2M6YA

The solution structure of the j-domain of human dnaja1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily A member 1
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2m6yA01
4J80A 2QWNB 3AG7A 1NZ6A 1GH6A 3UO2A 4RWUA 2QWPB 4J7ZA 3APQA 2CUGA 2N04A 1BQ0A 2QSAA 1N4CA 1XBLA 2L6LA 2CTWA 2CTQA 2LO1A 2QWOB 3APOA 2OCHA 2QWRB 1FPOA 2KQXA 2PF4E 2Y4UA 2YS8A 2LGWA 2CTPA 2DN9A 3BVOA 3UCSC 3UO3A 1BQZA 4IT5A 2N05A 1HDJA 2Y4TA 2DMXA 1WJZA 2EJ7A 1IURA 2GUZA 2CTRA 2GUZB 2M6YA 1FAFA 2YUAA 2QWQB
chains in the Genus database with same CATH superfamily
3DSQA 4F6EA 4RO2A 4DUYO 3A8TA 1I94O 1TA8A 4X62B 1PKXA 4J11A 4P2ZA 2W0XA 1OZ0A 3CWBH 2LW7A 1SF9A 5C8YB 1SETA 5IYZA 5L3CA 4ASUG 4CZZA 3K5LA 1EZJA 4DV3O 2Q7EA 4J80A 2E3CA 1MZFA 4KXRA 1YITV 1ZWIC 4DR6B 5CB4B 1JJOA 2XAQA 4BWAA 1Y66A 1THZA 2KB1A 4X66O 2AXTZ 2Y69B 4Z1MG 2JDIG 2ZR3A 3C3SA 1L0NH 4NXNO 1GO3F 2ZDIA 1H2LA 1OCOB 2R72A 1D5AA 1VQ7V 3STZC 5BMVB 3DC5A 4MS2A 1GAXA 4FMTA 2Q4PA 3IC7A 1VEWA 3OM3B 4CC5A 4DR7B 5LGTA 1EN4A 5CMUA 2HJDA 4NR1A 5FPOA 4UCTA 1Q81W 3AG2B 2RJZA 3F7VC 4I7ZB 1SQGA 4ZKIA 4IYHA 5LHHA 4GYCB 1M56B 2GUZA 4ZBMA 1SESA 2DW4A 2BTQB 3W7XA 4DR6O 2EZOA 4ZHQA 1O9HA 2RMKB 1KD1W 1M1KW 4PA3A 4D7TA 1R73A 3OMNB 4KHPO 3OMIB 4O4LA 4JTAB 2Q67A 5LMUO 3AK1A 2UUCB 3RYIB 4YJ2A 3UCSC 2WLLA 3PJSK 5TISZ 2X6AA 4PDMA 2QGNA 3CCRV 3JD3A 4JZ2A 4U3JB 5CA1B 1V9PA 4JF3A 4ZOLA 4GLXA 1BT8A 1ORQC 2E75B 3KCYA 2PTMA 1YCIA 1JFFA 1PP9H 4DXWA 2DE0X 4DR3O 4CS4A 1S77D 3FB6C 2JIZG 2IJJA 4NKGB 1PPJH 5LA6A 3LDEA 2Q8VA 3OFNG 5CBHA 4X89A 1PNMA 2ZIOA 3H9VA 2YI9A 5KA6A 1N0NA 3ABLB 1JQ0A 1M9NA 2QTSA 3B8NA 3T1HO 4OGQB 4MTFA 2ZCEA 4DV1O 1NU1H 1K8AW 1Q6HA 4X65O 4DUZB 2CK3G 1KYOF 4B3RO 3VQVA 5C8YA 5IYZB 4GX5A 1IBMB 1K4DC 5KUMA 4MVZA 5KX5A 2DYSB 2HFEC 1N32B 5CB4A 2B9ZA 2IJHA 1RM1C 1UPGA 2OCCC 1KP2A 3HKDA 3AK3A 3J7AU 1VQNV 4CS2A 4FM0A 2KKWA 3EHBB 3RGBA 4J9ZB 1K33A 4MVUA 2EILB 2ITCC 4DR5B 4B7KA 1VF6A 2K9PA 4RAIA 1QU7A 5KAIZ 4KUMA 5IJ0A 3UT5B 2QKCA 3S3XA 1DF5A 3H1IH 2WAMA 1WN7A 1HNXB 4LF5B 2EZPA 3AG7A 1IBLB 4J7JA 3RFRA 4DV0O 2B5UA 1US6A 2BTQA 2ETNA 3L9DA 2XAFA 3LDCA 4YJ3A 1H38A 4FFBB 4NTXA 1XDCA 1FXKC 1FFXA 4JI2O 1HNZB 2FTKA 4L8JA 3RYIA 4R6ZA 4MVOA 1F23A 2LFSA 2ODMA 2WLLB 4BW9A 2Z0AA 3HKCB 4DV4O 2OTJV 1NZ6A 1OCZB 2K1EA 3O9OA 2N04A 4MTXA 4X1IB 1Y74B 4NVPA 1VQ5V 1EN5A 4UCSA 4WBNB 3OTOB 2AHZA 5GONB 2DYRB 1N32O 3D3QA 1Y67A 3CCLV 4JI6B 4BIUA 2ITDC 1S5HC 3OR7C 3KZIZ 4DR5O 4R8CA 4YIOA 1IBMO 3KG2A 4JI4B 2ZE6A 1PV0A 4LWSA 1SA0B 2QKSA 2QM4A 2JRIA 3CCSV 5JCOC 5KLVH 4PA6A 5EZYA 1VF7A 3ASNC 2EINC 4J42A 4DR3B 4I0XA 5IJ9A 1XHXA 1IZ3A 1PD3A 4TQDA 2A3QA 3KKYA 