2M6PA

The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
PRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Mb2076
publication title The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase.
pubmed doi rcsb
source organism Mycobacterium bovis
molecule tags Transcription
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.270 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2m6pA00
2M6PA 2M6OA 2M4VA
chains in the Genus database with same CATH superfamily
5DM61 1OWBA 4ME3A 5MF6A 3M3YL 5IYCL 4A3GL 3K35A 1T9OA 3GTQL 1S30A 2NVTL 2R92L 3ZG6A 2VL6A 1TWFL 3KYXA 2E2JL 1YUXA 2Z3RB 1LKMA 2XJQA 4C3HL 2PVXA 4A3JL 4A3IL 2R7ZL 1S24A 4AHZA 3GTLL 3LPEB 5AI2A 3PZAA 4YWMA 3RZDL 1WCML 1R0HA 2RFKB 2QL0A 4ZN3B 4A3ML 5C3EL 1LKPA 3GTKL 4A3KL 1Y1VL 2GMGA 4U671 2EY4E 4BXXL 4AR4A 1CADA 4RXNA 4AYBP 3B08B 4Y52L 2MS3A 3FKIL 3I4ML 5DM71 4GS7D 1VCXA 3KYWA 2L0ZA 4AI2A 4A93L 3S14L 1LKOA 2WAQP 2XJSA 4TVMA 3HJWB 5EINC 3I4NL 5RXNA 1VZHA 2NVYL 3M4OL 3H97A 5C4JL 3WWNB 3VPBE 5JVG1 2ZIXA 2LCQA 5JVH1 1R0FA 1H7VA 3LWQB 3LWOB 4POFA 1FHMA 1SFOL 2V0FA 1R0JA 2O5JD 3J7Y1 1IROA 3FDJA 3S17L 4AHYA 2KKDA 5MFPA 4LHLA 5M5XL 5GADc 3S1ML 4AI1A 1OWCA 2AQCA 2ERSA 2CR8A 1R9TL 4XGHA 5AN9H 3QVDA 5M3ML 1SMWA 1R0IA 5IYDL 3PO3L 2CKAA 3LWPB 5C44L 3JR7A 1JYBA 1E8JA 1BQ9A 2K2DA 1Z92B 3H3VM 1TWAL 4QIWP 2JA7L 1PFWA 1VZIA 3S2DL 3H0GL 3HAXC 4LHNA 1WJVA 4C3JL 5GAHc 1ZRPA 4AR5A 3HOWL 1YUZA 1IU6A 3H9CA 4A3FL 4AHWA 2NYDA 4G6BA 1IRNA 3NFPI 6RXNA 3LNLA 4V196 1QCVA 3PO2L 2RDVA 2PMZP 3MSUA 3KYVA 3PKIA 4AHXA 1CAAA 5GAGc 5FJ8L 4A3DL 1Y1WL 2Y0SP 4K9FA 1TWHL 2R93L 1BE7A 2H12A 1IW7D 2WB1P 2XJRA 1B71A 3A44A 3GTML 4BBSL 3SS2A 5K2ME 1BFYA 1BRFA 3HJYB 2JI2A 3P2AA 2CKCA 1K83L 3HOZL 3GTOL 3S2HL 4A3CL 1RWDA 3H9BA 5IYBL 1F4LA 2PVEA 3GTPL 1I6HL 4AR3A 5FLML 3S1RL 4X6AL 2XJPA 3PWFA 1R0GA 1C09A 2JA8L 1SMUA 4BY7L 2HVYC 3RZ6A 4AI0A 2C6BA 2PYAA 3PKJA 2B63L 4AR6A 4XXBB 4YWLA 3KYUA 3GTGL 5C4XL 3LWRB 3S15L 1DX8A 2AYJA 2Z3QB 1QYBA 3HOYL 1B2JA 2XJUA 1VZGA 4E6YA 3HOUL 