2M6RA

Apo_yqca
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (1)H, (13)C and (15)N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Flavodoxin
total genus 46
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2m6rA00
2V5UA 1XYYA 2V9CA 3OWXA 2ARKA 3OJXA 3QE2A 4HEQA 5LJIA 2D5IA 3W79A 2Z9BA 1ZWKA 3F2VA 1AKVA 3GFRA 3GFQA 1XI2A 3HLYA 3O73A 1RTTA 1YOBA 3LT5A 2X2PA 3QFCA 1CZUA 1QRDA 1BVYF 2FAXA 2W5UA 3F90A 3FX2A 3G5MA 4GR9A 5F12A 2M6RA 3U7IA 4U7HA 3K20A 4YAUA 2QWXA 2QMYA 3KEGA 2BZSA 3W78A 3FNIA 2N1MA 4DIKA 4DILA 4D02A 1NNI1 1BU5A 2HPVA 4NLLA 4ZVMA 4Y9UA 1CZNA 3LCMA 4R81A 4PTYA 4OXXA 5LLDA 3FJOA 1RLJA 1F4PA 3W77A 3TZBA 5LVAA 3ESYA 4C0XA 3OX2A 2BN4A 2QMZA 1D03A 2Z98A 3NHKA 4YALA 3UXHA 2V5VA 2WC1A 4BMOB 3FW1A 4N9QA 2MT9A 4HS4A 4FGLA 2QR2A 4ZVLA 1XYVA 2FVXA 3NHRA 1FX1A 1QBGA 1CZLA 1DX9A 1FLVA 1X77A 4LTMA 4XDHA 4Y9RA 5LBTA 4YAOA 4CETA 2Z9CA 1KBOA 3F6SA 1B1CA 1QR2A 5LJLA 1FLDA 1J9GA 3ESXA 2QX9A 1H66A 1T5BA 1CZKA 1FLAA 2XODA 3NHSA 5LBUA 6NULA 1AHNA 1JA1A 4YAWA 4DY4A 1WSBA 3N3BC 2KLBA 1AKQA 2ZKIA 3B6IA 1AG9A 2B3DA 1VMEA 3NLLA 3UXEA 5A4KA 4F8YA 2OHJA 4QOJA 1SG0A 5F4BA 1H69A 2FZ5A 3GFSA 3HA2A 5FX2A 2MWMA 4J8PA 4GQIA 1OBOA 2XOEA 1YRHA 5LMCA 2FCRA 1CZOA 4S24A 1YDGA 2R96A 4XDGA 1FVXA 1OFVA 2A5LA 3OWHA 4FGJA 1AZLA 4BMPB 3SVLA 3S2YA 3FVWA 4LAFA 3B6KA 3NFRA 4ZVNA 3B6JA 2HNAA 2QX8A 3OVMA 3L9WA 3R6WA 4YQEA 4FGKA 1GG5A 2Z9DA 3B6MA 3NHJA 3NHYA 2BF4A 3P0RA 1AKTA 1RCFA 3NHWA 3O2NA 4Y7CA 1J8QA 2MOKA 3ES9A 4QOIA 1WSWA 4N65A 3KAQA 2FX2A 5NULA 5B3LA 5TGZA 5JROA 1C7FA 4GI5A 2BPOA 1YCHA 4ESEA 2HNBA 4M0CA 3QFRA 2GSWA 4U7GA 3JSXA 1J9ZA 1FTGA 1DXQA 5EAIA 4LTNA 4QOFA 1V4BA 2X2OA 3RPEA 4NULA 4YAFA 1ZX1A 2F1OA 3NHPA 1J9EA 1QHEA 2OHHA 3K1YA 3NHUA 1YCGA 3OJWA 4FX2A 3TE7A 4C14A 5B3KA 2FLVA 1AKUA 4PTZA 4CF6A 4U7FA 5ULLA 2KQUA 3D7NA 1FLNA 1YKGA 3EYWA 1AKWA 3KLBA 3F6RA 1AKRA 1D4AA 1T0IA 4N82A 5FA6A 2QX4A 3U7RA 4C76A 1AMOA 3N3AC 5FUQA 3HR4A 1ZWLA 1JA0A 2BMVA 2Q62A 2Q9UA 3N39C 2QX6A 3NHFA 4H6PA 1C7EA 4LTDA 5NLLA 2OHIA 1E5DA 3L9XA 5BUCA 3OX3A 4LA4A 1TLLA 4C0WA 3NHLA 4QOHA 3GAMA 3EDOA 3W7AA 1DXOA 2MTBA 3KAPA 4QOGA 5EA2A 1SQSA 4ZVKA 5EMNA 1D04A 2FZVA 1I1OA 1KBQA 2OYSA 2R97A 2M6SA 4QOEA 1TIKA 1CZHA 1XT6A 4QODA 2AMJA 1YCFA 2FDXA 4ICIA 4PU0A 3OX1A 3ZHOA 2RG1A 1FUEA 1RLIA 4H2DA 3TEMA 1CZRA 5F51A 1OBVA 3ESZA 2FOXA
chains in the Genus database with same CATH superfamily
1XGKA 4ZOEA 1IQRA 5IKXA 1YDHA 1KZ9A 5LD2C 3RAJA 3KYBA 4O1HA 3ZS9A 1XZQA 4DA9A 1FIUA 4AG3A 2BISA 1LA2A 1E92A 4M37A 1T5HX 3EOBI 2SKEA 2QVLA 4HMPA 4GR9A 3BRWA 4BASA 2TSYB 4IIBA 4CG2A 4BNUA 3IAUA 1E9SA 4X6XA 3QIAA 1E6KA 3DHYA 4JBNA 2X19A 1TA4A 2FSIA 3GT3A 4GMXA 5KREA 3U7EB 4QJ5A 4M86A 4TQ9A 4GMKA 4UQOA 1P3DA 1T5TA 2VFAA 3VJKA 1ZHFA 1QH8A 2B61A 3BPSA 3KOUA 5AW9A 4D8TA 5JAMA 4Y9DA 2Z83A 1RNLA 1UEJA 5DNAA 1R4AA 3VSDA 4A8JB 3Q6IA 4QRIA 2JBAA 5JNLA 4EUNA 3KNZA 4BJHB 2BI7A 4JOBA 1REQA 1NUTA 1Y4UA 2GFQA 2G4VA 3A0UA 3IVMA 3ADCA 3I9OA 2VP9A 3ME5A 5FOUA 2FSSA 1D2EA 3JWIA 2DFTA 3GZ4A 5HKLA 2F64A 3Q8XB 1Z82A 2C5HA 2O2ZA 1CQJB 2JH8A 3KQSA 1RBQA 2H00A 3CX6A 3M83A 5J4YA 3O8NA 3ZZNA 4P9NA 1QYVA 3VUEA 5FYQA 3GG2A 1X7ZB 1N2IA 2XCIA 4NCJA 4NZNA 5AI8A 2WJWA 1LI5A 3G79A 2P6PA 2QRMA 3MWJA 4FE4A 5D8DA 2GM9A 4B8YA 3DC7A 4DUGA 5HHTA 5L7YA 4HD8A 4D9IA 2IU3A 2PLWA 1S6YA 2VAMA 2IYOA 3COJA 2H7YA 3MWYW 1QRSA 4XIFA 1UK9A 2OTCA 1Q0TA 2V7WA 1ISSA 1GO2A 4GBMA 2RARA 3DYIA 4CW7A 1KI2A 5DNYB 1YE8A 2B30A 3MYRA 3WV5A 721PA 3WGNA 3RAEC 3RW9A 1Y1PA 3IS3A 2SBTA 4JJGA 3AM4A 1QQ5A 3JATB 3CISA 3KS9A 5EIOA 1UWVA 1XTPA 3OTWA 2HT6A 3WAGA 3QEBZ 1TM7E 2KHZA 3ORQA 4LFBB 3C3CA 4M0KA 4R16A 2MSWA 4P5DA 2R2GA 2XADA 4OQ4A 4X44A 2IWHA 2LV8A 1P75A 3KSDO 4HEHA 2QB5A 2VK4A 1NJ6A 5TS2A 3TMYA 4ZPJA 2QN7A 4LHWA 3S1AB 1IK6A 2XYHA 3F7TA 1ACMA 3AJAA 5GAJA 1GNQA 5IAJA 3UKDA 1BCSB 2XYPA 6Q21A 4HVTA 3AKCA 3ND6A 4DLUA 4GSLA 4L7QA 3KQMA 3DJFA 1MC8A 1ZIDA 2PVSA 4DBVO 5JPDA 3UN1A 1X74A 3REOA 1V9CA 1NVWQ 4QEDA 3G8CA 4IDGA 3SC2B 4C6SA 3ZZ1A 5I7UA 2D2VA 2QZ9A 1QVAA 5DU2A 3RUFA 1ILEA 1Z47A 3OUUA 2BT4A 4KXQA 4B6OA 5J4HA 1PFVA 1I2DA 3T4XA 5JAHA 3E3OA 5LQDA 4J9UE 5J2TA 1K5HA 1GQYA 3PENA 4MYCA 5BSTA 2NO1A 3ED5A 3M6UA 4YPOA 1WPQA 4YJKA 5ER9A 3NV7A 4BO0A 3KJEA 1MJGA 3HWSA 2IUUA 1IHXA 3L8GA 1R6TA 2ORED 4BQOA 2EKPA 1ZM9A 2W9XA 4YJFB 1Z9BA 4F6RA 1KS2A 1YI1A 3OCWA 3PNSA 5T8KC 3DZFA 1EHYA 1VDZA 3EAQA 3IBCA 3Q7TA 5DTRA 2FI1A 3GYBA 3WLFA 5C7OO 4N39A 1WULS 5KJFA 5MDHA 1L3BA 3OM9A 2CY0A 3FSGD 2G8LA 4AZ3B 5G02A 5GJCA 1J2JA 3ZDZB 3LU1A 3IKJA 3IE1A 2FZCA 2R48A 1JQKA 4OFWA 3WYBA 4V39A 1QIDA 2F8LA 3O7WA 2DKNA 5J2TB 3EVAA 4G5HA 4UXHA 4XEHA 1SUEA 2GBGA 3RYIA 1Y1QA 2XGJA 4EJSB 4F3CA 1IXRC 4HUQA 4J90A 1GKIA 2XUHA 3WY9A 4C0XA 3DC2A 3QLTA 4IL5A 3UHAA 2HIHA 1Y8QB 1W46A 1GUBA 3GH3A 2HZ7A 4NH4A 4PAQA 4DNPA 2Q3LA 1JIUA 3DOJA 1PL0A 4EA7A 3TB6A 3O93A 3RC2A 3SVLA 2XVZA 5LBIA 3C74A 4KBYA 4L27A 3SZGA 1N9GB 1Z33A 3R77A 2QX9A 2I1WA 2P90A 4ZVVA 4DPMA 3KKEA 1RW4A 5LQKA 4Y6QA 4DWOA 3RSZA 2Y6UA 3PUVA 4COKA 1NC3A 4X7MA 5ALTA 1KI8A 5JYEA 3I04A 1YSCA 4BGIA 3LECA 2Q3CA 3MXOA 5CXUA 3WK5A 1TKBA 