4PDLA 3H1LH 5JQGA 2E5LO 1J95A 5KMGA 1G1XB 4H13B 5FNVA 3HKBA 4AHCA 4MVMA 5BMVA 4ICGA 1M57B 1GH6A 3DXRB 4LBEC 1YI2V 4EFBA 1QVFU 3U11A 4DR4O 3ABLC 1HWYA 2XTAA 2CTQA 3H01A 3ZRWB 4MVQA 4YHHB 4E4EA 4FJCC 5LGNA 1XREA 5JWPA 4B3SO 1KP3A 2Q73A 3FAVB 1Q7YW 3ETEA 2DJVA 2UXCO 1XNQO 4LH7A 4JI8B 3QG5A 4FFKA 3RYHB 2F23A 2WSSG 1JJ2U 3SJQC 2UUBO 3JAKA 4JI0O 5IWAO 3L74H 4O4JB 2ZE5A 1RM1B 1FS0G 3WB0A 4DUZO 3M8AA 4ZOLB 5LL6Y 1JX9A 2H94A 4GX2A 5J2UB 2QKAA 4GKJB 1NQTA 4OPAA 5L3GA 1OV9A 2IBZH 5LMNB 3K59A 1RPRA 2OCHA 1MSWD 4FPPA 3CRMA 1KQSU 1CP9A 2P4KA 1F4NA 2YIBD 1NH2D 1VQOV 4K8ZA 3JAWA 1NS1A 3TXSA 2ATKC 3SPJA 5K1PA 3F5WC 5LHGA 1HR0B 1NR1A 4WBNA 3K5NA 2VWJA 5LMNO 3WB2A 4UB8Z 3CCVV 2CH7A 5B1BB 2IH3C 1MNGA 5LXTB 4LCUC 1GN6A 5EC2C 2Q7HA 1VQPV 3R65A 1FXKB 4HAMA 1KBHA 1DLBA 1R3IC 2ILMA 3M99B 4G28B 3CMAV 2UUAB 1K97A 3CRCA 1AB3A 4XDJA 4JAUA 1SRYA 2DQ3A 5KX5B 4NYKA 4I0XB 2Y0PA 4AQYO 1FKAO 4CBCA 3RYCA 2UXCB 2WLMA 4P9OA 1V55B 3UO3A 2A79B 2XHBA 5FPRA 3HKDB 1DTOA 2KG7A 4DYLA 2E74B 3TGUH 2RN9A 2D3OW 3OE7G 5JVDB 3SR2C 2GSMB 2GTAA 4DR1B 2VQFO 5CA3A 2QEXV 2QE7G 4O4HA 4HYOA 3SYPA 1HNWB 4H33A 1DF4A 4JV5B 4MTGA 5B3SB 2CE4A 3AG4B 3LUTB 3X2QB 2EX3A 3U0ZA 5CBFA 1R3KC 3ASNB 1H8EG 1SC5B 2F1MA 4DV2B 4LFAO 2FL4A 2XAJA 4DV7O 5EYPB 4EB6A 5CBGA 5L3EA 4HZ3A 4UUJC 1VARA 1SZTA 3UQ8A 2VQEO 5ITZB 1SZXA 1BQ0A 1LR1A 4X1YB 4YJ3B 3OEEG 1VF5B 2PF4E 3CJHB 5FLXN 4AILC 3CEIA 3K0DA 4XBFA 3H1JH 3TK1A 4PA7A 4UCVA 4QJFB 3HKCA 3RT3C 2QM8A 5E1AC 3OTFA 3HKEA 5HFMA 3F5TA 3SYAA 2BSKA 2LJ2A 1M57C 1BMFG 3CXCU 4IHJB 3E8FA 3CSXA 4X1IA 1YTFB 2QWOB 1HP8A 1FPOA 3G80A 1I5XA 4K0KO 4I5SA 4LFBB 3AG2C 1VF6C 5DEDA 4CH3A 1QBZA 1Q86W 2DOSA 4QPKA 1MZEA 2LGQA 4OX9B 4FK5C 1CPYA 1VQLV 3L73H 1XQ8A 1K7DA 1GKFA 3QNEA 3K58A 4B08A 3G6BA 2FB5A 4Z1VA 4LF8B 4AQYB 2UXDO 4FLTA 1R3JC 1Q6UA 4LH6A 3RYCB 4DW0A 2Q9LA 2YIDA 3A2FA 4DRXA 1UJWB 5CA0A 1ZL8A 3O65A 3T4ZA 5LMUB 2BTOA 2DWEC 1XNQB 1BHAA 4QGPA 4RUFA 3RVYA 4HNAA 4K8XA 3DC6A 5K1XA 4L87A 3H1HH 1Z5VA 2AGAA 4JV5O 1I5YA 2JJ1G 4X20A 5LHIA 1HW7A 2YXHA 2XAGA 1MG1A 2X7RB 4JI7O 3IAYA 2B1GA 4DW1A 5GTIZ 3BCCH 1AI6A 1GK9A 4O4HB 1SQVH 2YICA 2ZKOA 3CMEV 3MHHC 1XMQB 1LUVA 3T1YO 1WJZA 4PA4A 1K4CC 3QTCA 1P7GA 5JCOA 3CS5A 2QWNB 1T5EA 2Q7GA 1N0JA 2VRZA 2WLKA 3JASB 2P90A 1KC8W 3E2EA 4J7ZA 2RDCA 5KA5A 2P7TC 2F43G 2NLJC 2PGGA 4DV7B 3P3PA 3LSSA 3AG1B 1W2BU 3TXQA 1JFFB 1G4YB 2BSKB 2IU0A 5A2QN 3VQWA 1VQMV 4JAVA 4W4LA 3T1CA 3OR6C 4GCZA 5J2UA 1SQXH 5JJEB 4RQFA 2B1IA 2JEXA 2YI8A 3OEHG 1H8HG 3RYFB 4W4KA 3BHPA 1RSOA 1WP7A 2ZQMA 1L0LH 2EBOA 3T2MA 3ZX6A 2YXLA 4IHJA 5B3SC 4LF4B 3JATB 1YIJV 1S0VA 1FD9A 3X2QC 1JPXA 1AR4A 3B2EE 2HVKC 