1RYQA 4BBRL 1NXEA 2V0EA 3KYYA 4Y7NL 1RYTA 4TPUA 4AI3A 2DSXA 4UY81 3K7AL 3HKZP 3WWLA 2XJTA 4WFN1 2C6AA 1PFUA 4C3IL 4ZN1B 1TWGL 2YU9L 2JI1A 1DVBA 1RDVA 1S2ZA 3B0AB 3J7Z1 1B13A 3QQCE 3HOXL 2M4YA 1BQ8A 1I50L 1T9PA 2JI3A 5H1Sc 4BY1L 7RXNA 1NNQA 1QQTA 1PZXA 5MFZA 1T9QA 1FHHA 3RZOL 5IP9L 4A3BL 1IU5A 2A68D 2JA5L 5IP7L 1YK5A 2J9UB 1YK4A 2APOB 3PL5A 5AI3A 5GAEc 3CQZL 3LWVB 3RYGA 3HOVL 2A6HD 2XJVA 4POGA 3S16L 1NXGA 2E2IL 2PPTA 3GTJL 3PIP1 5M5WL 1ODHA 2ERJA 3P8BA 1B2OA 4A3EL 5IY0A 1TWCL 2NVQL 2A6ED 2V3BB 5MLC3 3H99A 2M6PA 4JAGA 2KN9A 1RB9A 1RDGA 1P7PA 1YV1A 5EIOC 2B5ID 2NVXL 8RXNA 1PFVA 3MQKB 2HR5A 1PFYA 2JA6L 2BE5D 3MPSA 2PSMC 4JAFA 4JAEA 3IU3I 2M6OA 5M5YL 4JADA 3S1QL 1LTLA 1SMMA 4B8CD 5M3FL 5MGNA 3S1NL 3PIO1 2A69D 2E2HL 1I3QL 3RZTA 4C2M1 4A3LL 2VUML 2AUSB 2M4VA
chains in the Genus database with same CATH topology
5DM61 1OWBA 4AI1A 2CKCA 4ME3A 5MF6A 1OWCA 3K35A 5MFZA 1T9QA 1T9OA 1FHHA 1S30A 2ERSA 2CR8A 4XGHA 1IU5A 5AN9H 3ZG6A 1RWDA 3QVDA 2VL6A 2PVEA 1SMWA 2A68D 1R0IA 4AR3A 3KYXA 1YUXA 2XJPA 2Z3RB 1LKMA 2CKAA 3PWFA 1R0GA 1C09A 1YK5A 2XJQA 2J9UB 1SMUA 1YK4A 1JYBA 2PVXA 1BQ9A 1E8JA 3RZ6A 4AI0A 2C6BA 2PYAA 3PKJA 5AI3A 5GAEc 1S24A 2K2DA 4AR6A 4XXBB 1Z92B 3KYUA 4YWLA 3LPEB 3RYGA 5AI2A 4AHZA 3PZAA 2A6HD 4YWMA 1R0HA 2XJVA 4POGA 1NXGA 2QL0A 2PPTA 1DX8A 2AYJA 2Z3QB 4ZN3B 1QYBA 3PIP1 5GADc 1B2JA 2XJUA 1VZIA 1VZGA 1LKPA 1ODHA 2ERJA 4E6YA 4LHNA 2GMGA 1WJVA 3P8BA 4U671 1B2OA 1ZRPA 4AR5A 5GAHc 1RYQA 5IY0A 1YUZA 1IU6A 4AR4A 2A6ED 1NXEA 4AHWA 2V0EA 2V3BB 1CADA 3KYYA 2NYDA 1RYTA 4RXNA 5MLC3 3B08B 4TPUA 4AI3A 4G6BA 2M6PA 4JAGA 2DSXA 1IRNA 2MS3A 3NFPI 4UY81 2KN9A 5DM71 4GS7D 1RB9A 3WWLA 3LNLA 1VCXA 6RXNA 2XJTA 4V196 4WFN1 2C6AA 1QCVA 2RDVA 3KYWA 3MSUA 1RDGA 2L0ZA 3KYVA 4AI2A 1YV1A 4ZN1B 1LKOA 5EIOC 2B5ID 3PKIA 4AHXA 8RXNA 1CAAA 2XJSA 4TVMA 5GAGc 5EINC 2JI1A 2HR5A 5RXNA 1VZHA 4K9FA 1DVBA 1RDVA 1S2ZA 3B0AB 2BE5D 3J7Z1 3WWNB 3MPSA 1BE7A 2PSMC 2ZIXA 1B13A 4JAFA 3VPBE 5JVG1 2H12A 4JAEA 2LCQA 3IU3I 2M6OA 3QQCE 1R0FA 5JVH1 4JADA 