4LV5B 4H1UA 4QDOA 2YYZA 1AQIA 4L73A 4RH0A 3OQMA 2QT1A 2ZRFA 4RQUA 3C1OA 5EJMA 2Z1DA 3IAEA 3PGKA 4P8RA 2MYNA 5CVTA 2E4YA 5JMPA 1KYWA 2O2JA 2C78A 4RL4A 4TSFA 1RVDA 4KGXA 5TVGA 4AZVA 3NM4A 2O8FA 1RAHA 1Y1RA 3PRYA 3AB3A 3EHDA 3OOEA 1N0WA 4S12A 3AEUA 4YJGA 3BXHA 3O5AA 1L7XA 4LRUA 1EWVA 2FETA 1IUPA 3Q5GA 4KFRA 2ZUUA 1MVOA 3B6MA 2I80A 4RWZA 4TZTA 4XVHA 3VO2A 1U31A 2AOTA 2IUEA 2JGMA 3ECSA 3O2NA 4IKPA 4IO1A 3FBGA 3UWPA 5EZ6B 5BQOA 4OOFA 3AX6A 1RSZA 3K9WA 4OG2A 5K0TA 4FKMA 1PL8A 4KDRA 1Z2PX 3QMMA 2VDRB 3NTVA 2OSVA 2UYCA 4L0DA 1Y3IA 1ANKA 2WUVA 3DDSA 3IMFA 4IOJA 4YAFA 4WXHA 4IQ8A 3GV0A 3ADKA 4INOA 4MROA 4Y98A 2VJBA 4DV5B 4ZYUA 4Q3BA 2R8BA 4X0EA 3UV3A 2YJ5A 1I7SB 2IEDA 1VGVA 2IDJA 5CD9A 2NG1A 3ETNA 4YFYA 1UWCA 5FWAA 5CEJA 1NVDA 1GCUA 2DPLA 2J85A 2PO5A 1O96B 2EIHA 1JHRA 3SJZA 3ISVA 4FDUA 3C7TA 3A1NA 3U4MA 2G1JA 3H0CA 4LBZA 1LC0A 4KRXA 4N54A 4OUKX 4QEKA 3R6LA 3R7SA 1P2VA 1F20A 2Z8XA 3OX3A 4B2YA 4TV9A 2CMKA 5CVCA 3PXAA 3WL6A 1NRJB 4MS4B 2HCFA 2Z1MA 2XB4A 3HYRA 5ARBA 2AIRA 1GYQA 4KO4S 3MERA 2OV6A 4BFXA 1W44A 2A5JA 2AX4A 2D0IA 2R97A 4I3FA 3DBLA 2WWVD 5ALWA 4PQYA 3OU6A 1Q21A 2HV8A 5CR9A 4RK6A 2GAIA 4B31A 1ZVJA 3DMHA 1WUIS 5PGMA 2VXCA 2YJZA 1M7BA 2GYUA 3CE6A 4IV0A 4DTIA 4WKGA 3P9NA 3KT0A 5P21A 4C2TA 2BFWA 1SCDA 2ANCA 5BMVB 5GM2A 1RC1A 2WHRA 2Y1OA 3UK7A 3EPLA 3RARA 1KJIA 1I24A 3AYZB 4JSRA 4ZAXA 2AMFA 4AJ4A 1T4BA 2Z58A 2ZPAA 1RJEA 1QWSA 2GYWA 2Y9MB 3FB4A 4J0DA 3RVKA 5I9NA 1OYVA 2OBXA 4Z0TA 2XXBA 3L4SO 4D98A 4JMLA 4NENB 3N1UA 5HGJA 2G08A 3HB1A 5CEFA 1ZMRA 4AT1A 1ORDA 2CV0A 3HADA 5KIAA 1KJZA 3H3XA 1M2NA 2OBMA 3GLIE 2I29A 3EEOA 1F4LA 4NYMQ 3QE0A 4UOQA 3RLIA 4ZDKA 3BCRA 2W2TA 1CB7A 4RE5A 2WLSA 2QGNA 3V7NA 3LXMA 1E1RA 1PEKE 2JK1A 4EG7A 4RTRA 2DJ5A 2Q9AA 2WRZA 4YV1A 2H0QA 4LYYA 1ZQ1A 1L4LA 4AK9A 1KJJA 3T3MB 4PCLA 4V3BA 2R8RA 5ALEA 1HORA 2HIMA 2EJCA 1JLLA 3L5OA 1I80A 2OE2A 2CD7A 3A06A 2Q28A 1ZZEA 4YRRA 3V1KA 4DM7A 4XE5A 3ROXA 1RCTE 3SX4A 3PHHA 3IQGX 3K92A 5JI3E 4ATNA 1QRTA 4ZEVA 1JFVA 2V74B 1W36D 2B8TA 3OEEA 1ZO8A 4MYRA 2LD4A 1DC5A 3H4IA 4XOIA 4AWAA 3QKTA 1G60A 5TQJA 4D4MA 3QPVA 4MO9A 1EVQA 4R9SA 2BZ1A 2W22A 3QVWA 1GQFA 4LZJA 4E51A 2PH1A 5LP6C 1L5YA 1ZM4A 2DUJA 2YV2A 4TMFA 2NTJA 3UICA 3WA6A 5HSGA 3W6ZA 3A6FA 1EWYA 2FDRA 2D5LA 3M5WA 1C9MA 4GI1A 3B1XA 1SU8A 1DEXA 3AERA 4R1TA 2OB2A 1Z7EA 4ND1A 5HKAA 1WSWA 2FEOA 3GEIA 4BS9A 1Q1BA 2FQXA 5C8YB 1UBOS 1KWKA 5E1OA 2E4ZA 4HX5A 2PFKA 3K73O 3ZGYA 2JAWA 3ZTWA 4BWGA 4RC9A 1K9SA 2AOXA 4GC9A 4CTOA 1VLMA 2VTDA 3PQ6A 1NNLA 1KZ7B 3GWGA 3Q7PA 1FFXA 3P9KA 1E3LA 4ZYYA 3D4OA 1KETA 2J33A 3ZHXA 8ADHA 4DV6B 2MR6A 1A9PA 3C6YA 4TT3A 5B7QA 5BY2A 3VYVA 1PR6A 1XZKA 2YZGA 3BERA 1AT1A 3ZNNA 2JLWA 1Z0IA 3EEFA 1L5NA 3BZWA 1GUAA 3TECE 2XKBA 3C7KA 4ETNA 1IY9A 1OLSB 4I1PA 1V4VA 1NKSA 1K06A 3FJ1A 5K09A 4WBSA 3QEAZ 4E5YA 1MDBA 4BNVA 2HSWA 2X4LA 5KSWB 1MAVA 3AV3A 1WB6A 5AK3A 4AKEA 1DKMA 1QUEA 2VLBA 2YV5A 4PAWA 4YACA 1T1SA 1ZH6A 3WLHA 4BNYA 2DYKA 4FZRA 5EWLA 4D92A 4HLQB 4QU9A 1GNSA 4YUYA 2FDCA 2V1UA 3KFLA 3V33A 2QRUA 3ND9A 4QYWA 1XJQA 2BE9A 3N2KB 4Q34A 5HIIA 3V8PA 3N7TA 1R88A 2B6HA 5FFMA 5E6RB 1IY2A 2X76A 3SEQA 1AM4D 1UFOA 5C34B 4G36A 4OFBA 1N4DA 2V9CA 1NLFA 2YNMD 4I19A 2J6BA 2L2QA 2LBPA 4YQYA 3SQMA 2ID4A 2X8JB 1JVNA 1RTTA 3IRUA 1QS0A 3LKVA 4YP7A 1KERA 1PWHA 2PD3A 4XPIB 2NVUB 1JFFB 3U44B 5LQMA 4ZCMA 1Z3CA 1PTJC 3QU7A 4F21A 1OH6A 1MEEA 1PNVA 2Y76A 1JFSA 2ECPA 4KQ1A 3WRYC 4BIIA 3V4VB 1YZQA 5EKSA 2H4HA 3EXHB 5KYYA 4PX2A 3WMFA 4EJMA 2IZ7A 2VAWA 1A8UA 3FZQA 1OBHA 3D4PA 4LJSA 1H05A 3EVCA 3CWCA 3FNGA 4XFKA 3PNPA 4MW6A 5E95A 4D80A 4ZHQA 1AO0A 1H2FA 1TRKA 2P2SA 5ADHA 3JWGA 3TINA 4N6GA 2ZBDA 2G40A 3FTQA 3IGFA 4V0LA 1XUOA 5LYJB 4G0OA 3HU3A 1U81A 5KYXB 3IKVA 2G0AA 1XMSA 3MT9A 4Q4DA 1JXOA 2VA8A 3OZTA 4WK0B 2XX3A 3JALA 5CP8A 5EQFA 4A27A 2A78A 2BDEA 1GRCA 3PK0A 4ZI7B 5BORA 5A4MS 1CEEA 3BD7A 3N0TA 3HH8A 3RCBA 1UZAA 1BXRA 3ESCA 5JO0A 2BE7A 2ECQA 3JQ9C 2C96A 2BGLA 2WIAA 2EQAA 3OQ1A 1I0IA 5AW3A 3AUKA 3RTBA 4KH1A 2WWHA 4F4DA 5CDGA 2QNBA 1A88A 3FMPB 1XU4A 4WXMA 2FX3A 3CR3C 4WKPA 4NF2A 5HJ7A 2JJ2D 2NO7A 4KCGA 3E9QA 3OZ7A 3DW3X 3M4ZA 2E1PA 2FW9A 2ONKA 4UM9B 2EQBA 2HFKA 2RBKA 5G41A 3FNFA 4DR7B 3DTTA 6ADHA 3G0CA 4M55A 1DCTA 3IT2A 1DDGA 4K9RA 3F97A 1H8HD 5AXAA 5KSOA 1JR4A 3GUCA 3GU3A 2A14A 4YJ3F 3Q8LA 3DM5A 4REMA 3PD0A 3TW0A 5E9WA 2DUMA 4L78A 2GHQA 5G0SA 5LC1A 4YQZA 5EOVA 4NCAA 1ETUA 2GRJA 2HU7A 2VNHA 3WNCA 5C3MA 1TVKA 3LCRA 3KFXA 3TIIA 1MJ5A 1UR5A 1F2UA 1TC1A 2R3SA 3A3OA 2BJVA 3QWAA 3KKQA 3P19A 4IUBS 4QJIA 2IY8A 3K96A 3CLVA 1GZ5A 4MA5A 2R1ZA 4YP0A 5SY4A 3TZLA 4OLFA 1QIFA 2RI0A 1DZIA 2H8KA 2V58A 4EY7A 1SCUB 2H2FA 2P11A 4BGDA 2EDAA 3O2QB 5FHQA 4B6EA 4CZ2A 2MJLA 1FSPA 5SV2A 1UXHA 4G56A 3P96A 1Z2NX 16PKA 3GRFA 5CFOA 1TJ5A 3RFCA 3MT7A 1OJLA 1K7YA 3VM6A 5LIPA 1ONPA 1YQQA 4MO2A 3G9TA 4D5EA 4N49A 4ZQHA 2V1XA 2W6OA 3MEQA 4FFSA 1TPYA 2HA2A 4OGGA 3X1XA 2MSDB 3SC3A 4QGAA 2ZE6A 3IAFA 3U5TA 2DTDA 2DTXA 1WQ1R 3GAMA 1T2EA 1NE7A 3E9EA 2NTEA 3G17A 1GU7A 2ICAA 4WN9A 3WMEA 5EMNA 3MYYA 1K5DA 3K0AA 4AX4A 1ZA2A 3KQTA 4QTYA 1PR9A 5LZ5A 3A1WA 1FDSA 3ZW9A 2W2VA 