1FAFA 2PUSA 1XNRB 2EIKB 2BOCC 4LFCO 3BA8A 4FZ1A 2JS3A 4FLUA 2F4VB 1N4CA 1XBLA 5JH7B 1BL8A 1R6TA 1B3QA 1ZL8B 1D2DA 1AI5A 1IDSA 3ABKC 2EIJB 4K35A 4G27B 4JI8O 2OTLV 2ZXWB 2FKXA 2FMLA 2G38A 4LP8A 3T1YB 1R6NA 1H2SB 4N23A 3QO8A 1W59A 4ZI7B 4PDRA 3JSLA 4JI1B 1H2MA 2M6YA 2ZR2A 3JARA 4U7NA 3MD0A 2IH1C 4DR1O 4RWUA 4IL6Z 3OGIB 2DWDC 5KHIA 1VQ6V 3GVMA 2GTSA 3R66A 3GB7C 2Q68A 1Y6XA 1ZUQA 1WAZA 2P4VA 3ASOB 4ABMA 2AW9A 4O4IA 5LP6B 4I9WA 4JI2B 4DV4B 3ABUA 3OAAG 1MA1A 3EXAA 1P7BA 4BAYA 3G4SV 3ZMVA 5B1NA 2JGDB 1R1BA 2KQXA 1K73W 1YVWA 2WA3A 1SERA 3RVZA 3EFFK 1GN2A 5IYBO 4WFFA 5EBMC 2P67A 1YTFD 1OCRB 4JZGA 1WPBA 3CRAA 1AVMA 2FYUH 1YEWA 2R9RB 3QO5A 4PI2A 3ZRVA 4GT1A 3DGEA 2CGOA 3EVKA 4O2AB 3FB8C 2JJ2G 1IBKB 2F93B 5C93A 1Z5WA 2QTOA 1SA0A 4I9QA 3B8MA 2P6JA 5H2FZ 3E22A 3FKSG 2HP8A 3JALB 3AG1C 4XDKA 3G71V 4I50A 4LWSB 3SYOA 5DM6V 4CH5A 5L3BA 2OT5A 1IXBA 1QR8A 3SJBC 3W7TA 2X6CA 2YUAA 4TUYB 2C2AA 4PA9A 1IBLO 4GKKO 3K03A 4FVMA 4MT8A 5KMGB 4B3RB 2QWPB 3S3WA 4HNAB 2HEPA 2R9AA 4A5UB 1WB8A 1EFRG 2VQFB 1MABG 3E8BA 2HJFC 2DQ0A 4NTWA 3MHSC 4QIWF 1AI7A 2GHYA 1Y76B 3G6EV 2BE3A 1H2KA 4J10A 1CXZB 4UCOA 3A0BZ 2LP7A 3HKBB 5H6QA 2ZT9B 3G67A 3K3WA 4HBNA 1FXVA 4UCRA 4IIJB 1OCCB 4C7UA 5HFLA 1EBOA 3N2GA 1N34B 3CCMV 1QHTA 2Y4TA 5KHJA 5IWAB 4JI0B 3FAVA 2IM9A 4LF7B 1P84F 1U96A 1AP5A 3IC9A 4TV8B 1F7YA 3JAKB 1R3LC 1I0HA 2QSAA 2JVDA 3OW2U 1V55C 1L1FA 3GWKC 4F4LA 4JYCA 2HHHB 2RNBA 5IDJA 3Q4HA 1PM9A 4DR2B 1VIBA 4O4JA 5BXZA 1WB7A 3BPZA 2XAHA 3A0RA 3JAWB 1OJHA 5IE9A 1CEZA 1GTOA 5LGUA 1QCEA 4TQFA 1GM8A 2Q0AA 3AG4C 3D36C 3CC2V 2YXYA 1WA8A 1X4TA 4JTDB 2E76B 1TUBA 1D5NA 4NB5A 1ENVA 4FIPC 1IURA 1FFTB 4LF4O 5LP6C 4O2AA 1VP7A 2HLDG 1YJWV 3ZN1A 4I55B 5LOVA 3KCXA 1VMGA 1NR7A 2YSUB 1GM7A 5CN0A 1TVKA 2OIEA 1J5EB 3E35A 1MOFA 3B40A 4X88A 4F6RA 1QLNA 1XOUA 1AJPA 4B7EA 4LF9B 2UXXA 3JSNA 1RP3B 4JTCB 2VWKA 2H3OA 1OCRC 2RQ6A 1GN3A 5JVDA 1M4UA 4WFAV 4BR6A 2PYJA 1BGYH 4FLVA 2V4DA 1G6UA 1FXHA 1K34A 1E79G 4FLYA 4JGSA 3IJ4A 2V7QG 2ZE7A 1IVSA 1KMIZ 1VQ9V 4TV9B 4DV6B 4EEQA 1Q3EA 1YDXA 2XASA 2WLJA 2UXDB 3N27A 1K9MW 3ZHVA 4ZHQB 1NVPD 3W7UA 2ZNJA 3T4DA 1N34O 4QE7A 3VQXA 2IW5A 5EK0A 1V54B 1KU9A 4JYYA 4D7SA 5DN6G 2NNUA 4WCEV 2ZINA 4FFBA 2YEVB 1BQZA 4X1YA 2GDSA 4TOIA 3MAQA 2WLNA 1Y74A 3UKMA 3QVNA 4BIZA 3SGIA 5GONA 1WLEA 4DUYB 1SQFA 1I94B 4J7KA 3P32A 1WA8B 5KUKA 3E8GA 4DV5B 1Z2GA 4FLZA 1M90W 4FZ0A 3BY6A 1OCCC 2F66C 4H44B 3JD2A 4NXNB 1RPOA 3OMAB 3B4SA 1OHHG 1RFYA 1E1RG 3ABMC 4IYIA 2A7WA 1TVKB 3F7YC 4R50A 1TUBB 1JVMA 3OT7A 1GRJA 3K9SA 4PI0A 2KSDA 4GKKB 3ZRSA 4DO2A 3FB7C 4WFBV 4I50B 4H37A 2QA4V 1NKDA 3ABTA 4MW3A 5DECA 1W0KG 1NVPB 