MFZ A;  1BE7 A;  3ZG6 A;  2XJR A;  1VZG A;  2A6H D;  2XJS A;  1IRN A;  1B71 A;  5EIN C;  2A6E D;  4GS7 D;  3B08 B;  2K2D A;  4AR5 A;  1IW7 D;  4AHZ A;  1BQ9 A;  2AYJ A;  2A68 D;  1RDG A;  4LHN A;  4AI0 A;  1B2J A;  3PKI A;  4AI3 A;  4RXN A;  2KN9 A;  2XJT A;  2NYD A;  4LHL A;  1BFY A;  4K9F A;  2CKA A;  2DSX A;  1CAD A;  2JI3 A;  3J7Z 1;  3QQC E;  1DX8 A;  3WWL A;  5GAG c;  4JAF A;  1VZI A;  3KYX A;  5K2M E;  2M4Y A;  1C09 A;  2PVE A;  8RXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...