5BT9A 5KSPA 1ZNWA 4NOLA 2V98A 4LJ4A 1QK5A 1FNMA 4I5IA 1LQTA 3NIBA 3AWDA 3WR5A 5F5LA 4QU0A 4IJQA 3NBFA 4JELA 4MNTA 1NYRA 1TJPB 3VYUB 4CLRA 2Z9BA 2FHSA 3DZJA 4G1UC 5I9MA 3SAJA 3F78A 3LWBA 2DRIA 3D4NA 3QYPA 1TA9A 1QFXA 3KE8A 4F1KA 3WHKA 3PEWA 2FPPB 2H07A 1P8AA 5IAGA 2IEZA 4Y67A 2C4HA 3U9TA 3U44A 7MDHA 3I2GA 1K6IA 4FFWA 5FBZA 1CUGA 2YMPA 4QECA 4AP5A 1IXYA 4BV8A 5JSZB 1UPXA 1WMSA 2F9MA 3HCPA 4CLOB 4E30A 5ITZB 2XV1A 4PPNA 5CCBA 1SXPA 3SEFA 3NIFB 1E4VA 5KU7A 2JK0A 2V97A 4QGHA 1NQWA 3BGDA 4FR0A 4KR0A 3ILSA 4YO8A 4Z6KA 4NV1A 1QHIA 4CUZA 1QBGA 1RKQA 1CFZA 1DX9A 1RXIA 2J87A 1P29A 2JFVA 3DNMA 4LJYA 3WXBA 3DV2A 1RJ9B 1TZKA 3OEYA 3TZCA 2AXNA 2O3SA 3FCEA 4H0CA 1DBRA 1XTZA 3G8AA 1ZOPA 4JAVC 3UYLA 2QLTA 3K1ZA 3N5CA 5H8WA 2L69A 4BNNA 2CBZA 3A2MA 3CMMA 3RC1A 3PDCA 1RHKA 2PGOA 4HGNA 3SMQA 2QUIA 1R37A 5FOTA 3T5BA 3FDIA 4O2AB 1APBA 1P62B 1ZGAA 1USWA 2PWAA 4C4TA 1YKSA 4TROA 1BJRE 4HGRA 1LDGA 3DAFA 1YA6A 3OZFA 2Z08A 2P3OA 1W4RA 4BO2A 1LK7A 1PR1A 3H86A 3NHZA 4R69A 3LPLA 5CXXA 2C5EA 1DAIA 1ZGGA 4JI8B 3P9SA 4GIBA 1E0AA 2BLNA 4Y7CA 4MDHA 3Q12A 4AYTA 4D4LA 1DNPA 2XNSA 3HY4A 4KL8S 3D4BA 3OCYA 4TKVA 4LJKA 1G2IA 3R40A 1PJAA 4G89A 1P9NA 1F14A 1UBGA 3ONFA 1KE1A 4KXYA 5ISMA 2FK7A 2FSFA 3U9LA 3D43A 4WDRA 1GAQA 4TXMA 1TAHA 4MZXA 1EP3B 4NY1A 2Z3ZA 1BS9A 2I7XA 4YX9A 2IS1A 3EJWA 3VHQA 4NXNB 2NX2A 4EG6A 1AV6A 1OOEA 2CVQA 2VQDA 2J5RA 3I8OA 1SCAA 2QTCA 1UMCA 3L8CA 1E1QA 3TQIA 5CX1A 4KODA 1SVLA 2H2WA 5J5AA 1KOGA 3KYCB 4OLBA 3E5MA 4RL6A 1PJSA 3T7IA 4UTRA 1XPUA 1I1QB 1XZJA 3ML1A 3PIIA 2FNAA 4GPBA 1RPAA 3HCEA 3FVTA 2ZYSA 4LUCA 4RTQA 4Q3OA 3F73A 1I10A 4Q7JB 4LVOA 1U0SY 4Z2AA 1D2HA 1H42A 1EUCA 3Q0EA 4UULA 1LZKA 2QDXA 2XSZD 4F06A 1F0YA 2C7VA 2IP2A 3R7WA 4B3JA 2JFHA 1NULA 4RHXA 3T7SA 4CG1A 3ZVMA 1JT9A 2WTBA 4G23A 2WM3A 4RPLA 4CYMA 2VPIA 2AMJA 2EFCB 1RJDA 2HU2A 3DEYX 1SH7A 2BFFA 1E4EB 4K05A 3G9ZA 1X7WA 2JJ1A 3L6UA 4OB7A 1VC2A 4YR7A 2ZE8A 3KUCA 1T6XA 3TOSA 1U0BB 1KDTA 2J3EA 3A1UA 4K6CA 3W5JA 1A50B 1NONA 2IBSA 1TDJA 4Y2VA 1Z45A 1S2OA 4OHBA 1MA3A 5BSFA 2ZRKA 4AJ9A 2RI1A 3NAGA 4RLFA 4DBLE 3WLEA 3RQIA 3S68A 1DQRA 3VPHA 3IYLW 3OQIA 4ZO6A 1AO3A 3OZWA 4W1PA 3L1VA 3VOSA 1QX4A 1D8AA 3A9UA 1NP6A 3H9JA 3ZWAA 4ZMBA 2YOGA 2GJ9A 4LVNA 3CCFA 3JW8A 1TW3A 1RQXA 1CRQA 3S3TA 5F4ZA 2VHJA 3CF2A 4MV9A 3U4CA 3ROMA 1A9ZA 4PNEA 4QHYA 4K2AA 3W2GA 2C9BA 3S8MA 1DHTA 2HSEA 4YDSA 2VJKA 2EZUA 3JARA 3PF8A 4F71A 4ILEA 2WTUA 3NHKA 2Q5CA 2JW5A 4HB3A 3DW1X 1L4GA 5GADl 3IOMA 5H3HA 4J07A 4G5OA 3V8EA 3TAXA 3LV8A 3AERB 4I1VA 4N0EA 1R6XA 1WL8A 3ZIAA 3BWMA 3OIGA 2WR8A 1H9AA 2VHWA 2X1MA 2P9ZA 3AOEC 2WSSD 1FY2A 1BWPA 1ZCZA 2GPBA 4MYTA 2GN0A 4BEBA 3QMVA 2I4RA 2IEAA 3PX3A 1IATA 2FRXA 1VMDA 3AUFA 3D6AA 4RD4A 4X8OA 5EERA 2PJRA 1G20A 4UDYX 2HU5A 1DWQA 2A1TR 4DA8A 1C4WA 4E3ZA 2W6MA 2RGNA 1XZ8A 4U2DA 1ELOA 1TXGA 2JH9A 2BCJQ 1KO1A 1GOTA 1Y3BE 2D1SA 2XGSA 3DFUA 3E3NA 3UJHA 2P9FA 3OQIB 3R41A 1CUVA 3KQYA 5DM60 4JSTA 2J46A 4GMFA 4BBPA 3WJ1A 4WLOA 2JFUA 2R00A 4KYUA 3UXMA 1PGJA 4Q1CA 4WUVA 1SIUA 3FPGA 4QIHA 3V6MA 1M5TA 1SXHA 1IIRA 1CHDA 2N9UA 1N57A 1ZSVA 3AMVA 4Q4LA 1ECBA 5JV5A 4O25A 1E2LA 2NVOA 3QTBA 5K3BA 3DV0B 1GVNB 1XOIA 3HJHA 3TNDA 1UDAA 2O3RA 2WFMA 5ITSA 4BY9E 5FHRA 2FUNB 5LU8A 4UD2A 1COWA 1DKQA 2INGX 2P75A 2BCEA 3SR4A 1YS4A 2JAHA 3SHTA 3WK8A 3IA7A 2LDBA 2YICA 5L9AA 4HLCA 3KP1A 4QHTA 1JLSA 3NJRA 4LXQA 1OBFO 4XWGA 1ZX1A 5E6UB 2VDMB 4CIVA 3J81A 1II0A 1VCOA 2GPYA 1KZGB 1NUAA 2ORIA 4FMDB 3SQXA 5HIKA 3MTGA 5D85A 1WETA 1JKFA 1EK0A 1L5HB 2QE7D 1ZGCA 1JYSA 2GN9A 2RHWA 4E1VA 6AT1A 4GUAA 4LYJA 1E9EA 4R31A 1HE1C 2VIIA 4G5RA 2CDCA 4I7EA 1AB6A 1F12A 1YFZA 2H06A 1IMOA 2BI4A 5J5VA 4URZR 3ZDXB 5FUQA 1GZ7A 1WS6A 2A0XA 4RETA 1U8ZA 3G7SA 3FF1A 4UUQA 1X7DA 3G68A 3UNXA 2OHIA 4AS1A 2AOUB 2WTXA 2X4DA 3ZOKA 4DKXA 1HQDA 1PYGA 3KZCA 2X3YA 4C06A 4D9JA 1EE2A 2I2AA 4V38A 2EFGA 1SHUX 4NCKA 3O8OB 1BA3A 4WY5A 5LZ8A 2ODQA 2TRSB 1X1EA 2G82A 4M1TA 3PWSA 1DLJA 5ALJA 1W0JA 3D7KA 3PIRA 2FEKA 1H2AS 3KWJA 4WKCA 5HYVA 4D9EA 1V0JA 1TT7A 4JC0A 2WYOA 1L4BA 3AF0A 3A9TA 3OP4A 4P80A 5AKIA 1A2BA 2QROA 4Y2YA 1KEEA 2DR2A 1TQHA 2AC4A 3WIEA 2CEAA 3F90A 2VATA 5C37A 1I1HA 3EIFA 1LPMA 3FLMA 3GMSA 1FP6A 1FTQA 5I45A 3WL3A 3K1TA 3UPUA 4O33A 4BNHA 5LP6A 2XQIA 1CUHA 1UJCA 2AV6A 4IDHA 5DHTA 4AULA 1ZH8A 2TMKA 1AQJA 3V3TA 1AVTA 5A4DA 4ZYVA 4M36A 1TD9A 2ID8A 1Q92A 4S04A 2BYTA 1XCBA 1ST3A 4N47A 1IVSA 4A26A 2NMVA 3WWOA 2JJQA 3SE0A 1QU3A 5LQCA 4X84A 2HDHA 4XARA 3JRNA 2J0UA 1MH1A 4ZQCB 4C89A 3A10A 3P2OA 5IK2D 3DDUA 3QV2A 1X38A 1WU7A 3UXYA 3KPJA 1V26A 3UAZA 1Y0BA 2QJWA 4YMUA 2DMRA 4MUYA 1O4WA 1KI4A 1T25A 4A16A 2HIGA 4B75A 5CLGA 1YFLA 1DELA 1HL3A 3PFHA 4ER5A 4BNGA 2IZOA 1N5RA 2M32A 3GLFE 5AOVA 4HNVA 2QVGA 1KHTA 2JIZA 3TX6A 5THQA 1CD5A 4HAUA 3G5AA 5DV9A 2UUAB 2XXAA 3N2EA 4CT5A 4XEUA 1TF2A 1RCUA 4MV0A 2ZRLA 3MPUA 5HOQA 4R98A 1ZXBA 1EHCA 1OFUA 1DMSA 2PLFA 2X7XA 1UT6A 4JA0A 3KXDA 2QX8A 2GBLA 5CYPA 1YJAA 2Q6KA 1ZK3A 3JQQA 4HRAA 1RHJA 3R7FA 1N6PA 3LWDA 3A1TA 3TTSA 2FPMA 1E3SA 4MKXA 1PSWA 3PHGA 5A03A 4QC2A 1WSDA 2WUFA 1E6LA 4LE1A 3CQ9A 3FSJX 1XU7A 3JSAA 3DLAA 4PHTA 1NI3A 