1YHQV 1PL4A 2PYLA 5KHGA 3K79A 1H2GA 2N74A 3CXHF 3ZS8C 1XILA 3CCUV 3BA9A 3ZMZA 2CAZC 5H9CA 1S76D 3K9AA 1I08A 3D8CA 4DK0A 4YHHO 2V1DA 1X59A 5BZBA 1BE3H 5JQGB 4DV2O 4LFAB 1K92A 5KHKA 4TV9A 3SYQA 1NTZH 4NTYA 4GKJO 2ADPA 3HB3B 2EIKC 2ZNIA 3HR0A 4TSFG 3DXRA 2A06H 4G2KA 1E1QG 3N2GB 4X64O 3K57A 1FFXB 4GUNA 4PV1B 3ABKB 4JYAO 2EIJC 2WLIA 3CE2A 2ZXWC 3L75H 3VBBA 2UXBO 1ZSPA 1XMQO 2W6JG 1BCCH 2CTWA 5JJNB 3CCQV 3RW0A 4JI1O 3BVOA 4EFEA 3Q4HB 1HNWO 2F95B 4JYBA 5EIBC 1AR1B 3CRRA 3GWOA 4NXMB 5J9PC 2ADQB 2QR4A 2QDOA 4RUEA 3ZJZA 4X62O 3RYFA 4DV6O 1B6QA 4U3FH 4X8AA 3JATA 4LFCB 2X0LA 4LNUB 4K3AA 4CH4A 1BZKA 3TCUA 1XNRO 1A32A 1XL4A 3BRCA 1YJNV 3ZHTA 3HPLC 2CH7B 1RSOB 3ASOC 3AK2A 4R7CA 4NXMO 3ETGA 4E2LA 3CP1A 2Y48A 5EIBD 2UUAO 3CB2A 4MSWC 4CS3A 2LFRA 3B77A 2Y0IA 2HR3A 2OYQA 3A0HZ 1GN4A 4Q20A 4PHZA 4BW5A 4KP4A 3NXSA 3I5DA 1AR5A 2UUCO 4B3SB 1SQQH 3K5MA 1FXKA 1N33B 1DGSA 4J9YB 3JAMN 2WA4A 3BFRA 3TJTA 3AEIA 3E86A 1PNLA 4CH6A 3W7SA 2CTRA 5L3DA 4WFEA 3BABA 4OX9O 1HR0O 3K04A 1YSCA 3ZMUA 2WWWA 4OXSA 5JJJB 2WLHA 1S3JA 2CTPA 5B1OA 1Q6IA 1QR9A 2Z3YA 3IGAC 3I56V 3D36A 4KFMA 4ZI7A 4JI5O 4D6TH 5BR8O 3I55V 1XEQA 1JR9A 3APQA 4JI7B 2W0FC 2AZ2A 4DR4B 1ROPA 2MK3A 1Q82W 1F51A 1Q90D 1K3EA 3M7MX 2ZD9A 4O2BB 2WPDG 1BHBA 3AG3B 1NI8A 4X66B 4GX0A 4LF9O 5KAFZ 1XMOO 1JA8A 1L8DA 1NT2B 3L70H 1ZTEA 2EJRA 4O4LB 4TT3G 3RYHA 2W6IG 4DV0B 4DV3B 2Q6AA 2EULA 3OD4A 1P4RA 1MSDA 4P9PA 4X65B 1Y4MA 1XHZA 3CC4V 2QWRB 2PY5A 2OWOA 4IGGA 4IT5A 2IU3A 4UXNA 4LFBO 3ZRXA 3J81N 2RCVA 3CRQA 1QNMA 1KUQA 2PZSA 3SJAC 1Q8IA 1OCOC 1XUQA 2ZM6O 1N36B 3LSUA 4UCUA 3SPCA 3D3IA 4LNUA 3QF7A 2N05A 4LF8O 2BOBC 1HNZO 3JCZA 3CPWU 3CX5F 1S5LZ 3E22B 2JS5A 5LXTA 1FYJA 4FLWA 3FX7A 4YY3O 2XT9A 1N8RW 1YF2A 4GZRB 4UFZA 5GW7A 4DRXB 2AZ0A 2A9HA 4WFGA 5IY5B 2P06A 5LYJA 4KHPB 1G8MA 4PJ0Z 4TUYA 4MVRA 3FYEB 4H0LB 3UM7A 1QLEB 4JI3O 5E79Z 4JI6O 5B5EZ 2Q69A 4FM1A 2VQEB 3UT5A 3SYCA 3P3NA 2ZIMA 2LO1A 2D2CB 4UVAA 1EN6A 1TAEA 4U7OA 5D5PA 2UXNA 2R70A 4GX1A 1HDJA 2XOKG 3IFXA 1VQ8V 3K0GA 3DTUB 4DV5O 1JMKC 1Y76A 5IJ0B 4MTOA 2LW1A 4DK1A 4QE9A 1R6KA 3VOUA 2MW2B 5IYCO 4B3TB 4FM2A 2Y4UA 2YIAA 3H1KH 1F4MA 1ZX3A 2L35A 4PD4F 3ZN0A 3LNMB 1LUWA 2WLIB 5IYDO 4EB6B 4PELA 2YIBA 2Q0OC 3RBZA 3LDDA 4CC6A 2AHYA 1AP6A 2HKOA 3ETDA 4YIPA 4P30A 1UFIA 2QM7A 4YY3B 1JOYA 2HVJC 5B1AB 3CJHA 2PI4A 1IXMA 3ZCCA 1SQBH 5H6RA 1KECA 3BEHA 2HG5C 3OUSA 4TV8A 2ZDIC 3L71H 5B66Z 3NR7A 2BCCH 5AG2A 5BR8B 5BY1A 1TGOA 4UB6Z 4WF9V 2EILC 5F2VO 1TUEB 2UU9B 4JI3B 3N2KA 1GMGA 4RQEA 1PNKA 3C3TA 1J5EO 3WFVA 2NR5A 4I55A 5LOVB 3AG3C 3OUFA 5EBWC 1ZAUA 4UV9A 4UVCA 1NTMH 5JH7A 2ZE8A 3BAAA 5IJ9B 2IJIA 3SPIA 3CHXA 