1IW7D 1H7VA 2XJRA 1LTLA 1SMMA 1B71A 2M4YA 1BQ8A 4B8CD 1FHMA 4POFA 1T9PA 5MGNA 2JI3A 5H1Sc 2V0FA 3A44A 1R0JA 3PIO1 2A69D 3SS2A 2O5JD 3J7Y1 3RZTA 1IROA 4AHYA 5K2ME 2KKDA 1BFYA 7RXNA 1BRFA 5MFPA 4LHLA 2M4VA 2JI2A 1NNQA 3P2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6P A;  2M6O A;  2M4V A; 
#chains in the Genus database with same CATH topology
 5DM6 1;  1OWB A;  4ME3 A;  5MF6 A;  3M3Y L;  5IYC L;  4A3G L;  3K35 A;  1T9O A;  3GTQ L;  1S30 A;  2NVT L;  2R92 L;  3ZG6 A;  2VL6 A;  1TWF L;  3KYX A;  2E2J L;  1YUX A;  2Z3R B;  1LKM A;  2XJQ A;  4C3H L;  2PVX A;  4A3J L;  4A3I L;  2R7Z L;  1S24 A;  4AHZ A;  3GTL L;  3LPE B;  5AI2 A;  3PZA A;  4YWM A;  3RZD L;  1WCM L;  1R0H A;  2RFK B;  2QL0 A;  4ZN3 B;  4A3M L;  5C3E L;  1LKP A;  3GTK L;  4A3K L;  1Y1V L;  2GMG A;  4U67 1;  2EY4 E;  4BXX L;  4AR4 A;  1CAD A;  4RXN A;  4AYB P;  3B08 B;  4Y52 L;  2MS3 A;  3FKI L;  3I4M L;  5DM7 1;  4GS7 D;  1VCX A;  3KYW A;  2L0Z A;  4AI2 A;  4A93 L;  3S14 L;  1LKO A;  2WAQ P;  2XJS A;  4TVM A;  3HJW B;  5EIN C;  3I4N L;  5RXN A;  1VZH A;  2NVY L;  3M4O L;  3H97 A;  5C4J L;  3WWN B;  3VPB E;  5JVG 1;  2ZIX A;  2LCQ A;  5JVH 1;  1R0F A;  1H7V A;  3LWQ B;  3LWO B;  4POF A;  1FHM A;  1SFO L;  2V0F A;  1R0J A;  2O5J D;  3J7Y 1;  1IRO A;  3FDJ A;  3S17 L;  4AHY A;  2KKD A;  5MFP A;  4LHL A;  5M5X L;  5GAD c;  3S1M L;  4AI1 A;  1OWC A;  2AQC A;  2ERS A;  2CR8 A;  1R9T L;  4XGH A;  5AN9 H;  3QVD A;  5M3M L;  1SMW A;  1R0I A;  5IYD L;  3PO3 L;  2CKA A;  3LWP B;  5C44 L;  3JR7 A;  1JYB A;  1E8J A;  1BQ9 A;  2K2D A;  1Z92 B;  3H3V M;  1TWA L;  4QIW P;  2JA7 L;  1PFW A;  1VZI A;  3S2D L;  3H0G L;  3HAX C;  4LHN A;  1WJV A;  4C3J L;  5GAH c;  1ZRP A;  4AR5 A;  3HOW L;  1YUZ A;  1IU6 A;  3H9C A;  4A3F L;  4AHW A;  2NYD A;  4G6B A;  1IRN A;  3NFP I;  6RXN A;  3LNL A;  4V19 6;  1QCV A;  3PO2 L;  2RDV A;  2PMZ P;  3MSU A;  3KYV A;  3PKI A;  4AHX A;  1CAA A;  5GAG c;  5FJ8 L;  4A3D L;  1Y1W L;  2Y0S P;  4K9F A;  1TWH L;  