2VP6A 2D13A 2WWTA 5EJ6A 3SYLA 1L9KA 2RHGB 2YRFA 2VJQA 4BYGA 2BFNA 1Q12A 4O5OA 4PLGA 3E9ZA 3GNTA 2Y77A 5FUVA 3K72B 5HS6A 2XCSB 1WKBA 4R5MA 3PQDA 2C3YA 3DBVO 4F12A 1ORWA 3V00A 5B6JA 4KQKA 2RBEA 3RS3A 1QCDA 1FU8A 1T0IA 2FW0A 1RYBA 3C48A 2FSVC 2GAAA 3LQ2A 4GLLA 1ODLA 3B1FA 4HDNB 4TV9F 3DZIA 2AI1A 4XVQA 2NU9B 4E4TA 5JXWA 1IUOA 1CG6A 1PCXA 1D7AA 2P9QA 2D7JA 2Z2JA 3LPMA 4MR7A 4O4JA 4R3WA 3ZCUA 2ZB4A 1MAHA 1CJSA 4LX8A 4BMXA 2FWRA 1PZMA 3GVPA 3KOOA 3L43A 2I99A 5DXFA 4BIMA 1UK7A 1NXWA 2QZPA 3KZOA 4WWHA 2BV3A 2PPLA 1S8OA 5KO2A 2WFLA 1X7YA 2NQ2C 4BGEA 5M29A 3HL0A 3LLSA 1IN7A 5TF4A 3HZZA 1NQXA 4JYPA 3VOTA 1S2IA 1D9ZA 1W4ZA 1XT6A 3VDQA 1F1BA 2GK6A 5CT8A 5SZHB 4D8YA 2YWDA 2ZGVA 1NFQA 4GFDA 1G21B 1ZXLA 3UWMA 3EGWA 1P7YA 1GU0A 4YPFA 4BC1A 3OWXA 4WASA 1ZJZA 3H6GA 3L40A 1TYDE 3NCTA 3O73A 3UW1A 4ISBA 4B73A 3V1UA 3W34A 1DBVO 4ZOCA 3OOHA 3DLBA 2HO4A 4N7JA 5ADUS 1NUQA 4GI7A 3FA2A 2HBZA 3DGEC 4L3VA 3RE1A 1LH0A 3P8ZA 1EYZA 4IIJB 1DCMA 1E2HA 2O2IA 3CPEA 4O0LA 3ETJA 4AKTA 1ZISA 1QO7A 2AZTA 1WD5A 5F1PA 4ZO9A 4YCNA 2JFBA 1VQ1A 3FNHA 2HUNA 2XGOA 1FJ2A 1TUBB 5ADWA 2Z4SA 4MI1A 2KE5A 5G3ZA 3NB0A 5FP0A 2QMZA 2OUIA 2VKTA 3RSOA 4BRSA 5HK8A 1OZ0A 1NAHA 1ZN7A 4B7CA 3MN1A 3CR7A 3M8KA 4L5CA 3DB2A 4ZVLA 2XE4A 3ADOA 3OU2A 3UOWA 2GCNA 3C3YA 4EJ2A 2QYHA 4P4SB 4BVJA 3TM4A 1HEIA 2VT6A 4JYMA 2ECKA 2ZTSA 4YUXA 5TEWA 1DOAA 1XEXA 3ESXA 3F5SA 2E5LB 4HXGA 2C9CA 3PE3A 1HNNA 2F8SA 1EE9A 3BGIA 1E6CA 1G5IA 4ID9A 3ZJYA 2XVYA 3PLRA 4K86A 1I3MA 2XZPA 4BAGA 3WBKA 1G291 5AKKA 2ZSUA 3EXHA 3UY4A 4EYEA 2A0WA 1EQAA 2HT1A 1F2UB 5C2JB 3JQBC 1E2IA 1XLTC 3SDBA 2GA9A 4P3OA 2W2OA 2I6SA 3KTOA 1YRHA 2CHGA 1WCIB 5AUPB 2J5XA 3IAHA 1KDPA 1HE4A 2CZCA 4NECA 4Q4JA 1BO6A 1JFFA 4ZGWA 5LR6A 3MWEA 4IHJF 1KOJA 5CA0F 3ZZMA 4MJ7A 4FDLA 1C1DB 4KIGA 3M5DA 4R9RA 4RTSA 1N5IA 3NHJA 4MAFA 4JBGA 2QAGB 5CT6A 1V5EA 3PGJA 4ND8A 3GQVA 3BCSA 5FTMA 4V03A 1SKYB 4JB0A 4PXSA 5DGHA 3HXMA 5D3ZA 4BXOA 2BKUA 5CAEB 1RADA 1VJTA 2ZU0C 3BD9A 4WY2A 5K8JB 5TQVA 1HTTA 4DIDA 5THXA 1CEXA 1KMQA 4U63A 3P20A 4ZRDA 4AJJA 4EUEA 3JQGA 1ECFA 4J94A 2UVQA 4YDHB 2XOKD 3IKMB 2XAAA 2IYLD 4G2NA 2I62A 2OP1A 5LWHA 1ISIA 3EODA 2FN8A 1T26A 4W7IA 4JVLA 4ZI7A 2PMKA 1PJTA 3VHRA 3AETA 2R00C 2RH8A 3LA8A 4FKBA 4HDRB 5JVDB 4DV3B 1G8FA 2PYIA 5FWNA 1WXQA 4F9GA 2KW5A 3DGFC 4JB3A 4R1OA 4EHKA 4BRWA 1QLHA 3DR5A 2GPAA 4C0HA 2P0AA 2X15A 3CJTA 1V16B 2FP4B 4OBEA 3KDSE 4EF4A 5KCZA 4GHWA 1IQ0A 4UAJA 3MCWA 4OH1A 4X1YA 1X6VA 2E6KA 2HRQA 2YXLA 4RM2A 4TWJA 1IM2A 4DQLA 3QPCA 3ZLUA 5KMGB 4IDPA 3L2OB 1LF0A 5CIWA 1NBME 4BKRA 2I3AA 3HP4A 3R4CA 1KL7A 3FTFA 1HDCA 3N8HA 3DP7A 4KJXA 1ODJA 1FJXA 4KR2A 5B3JA 3S7TA 3AOEA 1O58A 2OECA 4QU8A 2NPFA 3QOYA 2PUEA 3FRHA 4CV1A 1UM9B 4FMBB 3V8MA 2JFOA 4I4TB 4DLVA 3D8NA 3JQGB 2GTHA 3GCZA 4YT2A 3HRHA 1E94E 4JD5A 4V0MA 4YGYA 4AIRA 3THYA 2JLZA 4RUKA 3Q6MA 2EBFX 4WXRA 2H17A 2ZI4A 4RX1A 3LBYA 3OG9A 4GOKA 5K99A 3ZWDA 2WIDA 5FV4A 3AFIA 1W4BA 4OHMA 3FNBA 4IG4A 2FPIA 4RVHA 1IG0A 2OOKA 3TMKA 3R9XA 4PNPA 3Q2KA 4X3PA 3HUEA 4I99A 1E61A 1M34A 1Q7GA 2WTNA 4KV7A 4WNCA 3GFTA 5IUNC 5BW4A 5FA5A 1K97A 2FJPA 1ZK1A 2PGAA 1O94A 4F46A 1H9CA 2XUOA 4DDMA 2IEBA 3NH9A 4O2BF 4CKYA 2N42A 1QIGA 3KTAA 2ZJOA 4BJ5A 2IF0A 2O23A 1J07A 1ZCBA 3HBFA 4G37A 4U8HA 5SYAA 1T4CB 3WDLA 5T41A 3ZVNA 3BFXA 3ZE2B 4D9NA 4W5NA 1ORIA 5DK4A 4MI6A 1U2SA 3HKCB 5KJCA 3FPBA 3GJ8A 1XG5A 3L82B 1GM5A 4BFYA 2KMLA 1QF9A 4MVJD 4L8VA 4WA8A 2B37A 4L15A 4R2JA 3UMFA 4DSAA 4QXQA 1U2QA 3DPSA 2ATXA 3HZHA 4JQYA 1UC4B 4EHFA 2HTFA 3ITNA 4RZUA 3VTAA 2PZKA 2O0KA 1EVYA 2YUIA 1WVGA 3BXEA 3PHJA 1Z34A 1QK3A 4RVGA 1SOWA 2QMEA 1OA1A 3PYMA 4JX9A 1IONA 1FVXA 1XEWY 2QP4A 1LBSA 4PVDA 3RRBA 1TUBA 2VP3A 4IO0A 3CIOA 5I4IA 4OXQA 5DI3A 4YBZA 2XGGA 2WI8A 1QG0A 4QQNA 3SM9A 4CE6A 4HDAA 1J8YF 1WB5A 1YB4A 2VT7A 3SP1A 2P3QA 4JIMA 1PW7A 3I9KA 4O3MA 1XSEA 2FX2A 1V35A 3KAQA 3KTDA 4HJRA 1S02A 3FUUA 1B6TA 3EZ7A 1DQPA 4JYCA 2BMWA 1Y5RA 1LBHA 2RSLA 3FBWA 3JALB 2ZJ3A 3QPWA 2G7ZA 1VJDA 3H1EA 2H57A 3M89A 3SZ3A 1E7MA 3W9YA 1MP0A 1OI4A 5BNIA 2QRGA 4HPWA 1EXDA 2Q4OA 1GU1A 3TW8A 3UT5A 2OOSA 1A8SA 1UBHS 5ALQA 5PNTA 3E9DA 4EUKA 1IQPA 4PBTA 1CS0B 3OZAA 3O1IC 2Z30A 1VHLA 2VPQA 3M70A 3G1TA 5JAZA 5GJBA 2X6QA 1T4CA 1Y5MA 4B4UA 4RD1A 4N18A 2E18A 5E1DA 4FFRA 1WOMA 4H27A 5I9SA 2Q9UA 1C1DA 1Z5NA 4LOIA 5DSZA 4KN5A 4PLHA 4D3XA 1OXUA 4QO7A 4Y2XA 2NYVA 3DBOB 5HFAA 5C1PA 5JJLA 4TXLA 1O6CA 1H2YA 4M1YA 4UAUA 1WUYA 4OCZA 2G76A 4NJMA 1CR2A 2D00A 2GZ1A 1GTMA 2OCPA 3B3AA 2V6GA 1BXGB 4KTVE 4PZUA 2FZVA 5AHOA 4P32A 4BVHA 5IU6A 4HYTA 5FORA 1VOTA 2IUYA 1IHUA 2HCRA 3FR8A 5AVOA 3P71T 4W9RA 5JTTA 2DHDA 3DNPA 4EPTA 1DJLA 2RAFA 3OHPA 2NP6A 3IUEA 5BUQA 1Y5IA 3OFJA 2QD3A 5K3FA 3D6HA 1L7EA 3V8NA 1ULHA 1KH3A 5DP1A 4JEIA 3T9CA 2RGYA 5IRCD 7REQA 1JS1X 1WXEA 4BO7A 2QTTA 2NO6A 3ZWOA 4A6PA 4PSKA 3MCVA 4TTJA 1HFEL 4IILA 4AO6A 4D42A 2EHJA 4EKYA 4CIYA 1DGQA 4X90A 1HTWA 3GO4A 3L93A 2MDTA 4ZCSA 3ANNA 2VH5R 1I7LA 4X1YB 4Z2YA 3LM8A 3M3DA 1VL0A 3WGUA 1JHQA 1W47A 1ZUWA 2BN4A 2J30A 5LP1A 1U80A 5DBFA 1OZAA 1E5QA 4FBGA 4YQFA 1CEYA 1JWBB 1Z62A 1N2BA 1NBIA 2OILA 4KNWA 5TF0A 4ITUA 