3L72H 1I7FA 1V54C 3K5OA 3FYIB 4X9QA 5CA0B 3JD1A 1Q43A 5LYJB 4F6RB 5EZYB 4DR2O 3JCUZ 4QPJA 4UV8A 1LNQA 4FLXA 2EIMC 4B3MO 2XUMA 1AJQA 1JCHA 3ZEDA 1XMOB 4JYAB 4JAAA 2XNDG 5H5NA 2O57A 1W0JG 4X20B 5GTHZ 3K08A 4LF7O 3LNNA 5FNVB 2JGUA 1YJ9V 3WG7B 3VQYA 1SQPH 2ZM6B 1OCZC 3ZRWA 4MW8A 4TWKA 1P49A 4I4TB 2X6BA 2VS0A 3ABMB 1URFA 4YXWG 1IX9A 3CYOA 2DYRC 3LSQA 5A9GA 3SDLA 2GUZB 3ZIAG 2LQTA 3JASA 1M93A 1H2NA 1U97A 2L6LA 5EC1C 3JYCA 4O2BA 4Z2WA 1N33O 2DN9A 3ZMTA 2JK5C 5IY5C 1EM1A 2HHHO 1B04A 2IJKA 4J41A 3STLC 2E5LB 2DMXA 4JI4O 1DK1A 2Z5UA 3QO7A 1PL0A 1KB9F 2EJ7A 4UVBA 2EINB 5J2TA 3THOA 2QWQB 1YZBA 3E8HA 1S72V 1QLEC 3E83A 2UUBB 1AI4A 2F4VO 1FJGO 2YEVA 3JD0A 3FFQA 3RWRD 3APOA 2Y69C 1B06A 1M5IA 5LA6B 2QJ1A 2YS8A 3TETA 4DR7O 1NTKH 2UU9O 3SPGA 3OGCC 1EZVH 1S5JA 4OPHA 1K5QA 3J80N 3N2KB 3SJCC 1NBMG 3FB5C 3ZBHA 3WU2Z 1O9GA 1GM9A 2GV9A 3B09A 4X1KB 4N21A 1VQ4V 3K06A 1COWG 4B3MB 2CGNA 1M56C 1FJGB 3JALA 2PI5A 1NJIW 2OIGA 5FL7G 1YXBA 2GBOA 1XL6A 4BIOA 2UXBB 2A0LA 3ZHQA 1Q5OA 5LBQA 1K5SA 4LF5O 1IBKO 2R9IA 5B1AC 5KHHA 1HNXO 4PDVA 3WB1A 3E89A 3JD4A 5D5QA 3CD6V 1SKVA 4ZIBA 4K0KB 4LC1A 4JPRA 2NN4A 1KKCA 4LF6B 5L3FA 3U10A 4AI8A 2P5OA 2M7WA 1MMMA 1XI1A 2H8PC 4JI5B 2KG7B 4Q6GA 4MVSA 1WNSA 3ZHUA 1BSMA 1AROP 2LGWA 3ICXA 4IIJA 4JASA 3CCJV 3ETQA 3ZMSA 4QNHB 3JARB 5EYPA 1KKDA 4O4IB 2YC0A 4I4TA 5LP6A 3CCEV 1QVGU 3OTOO 2JEUA 4LR3A 4WFHA 1VQKV 2CDYA 4KL1A 3SPHA 3CC7V 3RN4A 5B1BC 5ITZA 4EKWA 3ZHRA 3ZHSA 4U3JA 5CA1A 1BS3A 2EIMB 3W7WA 1AILA 5IT9N 2Q5ZA 3HKEB 1NH2B 4B3TO 4X64B 4YJ2B 3FD9A 2JGDA 3ML0A 3WG7C 3UO2A 2YDEA 3PN1A 5J2TB 2DYSC 2CUGA 2ARHA 3MDSA 1AJNA 3C90A 1QQCA 1ZLZA 1WP8A 2OCCB 5EBLC 1N36O 3P30A 4LF6O 4DV1B 4XDLA 1WPXA 4X1KA 1SS3A 3T1HB 2P22C
chains in the Genus database with same CATH topology
4J80A 2QWNB 3AG7A 1NZ6A 1GH6A 3UO2A 4RWUA 2QWPB 4J7ZA 3APQA 2CUGA 2N04A 1BQ0A 2QSAA 1N4CA 1XBLA 2L6LA 2CTWA 2CTQA 2LO1A 2QWOB 3APOA 2OCHA 2QWRB 1FPOA 2KQXA 2PF4E 2Y4UA 2YS8A 2LGWA 2CTPA 2DN9A 3BVOA 3UCSC 3UO3A 1BQZA 4IT5A 2N05A 1HDJA 2Y4TA 2DMXA 1WJZA 2EJ7A 1IURA 2GUZA 2CTRA 2GUZB 2M6YA 1FAFA 2YUAA 2QWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J80 A;  2QWN B;  3AG7 A;  1NZ6 A;  1GH6 A;  3UO2 A;  4RWU A;  2QWP B;  4J7Z A;  3APQ A;  2CUG A;  2N04 A;  1BQ0 A;  2QSA A;  1N4C A;  1XBL A;  2L6L A;  2CTW A;  2CTQ A;  2LO1 A;  2QWO B;  3APO A;  2OCH A;  2QWR B;  1FPO A;  2KQX A;  2PF4 E;  2Y4U A;  2YS8 A;  2LGW A;  2CTP A;  2DN9 A;  3BVO A;  3UCS C;  3UO3 A;  1BQZ A;  4IT5 A;  2N05 A;  1HDJ A;  2Y4T A;  2DMX A;  1WJZ A;  2EJ7 A;  1IUR A;  2GUZ A;  2CTR A;  2GUZ B;  2M6Y A;  1FAF A;  2YUA A;  2QWQ B; 