2R93 L;  1BE7 A;  2H12 A;  1IW7 D;  2WB1 P;  2XJR A;  1B71 A;  3A44 A;  3GTM L;  4BBS L;  3SS2 A;  5K2M E;  1BFY A;  1BRF A;  3HJY B;  2JI2 A;  3P2A A;  2CKC A;  1K83 L;  3HOZ L;  3GTO L;  3S2H L;  4A3C L;  1RWD A;  3H9B A;  5IYB L;  1F4L A;  2PVE A;  3GTP L;  1I6H L;  4AR3 A;  5FLM L;  3S1R L;  4X6A L;  2XJP A;  3PWF A;  1R0G A;  1C09 A;  2JA8 L;  1SMU A;  4BY7 L;  2HVY C;  3RZ6 A;  4AI0 A;  2C6B A;  2PYA A;  3PKJ A;  2B63 L;  4AR6 A;  4XXB B;  4YWL A;  3KYU A;  3GTG L;  5C4X L;  3LWR B;  3S15 L;  1DX8 A;  2AYJ A;  2Z3Q B;  1QYB A;  3HOY L;  1B2J A;  2XJU A;  1VZG A;  4E6Y A;  3HOU L;  1RYQ A;  4BBR L;  1NXE A;  2V0E A;  3KYY A;  4Y7N L;  1RYT A;  4TPU A;  4AI3 A;  2DSX A;  4UY8 1;  3K7A L;  3HKZ P;  3WWL A;  2XJT A;  4WFN 1;  2C6A A;  1PFU A;  4C3I L;  4ZN1 B;  1TWG L;  2YU9 L;  2JI1 A;  1DVB A;  1RDV A;  1S2Z A;  3B0A B;  3J7Z 1;  1B13 A;  3QQC E;  3HOX L;  2M4Y A;  1BQ8 A;  1I50 L;  1T9P A;  2JI3 A;  5H1S c;  4BY1 L;  7RXN A;  1NNQ A;  1QQT A;  1PZX A;  5MFZ A;  1T9Q A;  1FHH A;  3RZO L;  5IP9 L;  4A3B L;  1IU5 A;  2A68 D;  2JA5 L;  5IP7 L;  1YK5 A;  2J9U B;  1YK4 A;  2APO B;  3PL5 A;  5AI3 A;  5GAE c;  3CQZ L;  3LWV B;  3RYG A;  3HOV L;  2A6H D;  2XJV A;  4POG A;  3S16 L;  1NXG A;  2E2I L;  2PPT A;  3GTJ L;  3PIP 1;  5M5W L;  1ODH A;  2ERJ A;  3P8B A;  1B2O A;  4A3E L;  5IY0 A;  1TWC L;  2NVQ L;  2A6E D;  2V3B B;  5MLC 3;  3H99 A;  2M6P A;  4JAG A;  2KN9 A;  1RB9 A;  1RDG A;  1P7P A;  1YV1 A;  5EIO C;  2B5I D;  2NVX L;  8RXN A;  1PFV A;  3MQK B;  2HR5 A;  1PFY A;  2JA6 L;  2BE5 D;  3MPS A;  2PSM C;  4JAF A;  4JAE A;  3IU3 I;  2M6O A;  5M5Y L;  4JAD A;  3S1Q L;  1LTL A;  1SMM A;  4B8C D;  5M3F L;  5MGN A;  3S1N L;  3PIO 1;  2A69 D;  2E2H L;  1I3Q L;  3RZT A;  4C2M 1;  4A3L L;  2VUM L;  2AUS B;  2M4V A; 
#chains in the Genus database with same CATH homology