3TNJA 1T9GS 4MQFB 1Q74A 4EVIA 4IUDS 4XX1A 4IQ0A 1V3TA 4MVYA 1ZN9A 1K9VF 2JFFA 1O77A 3H7IA 3QUAA 4OJTA 4Q7KA 5E38A 2Q6TA 1ICIA 1S0UA 3EZ6A 2NUTB 1EHIA 121PA 3E61A 4JUBA 1RHMA 2JGRA 3AKZA 3LQQA 1MJFA 1PFWA 3O26A 3U26A 3ZH9B 2CXXA 4ZV4A 2MYTA 2YQZA 3GIDA 2PA3A 5LLTA 4A36A 2X1VA 3KLMX 2J9RA 2F9LA 4KO3S 3H18A 4FLEA 4HLNA 4BCDA 4E14A 5L3QB 4K46A 6REQA 1RE0A 3ZVRA 5J43A 4TTPA 1Z2DA 1EK2A 4MJ3A 2WJJA 4PHHA 4Y2SA 4X20B 3M33A 4E3WA 1SKYE 4PAGA 2YH2A 4PQRA 4TTQA 3BT7A 3OMXA 2WUDA 3PD1A 4MWTA 5JNSA 3MILA 5DT2A 2YR0A 2HXSA 3GZNA 4RV4A 2G3YA 4X92A 3WNDA 2Y2VA 3ZGZA 2Q46A 1NJ2A 4TVSA 1Z2EA 2HOQA 3HKDA 2DQZA 3IMKA 3AVPA 5AKEA 4IW3B 1J23A 4D9BA 2OHGA 5ALOA 1JXMA 2PMCA 2OFPA 4HQNA 4RJIA 1PR3A 1EUYA 2NN3C 4ESEA 5FBWB 2P40A 4ZK2A 4TL6A 1A3CA 3LGSA 1AHIA 4LHZA 2PXCA 2ZJ0A 2X0NA 2IHTA 2NIPA 1SA0A 2FZGA 3BRSA 2XVAA 3RYFA 2W42A 4U1RA 3NDRA 2TMGA 4AP9A 4HDSB 1ISFA 3BMCB 3SBOA 1DFGA 3DDOA 5JLAA 3U3KA 4GR5A 3ZHSA 2XCRB 4GX1A 2PK3A 4KIWA 2FEPA 2JLVA 1XRSB 2OXFA 2H08A 2QQFA 3ER8A 3SE7A 1U3TA 5FLEX 5KHAA 3TOZA 3A0RB 3NCHA 1C7EA 2YWJA 1A82A 5EUCA 2R8XA 1XAHA 5FBQB 2DP4E 5D7NA 2ZUTA 4DJJA 3P2MA 4FOPA 2G07A 1TEXA 3LDFA 5HWSA 4GX5A 4EJSC 2VSOA 3HLKA 3IAAA 3M34A 3X2FA 3BFKA 1UFQA 2CDBA 3LK7A 4UVDA 4AM8A 4BLVA 4E7OA 3CO5A 3PXXA 2H3EA 3PZRA 2P91A 1B6SA 3FF4A 3QOXA 3R5TA 4RVOA 4EI8A 2IH2A 3C1UA 5DK6A 5A9SB 3ROGA 3SZOA 3KKOA 4AMBA 1ZEJA 1R9JA 4EYSA 4RACA 1BD3A 4IDDA 1NF3A 1QGAA 1M7HA 2O05A 4I1RA 3TZ6A 1ENOA 1OV4A 3AI3A 3REQB 4DQVA 4KWIA 2FCAA 4MUHA 5EIHA 4RF2A 4BZZA 4MVJF 4PPQA 3SNHA 3SD7A 2GCOB 3RHZA 5L4LA 2PH7A 3I5MA 3OCZA 4BNDB 3FNIA 3UCXA 3I45A 3PNQA 2FU5C 5F7ZA 4F2GA 3ZHTA 2VF2A 4BLUA 1G9XA 5LFAA 1O96A 1IXSB 1XLWA 3P0JA 5CW2A 4C9BA 3L0CA 4CMCA 1Q7EA 4ENWA 1WUHS 1HT1E 2GN2A 2QT9A 1Z8DA 1JZTA 2L82A 2OGUA 5A62A 2EJWA 2FR0A 3DVQX 4KXWA 5JR3A 3ULKA 1U3UA 3GCWA 5D3MA 3CUEF 1U0EA 2XDQA 4UD6A 5F76A 3MELA 1NTOA 2IDZA 3F8SA 4NI5A 3V42A 4ETMA 2UAGA 3DCNA 4N8DA 5L3SA 4JVNA 3KOYA 2JBAB 4LDPA 4NMLA 5I4BA 2DOKA 3EZ2A 4IFIA 4UUOA 1H23A 4KUEA 4TRMA 2XUIA 4RS4A 4UHCA 1YC2A 3B5IA 1RKUA 5JNTA 1E9AA 1AXEA 1Z5UA 4F8YA 3ZHRA 3OU7A 5JWOA 1Y9JA 4TTTS 3I2HA 4Y2RA 4O4JB 3KBOA 1GLVA 2JEZA 3B53X 1GRQA 4REQA 1DFHA 1VFNA 1SVSA 4XQEA 4D96A 1TU4A 1JVBA 4G86A 4R8KA 5IZCC 2BFCB 3C2QA 3QFTA 3WB0A 2J8ZA 1S9HA 4W99A 4DXHA 4WBNF 4GRDA 1PHRA 2OCIA 3Q3HA 2OAEA 3KQQA 4OMUA 1UBMS 2VRCD 3GD5A 1OZGA 1JDSA 2VUSA 4KPEC 1MX5A 3E3MA 3U37A 1FNNA 1P77A 2ZQYA 4DRYA 3JAWB 3T3PB 1V3VA 1NIJA 3MXTA 3WZMA 4QU5A 4N0DA 4JR0A 4O08A 4W5HA 4YBRA 1USGA 5CB4A 3WGQA 2E89A 4ZDWA 2RG7A 3QVLA 1UDWA 3Q1KA 3BCUA 1X1CA 3PRKE 1Z16A 3EQ8A 1GT91 2X77A 4JXZA 3IJRA 4PLVA 3LY7A 2B7BA 3B1VA 3LQ1A 3LZDA 5AI0A 5JC8A 3MGGA 4PLZA 4L3WA 4US0R 4EYKA 1DBQA 2VYVD 5C31A 2EZ4A 1XVLA 4E5NA 2W6NA 1O97C 1VHTA 3MS2A 5B1YA 1MO3A 2N46A 1NDQA 3QXCA 4E46A 3VOAA 2O19A 1N1EA 3VC2A 1DAFA 4B9AA 1OIXA 2NSJA 3IX7A 3QVTA 1ZWLA 3ZQJA 4U7DA 1C3OA 4QTZA 3RAFC 3ORFA 2O2EA 1A9OA 1KXJA 3CTMA 5JT1A 4RLHA 3H4VA 2FPOA 1ZGHA 2PGDA 1RIIA 2R86A 2VOEA 4AXXA 5LXTF 2PUTA 4BFCA 1PJRA 4H3SA 4ONEA 3IXLA 3E3LA 4QBTA 1R4NA 3KAPA 4DEYA 1EZ1A 3SS9X 1Y6QA 1DV1A 3EDRA 1FB5A 4J16A 4W5TA 4KKXB 4K9KA 2YYAA 2VHCA 2RGUA 4H0FA 3SYMA 3TLEA 3CKYA 3GLKA 3LLMA 3FVQA 5IYZA 4MK4A 4ZJZA 3I9LA 4LWZA 1HQKA 3AL2A 3TLZA 4U9UA 4WCFB 2W93A 2IPOA 2WW8A 3ANYB 4MB2A 2XSZA 3WLLA 3LJKA 3QFCA 3T5TA 1ISJA 2VWPA 1EFLA 1VKRA 3IVCA 3KJXA 4IHJA 1ADGA 5L3VA 3PSAA 3CSDA 4ZI7F 2CL6X 1E99A 5CEEA 1I32A 1PQ4A 3QJGA 2H2AA 5JJKA 1XEAA 3SMVA 4EHDA 1A9SA 3WZLA 1M0SA 1JIQA 4EY5A 2AN3A 2O3JA 4AUMA 1ZNZA 4B3RB 1W6UA 4HADA 1VG0B 1LSUA 1E1QD 1RBMA 4M1WA 1J25A 1SOVA 1FEZA 2A1UA 3MGAA 4X1IA 3M6FA 3G7NA 1OFGA 3JASA 3GLHE 4WRRA 2X9NA 4KVFA 3M49A 4HUTA 3ZBUA 2E7ZA 4S1OA 1UQTA 2R8ZA 2XDYA 3CNOA 3GFVA 4A5SA 1N3LA 4DV7B 4O4IA 1VPEA 3VISA 1Y9DA 3EZYA 4BZWA 4EUHA 3PFGA 2KJQA 4UW9A 5FFFA 2E4AA 2Z5LA 1PUIA 3UCFA 4BDTA 4ASUD 2HQOA 2VQEB 4LJ5A 3MPOA 3KCNA 3OZDA 5I3ZA 4JJZA 2QN1A 3F0TA 2IDKA 1NJ5A 2J4FA 1ZLXA 3IDAA 1CC1S 2G7MC 2XD4A 3RANA 3T9FA 2R1VA 3P0HA 1UF9A 4IXMA 4DRXA 5JDCA 2JFQA 1KTVA 2XEXA 3CEJA 4LI0A 2HLDD 4ECEA 2WWGA 3I01M 2W8BA 5KWSA 3PNLA 3B38A 4MCIA 2A5YB 2PZLA 3GY0A 1FTYA 3UUEA 4TPKA 2WA2A 3VR4H 5K45A 3QWFA 4XA8A 3OVMA 4WOJA 4YQEA 2ZK7A 4Y6SA 2JAQA 2OV3A 4RH1A 4EOGA 4KFTA 3JS5A 3WADA 1Q1AA 4PSUA 5JLJA 5EXTA 3GJTA 4XQCA 3N8NA 4EY3A 2VTVA 1J8QA 4I14A 2IHJA 3OJEA 3A6LA 5H82A 1UMCB 4ID3A 1X8KA 2DWQA 1DBPA 2CXSA 4L8YA 2V6FA 5CA1A 1ENZA 4NEQA 2QG9A 4XD7A 2HNBA 1G6OA 2E5FA 2ATEA 3WDKA 4MPJA 3PWZA 4BBZA 1RWQA 4WN3A 2QX7A 3FLEA 4MR8B 2YWEA 3H19A 1XLVA 1RXYA 1HSOA 2WNHA 4HRYA 1M2GA 8ABPA 3EFEA 4JJFA 3IVGA 1UT8A 4FDAA 4TTRA 3EXFA 4U7FA 3ECAA 5EJ4A 5K05A 1PZXA 1A71A 1SK8A 4BO5A 3KCQA 3KLBA 1DQSA 5C1IA 4Z8YA 3GVXA 2GD0A 2J31A 4Y2QA 2DM6A 3MTIA 4GX0A 4Z1MA 1URPA 1W0CA 2P7HA 2R1VB 2ZDGA 3EMKA 3EH2A 1VBNA 1OH8A 4B81A 3OZGA 3I61A 4CDNA 1HDOA 1A9YA 2XYVA 1NP3A 4QYSA 4OKSA 4G1EB 3SN6A 3WL8A 4EQ6A 2YZMA 2DUNA 1H9BA 1EJBA 1V11A 1VRCA 2QQEA 2ZG6A 3HJNA 4CM8B 1VDMA 1MZPA 4RW0A 5D6NA 4XWKA 1NVAA 4GZ6A 1O2DA 1Q7RA 2R87A 