#chains in the Genus database with same CATH topology
 3DSQ A;  4F6E A;  4RO2 A;  4DUY O;  3A8T A;  1I94 O;  1TA8 A;  4X62 B;  1PKX A;  4J11 A;  4P2Z A;  2W0X A;  1OZ0 A;  3CWB H;  2LW7 A;  1SF9 A;  5C8Y B;  1SET A;  5IYZ A;  5L3C A;  4ASU G;  4CZZ A;  3K5L A;  1EZJ A;  4DV3 O;  2Q7E A;  4J80 A;  2E3C A;  1MZF A;  4KXR A;  1YIT V;  1ZWI C;  4DR6 B;  5CB4 B;  1JJO A;  2XAQ A;  4BWA A;  1Y66 A;  1THZ A;  2KB1 A;  4X66 O;  2AXT Z;  2Y69 B;  4Z1M G;  2JDI G;  2ZR3 A;  3C3S A;  1L0N H;  4NXN O;  1GO3 F;  2ZDI A;  1H2L A;  1OCO B;  2R72 A;  1D5A A;  1VQ7 V;  3STZ C;  5BMV B;  3DC5 A;  4MS2 A;  1GAX A;  4FMT A;  2Q4P A;  3IC7 A;  1VEW A;  3OM3 B;  4CC5 A;  4DR7 B;  5LGT A;  1EN4 A;  5CMU A;  2HJD A;  4NR1 A;  5FPO A;  4UCT A;  1Q81 W;  3AG2 B;  2RJZ A;  3F7V C;  4I7Z B;  1SQG A;  4ZKI A;  4IYH A;  5LHH A;  4GYC B;  1M56 B;  2GUZ A;  4ZBM A;  1SES A;  2DW4 A;  2BTQ B;  3W7X A;  4DR6 O;  2EZO A;  4ZHQ A;  1O9H A;  2RMK B;  1KD1 W;  1M1K W;  4PA3 A;  4D7T A;  1R73 A;  3OMN B;  4KHP O;  3OMI B;  4O4L A;  4JTA B;  2Q67 A;  5LMU O;  3AK1 A;  2UUC B;  3RYI B;  4YJ2 A;  3UCS C;  2WLL A;  3PJS K;  5TIS Z;  2X6A A;  4PDM A;  2QGN A;  3CCR V;  3JD3 A;  4JZ2 A;  4U3J B;  5CA1 B;  1V9P A;  4JF3 A;  4ZOL A;  4GLX A;  1BT8 A;  1ORQ C;  2E75 B;  3KCY A;  2PTM A;  1YCI A;  1JFF A;  1PP9 H;  4DXW A;  2DE0 X;  4DR3 O;  4CS4 A;  1S77 D;  3FB6 C;  2JIZ G;  2IJJ A;  4NKG B;  1PPJ H;  5LA6 A;  3LDE A;  2Q8V A;  3OFN G;  5CBH A;  4X89 A;  1PNM A;  2ZIO A;  3H9V A;  2YI9 A;  5KA6 A;  1N0N A;  3ABL B;  1JQ0 A;  1M9N A;  2QTS A;  3B8N A;  3T1H O;  4OGQ B;  4MTF A;  2ZCE A;  4DV1 O;  1NU1 H;  1K8A W;  1Q6H A;  4X65 O;  4DUZ B;  2CK3 G;  1KYO F;  4B3R O;  3VQV A;  5C8Y A;  5IYZ B;  4GX5 A;  1IBM B;  1K4D C;  5KUM A;  4MVZ A;  5KX5 A;  2DYS B;  2HFE C;  1N32 B;  5CB4 A;  2B9Z A;  2IJH A;  1RM1 C;  1UPG A;  2OCC C;  1KP2 A;  3HKD A;  3AK3 A;  3J7A U;  1VQN V;  4CS2 A;  4FM0 A;  2KKW A;  3EHB B;  3RGB A;  4J9Z B;  1K33 A;  4MVU A;  2EIL B;  2ITC C;  4DR5 B;  4B7K A;  1VF6 A;  2K9P A;  4RAI A;  1QU7 A;  5KAI Z;  4KUM A;  5IJ0 A;  3UT5 B;  2QKC A;  3S3X A;  1DF5 A;  3H1I H;  2WAM A;  1WN7 A;  1HNX B;  4LF5 B;  2EZP A;  3AG7 A;  1IBL B;  4J7J A;  3RFR A;  4DV0 O;  2B5U A;  1US6 A;  2BTQ A;  2ETN A;  3L9D A;  2XAF A;  3LDC A;  4YJ3 A;  1H38 A;  4FFB B;  4NTX A;  1XDC A;  1FXK C;  1FFX A;  4JI2 O;  1HNZ B;  2FTK A;  4L8J A;  3RYI A;  4R6Z A;  4MVO A;  1F23 A;  2LFS A;  2ODM A;  2WLL B;  4BW9 A;  2Z0A A;  3HKC B;  4DV4 O;  2OTJ V;  1NZ6 A;  1OCZ B;  2K1E A;  3O9O A;  2N04 