 5DM6 1;  1OWB A;  4AI1 A;  2CKC A;  4ME3 A;  5MF6 A;  1OWC A;  3K35 A;  5MFZ A;  1T9Q A;  1T9O A;  1FHH A;  1S30 A;  2ERS A;  2CR8 A;  4XGH A;  1IU5 A;  5AN9 H;  3ZG6 A;  1RWD A;  3QVD A;  2VL6 A;  2PVE A;  1SMW A;  2A68 D;  1R0I A;  4AR3 A;  3KYX A;  1YUX A;  2XJP A;  2Z3R B;  1LKM A;  2CKA A;  3PWF A;  1R0G A;  1C09 A;  1YK5 A;  2XJQ A;  2J9U B;  1SMU A;  1YK4 A;  1JYB A;  2PVX A;  1BQ9 A;  1E8J A;  3RZ6 A;  4AI0 A;  2C6B A;  2PYA A;  3PKJ A;  5AI3 A;  5GAE c;  1S24 A;  2K2D A;  4AR6 A;  4XXB B;  1Z92 B;  3KYU A;  4YWL A;  3LPE B;  3RYG A;  5AI2 A;  4AHZ A;  3PZA A;  2A6H D;  4YWM A;  1R0H A;  2XJV A;  4POG A;  1NXG A;  2QL0 A;  2PPT A;  1DX8 A;  2AYJ A;  2Z3Q B;  4ZN3 B;  1QYB A;  3PIP 1;  5GAD c;  1B2J A;  2XJU A;  1VZI A;  1VZG A;  1LKP A;  1ODH A;  2ERJ A;  4E6Y A;  4LHN A;  2GMG A;  1WJV A;  3P8B A;  4U67 1;  1B2O A;  1ZRP A;  4AR5 A;  5GAH c;  1RYQ A;  5IY0 A;  1YUZ A;  1IU6 A;  4AR4 A;  2A6E D;  1NXE A;  4AHW A;  2V0E A;  2V3B B;  1CAD A;  3KYY A;  2NYD A;  1RYT A;  4RXN A;  5MLC 3;  3B08 B;  4TPU A;  4AI3 A;  4G6B A;  2M6P A;  4JAG A;  2DSX A;  1IRN A;  2MS3 A;  3NFP I;  4UY8 1;  2KN9 A;  5DM7 1;  4GS7 D;  1RB9 A;  3WWL A;  3LNL A;  1VCX A;  6RXN A;  2XJT A;  4V19 6;  4WFN 1;  2C6A A;  1QCV A;  2RDV A;  3KYW A;  3MSU A;  1RDG A;  2L0Z A;  3KYV A;  4AI2 A;  1YV1 A;  4ZN1 B;  1LKO A;  5EIO C;  2B5I D;  3PKI A;  4AHX A;  8RXN A;  1CAA A;  2XJS A;  4TVM A;  5GAG c;  5EIN C;  2JI1 A;  2HR5 A;  5RXN A;  1VZH A;  4K9F A;  1DVB A;  1RDV A;  1S2Z A;  3B0A B;  2BE5 D;  3J7Z 1;  3WWN B;  3MPS A;  1BE7 A;  2PSM C;  2ZIX A;  1B13 A;  4JAF A;  3VPB E;  5JVG 1;  2H12 A;  4JAE A;  2LCQ A;  3IU3 I;  2M6O A;  3QQC E;  1R0F A;  5JVH 1;  4JAD A;  1IW7 D;  1H7V A;  2XJR A;  1LTL A;  1SMM A;  1B71 A;  2M4Y A;  1BQ8 A;  4B8C D;  1FHM A;  4POF A;  1T9P A;  5MGN A;  2JI3 A;  5H1S c;  2V0F A;  3A44 A;  1R0J A;  3PIO 1;  2A69 D;  3SS2 A;  2O5J D;  3J7Y 1;  3RZT A;  1IRO A;  4AHY A;  5K2M E;  2KKD A;  1BFY A;  7RXN A;  1BRF A;  5MFP A;  4LHL A;  2M4V A;  2JI2 A;  1NNQ A;  3P2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...