3HCDA 1M5UA 5CH5A 5IKMA 2HMUA 1GZUA 2ES4A 2B36A 5D2CA 3SYRA 4BRZA 1V48A 3EQZA 5I4CA 2H65A 5EQJB 3BOSA 2PT9A 1DX4A 4RJTA 4QWWA 1EVEA 2BHTA 2EFHB 4LK3A 2QEQA 3M0EA 1NKVA 1VHDA 2QJOA 3PUIA 2HSDA 3IP5A 1P4GA 3VNQA 2W2MA 3WYEA 1GPMA 1Y3AA 1AU9A 4UM7A 5LB4A 4LIPD 3WGZA 1F4VA 5IJ0A 1R5JA 5MHTA 4Z0PA 3W5CA 3T1QA 5KCMA 1E3IA 4JJ8A 1ORTA 4WACA 2Z2YA 3TB4A 2FOIA 1D9XA 1KP2A 2HRBA 2EFJA 3ASZA 3NETA 4PWYA 5ITVA 1RQ2A 2WWFA 3H2KA 1XVAA 3DE1X 2XWPA 2BBSA 4B33A 1QO0D 2RH9B 3TBFA 3WSVA 3S1LA 4BMOB 4X1KA 3HBLA 3QGMA 3HKDB 4CU5A 1FX1A 3UJNA 5C8XA 2Q1TA 1XCOA 2WZDA 1PZGA 2EFEB 2COUA 2VUIB 1EAMA 2AF4C 2ZS7A 4MQBA 3H0EA 3IUPA 3WDSA 1P1IA 3ZJ4A 3AP3A 1GFIA 2PS1A 2O8DB 1FTNA 1LB1B 3ASUA 4GGMX 5CJPA 1GITA 4HAIA 4OOEA 1WZEA 5JYDA 4E5UA 1NXXA 1R2QA 4FJ2A 3CBQA 4B7AA 1RACA 1N7GA 4HN2A 4FFVA 2AI3A 2H54A 3I8XA 3MQFA 3I1IA 3HSYA 4B6SA 4BAUA 3LTNC 4JUAA 2JF0A 2V7BA 1GDHA 1C3JA 1CY2A 3M7IA 4S2UA 5BVGA 3AVTA 5A5GA 4W1RA 3L7IA 2IKQA 4ZVSA 3NOXA 5JCJA 2EBHX 2YIMA 4XPZA 2FYTA 3HABA 1MPTA 3ABOB 5EXSA 1KKMA 3ECCA 2Y4NA 3NJ4A 3CEAA 3ICWA 4H1VA 2P1RA 3VH2A 4BPBA 5LD2B 3D02A 3PKJA 2V4ZA 4EP1A 1VPLA 5JROA 1AQ6A 2ST1A 2Z0MA 3ESAA 1K4KA 2WAAA 1KVQA 4BE7B 4BLOA 3ZE0B 1W8DA 2REQB 4LK2A 2SCUB 1ND5A 2OV4A 3NHUA 3AEYA 4PBSA 1T43A 3GDWA 3NMUF 1W34A 1YZYA 2CLHB 5CTJA 4UM9D 3EDYA 621PA 2MYUA 4IRXA 2JCXA 3PHCA 3T4UA 1KAQA 4AVYA 2BKAA 4C5CA 5DM2A 1VKJA 1B26A 4N5MA 1D8TA 3M1AA 5K6RA 4P54A 4CIAA 4GE0A 2ZS8A 4A0FA 1V5IA 4D45A 1EH5A 4FQ8A 1LNSA 3EEBA 5JDIA 2NOAA 3PR2B 5IVDA 5JMWA 2CE2X 4PC3A 3MCTA 3NALA 3FH0A 2C8LA 3JCZA 1JEAA 5A3VA 5IVPA 1QKJA 3LVFO 3PTAA 4F9EA 4MEJA 3NTLA 3WKBA 3VR3D 2WB4A 2Y93A 3BCHA 3P5BA 3H2ZA 2OM2A 4L75A 5FYDA 3ZXYA 1XQWA 1OA0A 3L6CA 4KK4A 5BO5A 4CNBA 2QRLA 5JCJD 3UQYS 1D1PA 2HU8A 2OYSA 3RC9A 5AUNB 1X94A 1FE8A 2IYTA 1L7RA 2NU6B 2XDQB 3ZJTA 1EWQA 4XWAA 5AK5A 3TZKA 2P6NA 4GPD1 3BHIA 3GL9A 4GL2A 1ZL0A 1XWIA 2H1SA 2G71A 4UHHA 3UAGA 3DO8A 3RTDA 5TGDA 1H85A 3IV9A 3SLKA 2XZTA 2OK7A 1JDZA 1J06A 3RPEA 4BQPA 5KNCA 3FX2A 4BO1A 2B94A 3PR1A 2DECA 5JS8A 2PPVA 3BIXA 1I6LA 1JX6A 2II6A 2VZLA 2FG6C 4NZMA 3TW8B 4XQ0A 2POQX 5FKJA 2FPPA 3MTJA 4GL4A 2XQGA 3L07A 1SBYA 4Y6OA 5ED4A 3C8DA 3MGCA 4KLNA 4KXLA 3CA8A 2F3RA 3QX8A 1SRRA 2RGBA 4OBXA 2VOJA 3WO0A 1KH1A 3CZ4A 2AHRA 4ETIA 3NATA 2G5PA 1VLZA 5L53A 2PKRA 3GHYA 4O4HB 5LDGA 4FX5A 1RWXA 1JEQA 2GEKA 5JSQA 2QTWB 5KU1A 4G5XA 4UQPA 5CITA 4L08A 3FKJA 4LE0A 1UPUA 2PWZA 3RS2A 1FS5A 1UBRS 4BWFB 3L05A 1ADFA 1EB9A 4PG4A 5FULA 4DQXA 3A4LA 2Q4TA 1QCZA 2ONZA 4JBWA 4L5IA 4P0TA 3RG8A 4RTMA 1N6RA 2LXNA 2XE7A 4HR7A 2IKSA 4NAUA 4TV8F 3WXMA 4QE3A 1GAEO 1R7RA 3VKFA 4L9SA 4CIDA 3IULA 5CMLA 1RTKA 1EM6A 2IV3A 3D64A 1MHPA 2LGJA 4DMCA 1PX2A 1XZPA 2CHQA 1Z5PA 2FG5A 4ARBA 4G1VA 2YCBA 3EBOA 4KYVA 1O94C 3WB9A 4MQ4A 4AMYA 2H29A 4BJ3A 3ZQKA 1ORHA 4YRNA 2EC5A 4OLHA 1D6MA 3BB3A 3VBCA 4BKMA 1WSAA 4ILKA 2NV0A 2ZIGA 4PHCA 3E1KA 1B8VA 4LG1A 3DKKA 4UUMA 1QG2A 2NQ8A 5IC5A 2H4WA 3FPEA 1NVBA 2P79A 2VQSA 2PUWA 4RY0A 1SCIA 5JPIA 4EFMA 3F4LA 3N07A 4M38A 3VU1A 3VHXA 1OXBB 2VCEA 1TQ2A 2ZSHA 4CV2A 4M9QA 1SBNE 2QD1A 2VHYA 3QKRB 1L1RA 1LQUA 1Q0PA 4EECA 1UDRA 2EVWX 2ZSFA 2OQ2A 3B3GA 1MFZA 1J09A 2ASEA 1DV2A 4RKWA 1QIMA 5LPNA 1VMAA 3G89A 1A2OA 1BE6A 4I4TF 4LTNA 4Y3UA 4GD3Q 1XCGB 1HOXA 2C2KA 3LH5A 1L7VC 5F5XA 2Y68A 4D74A 5BWMA 3TF5A 4XWTA 5EHNA 2IS4A 2H85A 4HQ0A 4NL4H 3SX0A 1CIJA 4OHCA 2P2YA 4CF6A 5ULLA 4D46A 4O4HA 3MNFA 1QO9A 3HY6A 4TOIA 1O9BA 2J5KA 2OORA 2Q7OE 1WLSA 4AJNA 2F43A 4ZGGA 3U7RA 5JI2E 2IQ5A 3W9UA 1XXHA 4QO8A 3SQOA 1A5SB 2RAPA 3P2IA 2Z3WA 4BTEA 1N33B 3MMXA 1P8JA 2CZQA 3VKVA 3AIKA 3MUFA 5CG1A 3HE3A 1H5UA 3PJGA 4ARZB 3OLXA 5I7HA 2Q4RA 3EDOA 1NMSA 4KPFC 1QV6A 4L85A 4QOGA 3OCCA 1A2QA 1DAMA 2WT9A 3MB8A 3I4CA 5JCOA 2QE6A 5C8VA 1MC5A 4UAVA 2ZWMA 4YJ2F 4JYZA 2P1DA 3R9KA 5K0SA 3ANXA 1XZGA 4JX8A 2AFVA 2E4VA 3TLXA 4E0BA 4CKCB 2B20A 3KXKA 1CDOA 4CQNA 2HLDA 1PJZA 4LYHA 3O92A 3PRJA 1E1MA 4QGFA 2BGIA 4HWOA 2HBYA 2AJBA 5CYFA 3DQQA 3FWKA 5BRJA 1FW6A 1NVGA 2UYGA 4YRMA 1VRVA 2D3WA 3HGQA 1PBTA 2CFCA 3T5PA 1I4LD 2QPLA 4ED9A 3ITDA 2QYOA 4F6LA 3BDAA 3GNLA 5F73A 1FTWA 4MS3A 5IAOA 2CNNA 2I4IA 3DDWA 1CERA 4KGZA 3I72A 3LCMA 3CNLA 1QTIA 4R81A 4ZT5A 1CUYA 1SXGA 2X40A 1OX4A 3E9RA 5H0IA 5B7GA 4W6ZA 5LLDA 1KMMA 2OFWA 1MQ8B 4X1KB 1N3YA 1RMQA 3LTEA 2EXXA 3I2FA 1KIAA 2BEVB 1PV2A 3OJOA 2EW8A 3I73A 1YZHA 1HT3A 5DGXA 4UUAA 5DM70 3R7BA 2ZWAA 3UK1A 3V97A 1BS2A 1NMYA 1YJ8A 4LPKA 1TYBE 4ENRA 4R9UC 1CZLA 2GFHA 2QTAA 3Q0IA 4GQBA 4E1AA 5BSVA 2CXPA 1DI0A 5JDIC 1V7CA 4IM7A 1XMJA 1A4UA 4WKNA 4PZ0A 3ZWCA 2I4LA 2H5JA 1AGNA 1X7HA 3I6MA 3K8ZA 2ZM5A 3NM6B 1VLQA 4D3FA 1N3BA 1SU7A 2AEMA 2AD5A 4YAJA 2WIJA 2QN2A 2IVFA 3VJMA 4JL5A 4NC9A 3VHLB 5CFPA 2ZYTX 4IGFA 5KNBA 4ENSA 2XBMA 4XVUA 2V9ZA 4ZXFA 1SXJE 1I5EA 3IHTA 2AJDA 4XQ9A 1BVUA 2HF9A 2O2CA 4KQ6A 4YRZA 2B1IA 3O9MA 1CB0A 4BMZA 4X85A 2QTBA 4H7HA 3UWKA 2DLCX 4M87A 4Z4GA 1Z0UA 1OAOA 1LTQA 1PEAA 2G5CA 3SBXA 3SFVA 4TYPA 4R8VA 3AEKA 3GGOA 1R9MA 1IL0A 4A0QA 2H4ZA 3DWIA 1AE1A 2XUPA 4NR0A 1RCFA 3H1TA 3W3AH 2XUGA 3KT6A 3RSGA 4RYDA 4YY3B 1PS0A 1P3Y1 1P4SA 1H8ED 