A;  4MTX A;  4X1I B;  1Y74 B;  4NVP A;  1VQ5 V;  1EN5 A;  4UCS A;  4WBN B;  3OTO B;  2AHZ A;  5GON B;  2DYR B;  1N32 O;  3D3Q A;  1Y67 A;  3CCL V;  4JI6 B;  4BIU A;  2ITD C;  1S5H C;  3OR7 C;  3KZI Z;  4DR5 O;  4R8C A;  4YIO A;  1IBM O;  3KG2 A;  4JI4 B;  2ZE6 A;  1PV0 A;  4LWS A;  1SA0 B;  2QKS A;  2QM4 A;  2JRI A;  3CCS V;  5JCO C;  5KLV H;  4PA6 A;  5EZY A;  1VF7 A;  3ASN C;  2EIN C;  4J42 A;  4DR3 B;  4I0X A;  5IJ9 A;  1XHX A;  1IZ3 A;  1PD3 A;  4TQD A;  2A3Q A;  3KKY A;  4PDL A;  3H1L H;  5JQG A;  2E5L O;  1J95 A;  5KMG A;  1G1X B;  4H13 B;  5FNV A;  3HKB A;  4AHC A;  4MVM A;  5BMV A;  4ICG A;  1M57 B;  1GH6 A;  3DXR B;  4LBE C;  1YI2 V;  4EFB A;  1QVF U;  3U11 A;  4DR4 O;  3ABL C;  1HWY A;  2XTA A;  2CTQ A;  3H01 A;  3ZRW B;  4MVQ A;  4YHH B;  4E4E A;  4FJC C;  5LGN A;  1XRE A;  5JWP A;  4B3S O;  1KP3 A;  2Q73 A;  3FAV B;  1Q7Y W;  3ETE A;  2DJV A;  2UXC O;  1XNQ O;  4LH7 A;  4JI8 B;  3QG5 A;  4FFK A;  3RYH B;  2F23 A;  2WSS G;  1JJ2 U;  3SJQ C;  2UUB O;  3JAK A;  4JI0 O;  5IWA O;  3L74 H;  4O4J B;  2ZE5 A;  1RM1 B;  1FS0 G;  3WB0 A;  4DUZ O;  3M8A A;  4ZOL B;  5LL6 Y;  1JX9 A;  2H94 A;  4GX2 A;  5J2U B;  2QKA A;  4GKJ B;  1NQT A;  4OPA A;  5L3G A;  1OV9 A;  2IBZ H;  5LMN B;  3K59 A;  1RPR A;  2OCH A;  1MSW D;  4FPP A;  3CRM A;  1KQS U;  1CP9 A;  2P4K A;  1F4N A;  2YIB D;  1NH2 D;  1VQO V;  4K8Z A;  3JAW A;  1NS1 A;  3TXS A;  2ATK C;  3SPJ A;  5K1P A;  3F5W C;  5LHG A;  1HR0 B;  1NR1 A;  4WBN A;  3K5N A;  2VWJ A;  5LMN O;  3WB2 A;  4UB8 Z;  3CCV V;  2CH7 A;  5B1B B;  2IH3 C;  1MNG A;  5LXT B;  4LCU C;  1GN6 A;  5EC2 C;  2Q7H A;  1VQP V;  3R65 A;  1FXK B;  4HAM A;  1KBH A;  1DLB A;  1R3I C;  2ILM A;  3M99 B;  4G28 B;  3CMA V;  2UUA B;  1K97 A;  3CRC A;  1AB3 A;  4XDJ A;  4JAU A;  1SRY A;  2DQ3 A;  5KX5 B;  4NYK A;  4I0X B;  2Y0P A;  4AQY O;  1FKA O;  4CBC A;  3RYC A;  2UXC B;  2WLM A;  4P9O A;  1V55 B;  3UO3 A;  2A79 B;  2XHB A;  5FPR A;  3HKD B;  1DTO A;  2KG7 A;  4DYL A;  2E74 B;  3TGU H;  2RN9 A;  2D3O W;  3OE7 G;  5JVD B;  3SR2 C;  2GSM B;  2GTA A;  4DR1 B;  2VQF O;  5CA3 A;  2QEX V;  2QE7 G;  4O4H A;  4HYO A;  3SYP A;  1HNW B;  4H33 A;  1DF4 A;  4JV5 B;  4MTG A;  5B3S B;  2CE4 A;  3AG4 B;  3LUT B;  3X2Q B;  2EX3 A;  3U0Z A;  5CBF A;  1R3K C;  3ASN B;  1H8E G;  1SC5 B;  2F1M A;  4DV2 B;  4LFA O;  2FL4 A;  2XAJ A;  4DV7 O;  5EYP B;  4EB6 A;  5CBG A;  5L3E A;  4HZ3 A;  4UUJ C;  1VAR A;  1SZT A;  3UQ8 A;  2VQE O;  5ITZ B;  1SZX A;  1BQ0 A;  1LR1 A;  4X1Y B;  4YJ3 B;  3OEE G;  1VF5 B;  2PF4 E;  3CJH B;  5FLX N;  4AIL C;  3CEI A;  3K0D A;  