2HWUA 1LGYA 1J7JA 3NI2A 4RZ3A 4YJHB 5AJTA 1NHGA 3PI7A 5I7AA 1A5ZA 4JP3A 3WLIA 1C1XB 3UH1A 1RM3A 1FTGA 3WGMA 5IDYA 3BS4A 4DYHA 1X80A 1Y6FA 3GRCA 1YDMA 3CSUA 1GFSA 1V25A 3O2JA 1TM4E 3BTSA 2VYVA 1NI5A 2XCUA 2HJRA 3C8UA 2D2FA 3D5TA 3DD1A 3EGEA 2IV7A 4Z3KA 2BTQB 3VBEA 3ZHBA 4YHHB 5ELMA 2QTRA 3UTCA 2AL7A 1E7RA 1HE5A 1Y3DE 3T06B 3WVNA 3ZCPA 1PK8A 2XOXA 3O84A 4O4LB 3DUWA 3VDMA 2W6ID 3ZV7A 4YUZA 4OXRA 2K2QB 4KQMA 4XUDA 1YBVA 1EDDA 5GPBA 5ALDA 3DMDA 4RXTA 4YRDA 4E32A 4X97A 3LQYA 5KYUA 1A5TA 3GHHA 1O57A 3D3WA 2QX6A 4QDXA 3A32A 4G0PA 4ES6A 3AH8A 5GV7A 1NT2A 1UJ4A 1VCHA 3TBHA 5KHLB 5BSKA 3Q3EA 1P72A 1GCGA 2XUKA 3IAM6 1GGJA 2VF7A 3N7UA 4M1QA 5BV1A 2PUBA 3I0ZA 1E77A 1S9DA 3A6ZA 3PCTA 2F1HA 3HCOA 1S01A 1UPBA 4KDCA 5CNKA 2AS0A 3ZHCA 4M7WA 1WNFA 1N92A 2M6SA 5B1DA 3X1MA 3VC7A 2ZR8A 2PE5A 2PWPA 3EGXB 4A2CA 2ZAOA 4NTZA 2EWVA 5KS2A 1ODTC 1THMA 4Z9XA 4EGSA 1EB8A 1MAAA 1YC5A 4CEJB 3LYLA 2C5SA 2UYOA 1M34B 3UUWA 1RRKA 2CXTA 1P7ZA 2NPOA 3O8OA 5L3ZA 3QEMA 4IYRA 4GBGA 4J0HA 1RQRA 3G5MA 1ZJWA 3MINA 2OUKA 1P19A 4LXYA 4EIWA 2FLKA 4IGKA 3KEGA 2VP2A 4FD3A 2C2GA 2YYYA 4FXOA 1NN0A 3P9PA 4HUQB 3BGOS 3L01A 4NRDA 3N59A 3VI3B 4XD2A 3OIWA 3W9BA 1S3SA 4GBED 5EJEA 1OB2A 2P2NA 4INAA 2YMQA 2OAQ1 3S2UA 3LC0A 4XDYA 1YACA 3GRKA 3TDKA 3AL0C 1L7DA 1OZFA 1XO1A 4L5AA 1T1IA 4HFRA 1QGYA 2Z1NA 3OICA 4M49A 4EYOA 4F9FA 3OF2A 4DCSA 2CDRA 4PZPA 1ONBA 1C4OA 1EJ2A 4IJKA 4RHCA 4TTSA 4CPDA 1R64A 3ZDAA 3NVAA 1Z6QA 2J6IA 5C1BA 4HH4A 1NXSA 4RU1A 3HVKA 1N5LA 2OFOA 4PANA 1NATA 1BHSA 1I6WA 1EJ0A 2XODA 4HUJA 3X2SA 1ZOSA 1B8NA 2XB6A 4YROA 3S2ZA 1FDWA 4QFCA 1O95A 4KXXA 3VDXA 5BVGB 2QKYA 4JOQA 4LF4B 5JC1A 3OT5A 1VGRA 3OZXA 4CR8A 2JIRA 1LJLA 4JS0A 3A1FA 1VJRA 4YMLA 3DOEA 4HPXB 1G98A 2HCJB 3C5HA 1N8TA 2FW6A 2PS0A 2QRQA 2WMYA 4INZA 4ZVUA 4Q18A 1ORRA 3RKRA 1D5CA 3AF4A 3LPCA 3ZK9A 4LJ6A 4JQSA 3IT3A 2CL5A 4AY2A 3KJQA 1OFUX 3BFJA 1H4SA 3OD5A 2AX3A 3CB2A 3A1DA 4ZOLA 5H68A 4LXUA 1WRBA 1NZDA 1Q91A 4MVJI 1T35A 1Z6PA 3CVYA 5AI6A 2B92A 4K1XA 4QUDA 3GJSA 3JRWA 3LUPA 3SKXA 3VYWA 5K03A 5A02A 3UK6A 2VNKA 3G5LA 3OI7A 2O4CA 2Q50A 1K7SN 4NPHA 4M8KA 2IXBA 2J45A 1FYVA 1SIWA 1KYVA 2FK8A 3NT5A 2KSQA 4FU0A 1U2DC 2HA4A 1XROA 3HWX1 1U2PA 4IUYA 1HLDA 4OBBA 3FI0A 4L4XA 2QZJA 2Y1LA 4NCIA 1PWEA 3CN9A 4BP3A 2UZ1A 3OSUA 4I55A 5ESRA 1UJ5A 5GIOE 3AEUB 3LBHA 3JZMA 2PX0A 4RHFA 3D7NA 3Q85A 3U2QA 2JGKA 3QLUA 4WJKB 1ZLYA 3C6XA 2C8KA 5F78A 1ZY2A 4YRTA 4B9EA 1N1DA 1THZA 1ZSYA 3GOQA 3O9ZA 1NBOA 3TW6A 3O82A 1U2EA 2R7NA 4W5WA 4XSGA 3TVDA 2GZDA 4ZD6A 2ZROA 3U7GA 4O3FA 1XKTA 1FFAA 2DEUA 3WGJA 3KB6A 5BQ5A 3HCWA 5GJVC 4MP3A 1NP7A 3GLVA 3L4KA 5EJ7A 1RAEA 2B4QA 2Q9CA 2H9AA 3AP1A 4RK0A 5F3WB 1KRWA 2DHRA 2IIVA 3EHEA 1ZH2A 4KMSA 5KVVA 4G07A 5KVCA 3IIJA 3IIIA 2REOA 5B5SA 4CM3A 3D59A 1TK2A 2PUGA 1TM1E 3LIPA 4KLZA 5TT1A 3H83A 5H59A 4BKQA 4E22A 3ZWKA 4TKUB 1J99A 1II8B 1YMUA 1SN7A 4A15A 3VZPA 1DEKA 3ZN2A 1OBVA 3NNSA 4I9NA 1C3XA 2CYAA 3LDAA 2ODAA 1AKMA 2OLEA 1MGPA 4Z4CA 2A5FA 2ZRGA 1IBMB 1EU1A 3IOBA 5MN4A 3KJNA 2JEYA 4GDMA 4MINA 1QH1B 3CUWA 3ZQ4A 1A1VA 4PNZA 2LR0A 2V55B 3C3EA 3FKQA 3OEHA 2NZUG 4O63O 5HQJA 3ZDRA 4AJOA 3OQOA 4UBKA 4MV6A 3DAGA 1BJKA 5YASA 1E6UA 1NR7A 4HDMA 4M53A 1NBEA 1L5SA 4ND3A 2GCEA 2YBEA 4QPCA 5C7LO 5IULC 1W88A 2CXOA 2NT3A 3CW9A 2IYPA 2QQGA 2R44A 3NTXA 3R0VA 2OQRA 2QIOA 2WSIA 3KEQA 2ZJ6A 3R3ZA 3B8HA 3LT0A 4JBXA 3VR6A 5C46F 2WHPA 3RYCA 1XD2B 4E5PA 2VPYA 2CFTA 5AXBA 2LNDA 3WOVA 2UVPA 5KAPA 5DRYA 1OW3B 3AJ9A 4WX2B 4XD7D 5KNDD 4IQGA 1FLAA 1RQGA 3C5VA 4XUEA 3W05A 3RRNA 5KTMA 1CULC 2OZLA 3H75A 3LC1O 3HU2A 3SJUA 4CM5A 1DRWA 3B6EA 4RULA 2ZI3A 4FYVA 1QP8A 2VSXA 5EZYA 2VDPB 1H69A 4EITA 4CCSA 4NBNA 2Y1FA 4I1IA 2VH1A 4R71A 1U5CA 4XJTA 2HLNA 1EX7A 3VUFA 1LI4A 4ZI3A 3OOSA 3T1NA 3ZCSA 3ZHYA 3O4GA 4IRMA 1W581 4X7BA 3EVZA 3AESB 4O2BA 3ZY5A 1JG6A 1QIKA 5E3JA 1YS6A 2Q6IA 2QLNA 2VF8A 4G65A 4GSKA 4UMEA 5JQGB 2H51A 1EESA 3IH5A 3VNRA 2JJMA 2A1IA 4I4LA 4LMPA 1KKUA 3AC0A 4LYAA 4WNAA 2YC2C 2OMKA 3VPDA 3C1TA 3FMVA 1SVNA 2C7GA 1QYIA 3U3JA 4WEQA 3QVUA 4TWBA 5EJAA 3VVBA 1O4VA 2HMSA 4FN5A 3ZE7A 5IAEA 4HOYA 1JFRA 3O8BA 2XB8A 4QRDA 1X0XA 4W9MC 2X2OA 4RJKA 2MMGA 4MVCA 4NULA 1T2NA 5TRTA 3QQ5A 5JFGA 3USZA 4G8CA 3S55A 3KKZA 3BMCA 2VP0A 1J33A 2BKXA 2QNIA 3H65A 3NKVA 4Q01A 5FB3A 2BFFB 4WBNA 3PDJA 4R2XA 3FHOA 3U1TA 4I55B 4QRHA 3GN1A 3CH5A 2JC3A 5ES3A 1P81A 3A6GA 1V8DA 3WTCA 3KSBC 3DBRA 1RXCA 2BUAA 2QM3A 2WKPA 3A4VA 5HUJA 4ZYWA 5IVHA 2QUJA 1NX9A 4RDHA 4EBBA 4RGBA 4Z0NA 3H97A 4YCMA 3VU9B 5H5JA 3E8SA 3LYAA 4AUEA 1NI4A 2EKBA 2VH2A 1KTIA 3UK2A 1MOZA 1OLUB 1ZQ9A 4AS3A 2YVQA 2J7PD 2J9XB 3FD8A 4MQUA 4XGNA 3TQFA 1MORA 1MAWA 4QODA 1SUDA 2JKVA 4XASA 5K20A 2IU0A 1XRRA 3IP6A 4NYMR 5FJIA 4O4LF 2VLIA 4G3XA 3GLFA 4Q6WA 1BMTA 1SUPA 3RC3A 3K5IA 3O9VA 1Y9AA 4CL2A 1X1DA 2RHOA 3VGPA 4NBLA 1O6FA 2YW2A 5CLFA 4KHPB 3V4LA 2C07A 3IL2A 4QBFA 1YQWA 4KLCA 3IKLA 3H5TA 4MB6A 1R6UA 1CETA 1CLEA 1FRFS 4R2HA 2MIIA 1LV8A 4I8DA 2GPNA 4QNMA 4EGCB 1JYFA 1YL6A 1UPCA 5CLJA 4H6VA 3B2QA 3RRJA 4D9FA 5ICSA 1W36C 4JOSA 4F3YA 1XPRA 5C4MA 3GMTA 3BUSA 3OLQA 3N6RA 2YYSA 1ZUHA 1X39A 2BFMA 5JSUA 4MRMA 5AJZA 3NUQA 3BIWA 1FJGB 1SC3A 1H65A 3VMMA 1XQXA 3ANLA 1O94D 1ZVVA 2IOQA 3WK9A 3N6XA 4HS4A 2ECOA 2ZPUA 1G16A 2ZJ8A 3B9RA 5BYKA 4RYLA 3UUFA 5TLSA 1U6JA 1N0VC 1G8GA 2UZ3A 1PKXA 3LWZA 3FMFA 1DRVA 4RKRA 3LXXA 3T99A 4PYOA 4WFJA 4DDWA 1LF5A 1PDWA 2AXQA 3A26A 1Z7WA 2O7RA 4ROSA 1X7WB 2B3DA 3G2JA 3H8WA 2VZ8A 4BNFA 1YVUA 2P7IA 2GJ4A 3FSRA 2ZYUX 3K35A 4V0RA 1Q0HA 3QXHA 2PMEA 1XELA 2XA9A 5TT0A 3P0IA 4FLFA 4C7VA 2CXNA 2IYRA 4QT0A 3GPCA 3RVPA 3S1SA 1DOZA 2P9TA 1RWNA 2P62A 4FXPA 1ZUIA 4ER7A 4GSYA 4O8ZA 2A0YA 2HMAA 4LQLA 4JUIA 2X86A 1ZIOA 4NVRA 5AKJA 4PHGA 3OZUA 3VVCA 3V4ZA 3OY2A 5ALMA 4EO9A 2D0DA 5I9IA 1ZCJA 2PX5A 1I6KA 3LUHA 3DO5A 2X0EA 5FEUA 3WNBA 2VDNB 5JD4A 1US8B 2LE0A 1JWAB 1LC3A 3C4QA 2WYVA 4DXDA 1DMRA 1X7XA 3DTYA 4ZVQA 1IOWA 4QBHA 4CODB 3LQKA 1XMOB 2YTZA 3M6MD 3QK7A 4QLAA 1Z37A 3V7FA 3H04A 2WF7A 3UV6A 2OHHA 4V1CI 3QPAA 3BAFA 4TUYB 1MO6A 3JV7A 4NCHA 4TL9A 3A37A 2X13A 3ILXA 1AKWA 2AF3C 5JRZA 1CR1A 1F5NA 2BEUA 2JD0A 1EPUA 4R7TA 4Z3OA 2PBZA 5B2EA 4G1MB 1ZRNA 3CF4A 4KE6A 2O14A 2ZE7A 4UEWA 4BB0A 2O8NA 4X71A 4PGGA 3L0IB 5BV2P 1GTJ1 2GXUA 3ELUA 4K6KA 5LMZA 1UBUS 5M7EA 4ABTA 2QW0X 3COPA 2O8BB 3E2PA 1X8LA 4Q4CA 4DLTA 1LLUA 3W7AA 1I2CA 3AEZA 1CQZA 4ESOA 3P5SA 5CGQB 2Q3FA 1BGVA 3LPDA 4CM9D 2LUOA 3PG5A 3TEFA 3LL7A 4PFSA 2NXNA 1RI1A 3LDUA 4PY2A 1C9YA 1TYCA 2Q2WA 4M88A 5ECDA 4OUDA 2CMGA 4QBGB 3KBBA 4RZIA 4L2IA 1EVKA 3GZJA 3ESZA 4RMJA 2I7CA 3ZY6A 4BFSA 2XYQA 4DNXA 5A5DA 4JVOA 2W2PA 5IN4A 4URHA 3RT9A 3MLEA 2EJTA 1UXOA 1TA0A 3K0EA 2DT8A 4IQFA 4DA6A 2DCUA 3AUTA 4J1TC 4DN6A 2YJ4A 2WWYA 3FWYA 2HPHA 3EWIA 4PO8A 4AICA 4JQOA 2XF2A 3W5DA 4FYIA 3JVDA 3AINA 2A3RA 1YI8A 4CMAA 3A8TA 5E7MA 4F92B 1BX0A 1OHHA 1CQIB 5FUWA 1YJQA 4HG2A 1X7GA 1R15A 2AXPA 2FFJA 2UUPA 3LGAA 4ENVA 4ZCLA 5C7IO 1UMDB 3WP1B 4B8ZA 1K1EA 2QTNA 3QLVA 2HNKA 3JD1A 1XA0A 4K8OA 1P74A 5D87A 4RHEA 4K9DA 1IZYA 3AHEA 3R4VA 4FLMA 5EINA 5H80A 1WOYA 1YR9A 2P0YA 4JEUA 3UJ8A 4DC1A 3CLTD 3NRCA 5B3JC 3K0BA 2IXFA 4PZCA 2IHYA 3EXHC 2CNWD 3PYXA 1CIPA 4KRGA 4U39A 2E49A 5AM0A 5BV0A 3GBSA 4MJLA 1L4KA 1YHNA 2IFTA 4A1OA 1JSCA 4URFA 1B73A 1U94A 2FR1A 2VDLB 4K88A 3SNKA 4DNFA 1WUJS 3ISTA 2HSJA 1BFKA 5DI3B 4HVLA 1YE5A 6CHYA 3GLSA 1PR4A 2CGEA 5HRUA 2R96A 2PKQO 2Y1KA 2RCNA 2VBCA 3LX8A 4BTVA 1D2AA 1YO6A 3QH4A 5LWQA 2AE2A 2ZVQX 3PC3A 3GAZA 1VL5A 3AEXA 3IO5A 2EZTA 2EEPA 4ZZ3A 5IHPA 2QMUA 4EVSA 1RKVA 1USUA 2Y27A 2O20A 3VX4A 1DAGA 1XZCA 1SZPA 3ILYA 5IDWA 3LC7O 1D2NA 5A4IS 4LF8B 5TEVA 3T5DA 4Q05A 3WMWA 1CBUA 1HX7A 3WIBA 1TCAA 3IDSA 1LRJA 3L0BA 2K7ZA 3H11B 4FNGA 2W4QA 1TQ8A 4ZO4A 2FPGA 1V45E 2GR9A 3MUNA 1X7YB 2OZEA 1Z5GA 1SJ9A 1NBWB 2GAFA 1JHVA 3ENZA 4RLSA 1NG9A 1FFHA 1ZZGA 3PNYA 4QPNA 2IS6A 2A57A 2X9VA 4E5VA 1Y34E 1Z12A 2JS7A 3EIOA 1XZMA 2P4QA 1AKEA 1XX6A 1FCJA 2L17A 4FN4A 4JJ4A 5EQDA 2R6JA 3U49A 4ZKEA 3V34A 4EB0A 2VP5A 4LOJA 2VQFB 3O21A 3MQ2A 1XDDA 1N4AA 5LZ9A 1PFYA 3DZKA 3FUXA 4MMXB 4OSPA 2FPIB 2XD9A 4RF3A 1ZMTA 2GB4A 2H1RA 5NLLA 1O6ZA 3OLZA 3B9BA 2KLHA 3S8EA 2J3IA 3VHXB 3IRVA 1PSDA 2OAGA 2V0NA 4OQNA 4JI6B 2GD1O 5EHIA 5ALGA 3OQPA 1T1JA 1CF2O 5CVVA 3UHFA 5C8ZA 4ISCA 4K0KB 5EFOA 3CEPB 4BVAA 1JKXA 2X3UA 4OH7A 5JMOA 4ZU3A 3GJ6A 3C85A 2ZIFA 3PQ7A 3ZQ6A 2QL5A 3TG8A 4PGHA 2A1UB 4X1IB 4W1QA 1UFKA 1K2WA 2HEGA 5KDOA 2F59A 2F48A 3B1JA 4EYQA 2IW3A 2B0CA 5CFQA 3IO3A 4H3KB 2CVPA 4M46A 3GGPA 2FQQA 3F2VA 3RVOA 1XZIA 3HFSA 2CUTA 5KQMA 2BEUB 4LXXA 1P18A 1UKBA 1WY5A 4ZIRA 5KOJA 1EVLA 1Z75A 3NTUA 3GJ0A 2HMVA 3LO8A 4WXPA 1F3OA 2J07A 5BNFA 1OIWA 4MRMB 4UREA 5GOTA 3O38A 3SEZA 4UFOA 2CNDA 3HYCA 1RI2A 2ODEA 2COEA 3DCYA 1N2CA 2VK1A 2CVOA 2FUEA 4Q4HB 5IYZB 3UZUA 1SC6A 3IPCA 1Z5OA 4RANA 4ZVPA 2Z98A 3OH8A 3Q7QA 3CM0A 4Q0MA 3UWDA 3TTWA 2VDVE 1NSTA 5I7OA 1YR2A 5HCNA 2VC2B 2H92A 1NAIA 4FS8A 3WLSA 5EMJA 1I9GA 4EX6A 2E85A 2REBA 5FTWA 3IPRA 4ESHA 3N9IA 4P3KA 1OASA 3OAAD 4MWGA 4QYIB 4U0JA 2C4UA 3KR0A 4C7OB 3CWQA 3N3BC 3MBOA 4R0MA 2BM8A 4BOYA 2ZSAA 3KEOA 1UOPA 2IHVA 4CMIA 4GNRA 4IJMA 2Y1XA 3OCJA 2NWQA 2YHIB 5JY6A 2DXIA 4KSCA 4TLLB 1O97D 2H4YA 4W9NA 1IHDA 3KXPA 3NFYA 4YRKA 3P2EA 1TF5A 2PNJA 5JNUA 1S89A 1O9HA 1OFVA 3AZQA 4P3YA 5K0GA 1GEEA 3G85A 3DEZA 3LYUA 4HBGA 1GQ2A 2IWRA 3DHVA 3LLCA 5HKKA 4EA9A 4B3XA 1GP2A 2HI0A 4TYNA 2DUUA 3T5GA 4P58A 3FFXA 2PQ0A 3NHYA 2P9CA 3OMLA 4DVGA 1X8XA 1EFRA 1JLHA 1C7RA 3FYUC 4PCUA 1CRLA 2IUTA 3HI6A 2V7XA 1YRWA 5TSDA 3T1VA 1T4GA 3ZI4A 3E48A 2UYHA 2LWIA 1SY7A 1T10A 3P4YA 3Q7EA 2HK8A 4CUJA 3RVQA 4KO2S 1V11B 2DT5A 3L7DA 2QVZX 1XD8A 1QHEA 4UOEA 1NN1A 2QVBA 2FTKE 1UQRA 2WU1A 3AQ4A 2YJ6A 1U6KA 3ROFA 1ZM7A 3GFBA 1QYWA 1V3QE 3HJCA 2JB9A 3IIEA 3NW9A 5ENVA 3TTUA 3UOGA 2F4VB 1QTRA 2GBLC 2YC4C 1C7ZA 3CJQA 3PC6A 3ZXIA 1Q15A 4PYIA 4R2WA 4E6PA 4PZLA 5EMMA 2ZE5A 5BYJA 3KQOA 3SR3A 2DBZA 3UCEA 5C32A 3H0KA 1DE0A 4IIDA 1K6MA 1XEFA 4TV9B 2Q62A 1JNYA 1Z5WA 4EG0A 4DSTA 3QBVA 4LZPA 1M6EX 1SWWA 1XMIA 5KDLA 4BTLA 2GBCA 4IVQA 4UATA 3OFND 1UL1X 2EZ8A 2YIJA 2O2YA 3RK0A 3TI9A 5KC8A 1SQSA 1QKIA 3C24A 3RSQA 4DWJA 3H13A 4PYQA 1TQ6A 4KGVA 4D56A 2Q41A 2B99A 2VZ0A 3HUFA 4N3NA 1TIKA 1MAUA 1RC8A 2W2KB 3GELA 1UBTS 1QKKA 3UK0A 1VL1A 1DX6A