4XBF A;  3H1J H;  3TK1 A;  4PA7 A;  4UCV A;  4QJF B;  3HKC A;  3RT3 C;  2QM8 A;  5E1A C;  3OTF A;  3HKE A;  5HFM A;  3F5T A;  3SYA A;  2BSK A;  2LJ2 A;  1M57 C;  1BMF G;  3CXC U;  4IHJ B;  3E8F A;  3CSX A;  4X1I A;  1YTF B;  2QWO B;  1HP8 A;  1FPO A;  3G80 A;  1I5X A;  4K0K O;  4I5S A;  4LFB B;  3AG2 C;  1VF6 C;  5DED A;  4CH3 A;  1QBZ A;  1Q86 W;  2DOS A;  4QPK A;  1MZE A;  2LGQ A;  4OX9 B;  4FK5 C;  1CPY A;  1VQL V;  3L73 H;  1XQ8 A;  1K7D A;  1GKF A;  3QNE A;  3K58 A;  4B08 A;  3G6B A;  2FB5 A;  4Z1V A;  4LF8 B;  4AQY B;  2UXD O;  4FLT A;  1R3J C;  1Q6U A;  4LH6 A;  3RYC B;  4DW0 A;  2Q9L A;  2YID A;  3A2F A;  4DRX A;  1UJW B;  5CA0 A;  1ZL8 A;  3O65 A;  3T4Z A;  5LMU B;  2BTO A;  2DWE C;  1XNQ B;  1BHA A;  4QGP A;  4RUF A;  3RVY A;  4HNA A;  4K8X A;  3DC6 A;  5K1X A;  4L87 A;  3H1H H;  1Z5V A;  2AGA A;  4JV5 O;  1I5Y A;  2JJ1 G;  4X20 A;  5LHI A;  1HW7 A;  2YXH A;  2XAG A;  1MG1 A;  2X7R B;  4JI7 O;  3IAY A;  2B1G A;  4DW1 A;  5GTI Z;  3BCC H;  1AI6 A;  1GK9 A;  4O4H B;  1SQV H;  2YIC A;  2ZKO A;  3CME V;  3MHH C;  1XMQ B;  1LUV A;  3T1Y O;  1WJZ A;  4PA4 A;  1K4C C;  3QTC A;  1P7G A;  5JCO A;  3CS5 A;  2QWN B;  1T5E A;  2Q7G A;  1N0J A;  2VRZ A;  2WLK A;  3JAS B;  2P90 A;  1KC8 W;  3E2E A;  4J7Z A;  2RDC A;  5KA5 A;  2P7T C;  2F43 G;  2NLJ C;  2PGG A;  4DV7 B;  3P3P A;  3LSS A;  3AG1 B;  1W2B U;  3TXQ A;  1JFF B;  1G4Y B;  2BSK B;  2IU0 A;  5A2Q N;  3VQW A;  1VQM V;  4JAV A;  4W4L A;  3T1C A;  3OR6 C;  4GCZ A;  5J2U A;  1SQX H;  5JJE B;  4RQF A;  2B1I A;  2JEX A;  2YI8 A;  3OEH G;  1H8H G;  3RYF B;  4W4K A;  3BHP A;  1RSO A;  1WP7 A;  2ZQM A;  1L0L H;  2EBO A;  3T2M A;  3ZX6 A;  2YXL A;  4IHJ A;  5B3S C;  4LF4 B;  3JAT B;  1YIJ V;  1S0V A;  1FD9 A;  3X2Q C;  1JPX A;  1AR4 A;  3B2E E;  2HVK C;  1FAF A;  2PUS A;  1XNR B;  2EIK B;  2BOC C;  4LFC O;  3BA8 A;  4FZ1 A;  2JS3 A;  4FLU A;  2F4V B;  1N4C A;  1XBL A;  5JH7 B;  1BL8 A;  1R6T A;  1B3Q A;  1ZL8 B;  1D2D A;  1AI5 A;  1IDS A;  3ABK C;  2EIJ B;  4K35 A;  4G27 B;  4JI8 O;  2OTL V;  2ZXW B;  2FKX A;  2FML A;  2G38 A;  4LP8 A;  3T1Y B;  1R6N A;  1H2S B;  4N23 A;  3QO8 A;  1W59 A;  4ZI7 B;  4PDR A;  3JSL A;  4JI1 B;  1H2M A;  2M6Y A;  2ZR2 A;  3JAR A;  4U7N A;  3MD0 A;  2IH1 C;  4DR1 O;  4RWU A;  4IL6 Z;  3OGI B;  2DWD C;  5KHI A;  1VQ6 V;  3GVM A;  2GTS A;  3R66 A;  3GB7 C;  2Q68 A;  1Y6X A;  1ZUQ A;  1WAZ A;  2P4V A;  3ASO B;  4ABM A;  2AW9 A;  4O4I A;  5LP6 B;  4I9W A;  4JI2 B;  4DV4 B;  3ABU A;  3OAA G;  1MA1 A;  3EXA A;  1P7B A;  4BAY A;  3G4S V;  3ZMV A;  5B1N A;  2JGD B;  1R1B A;  2KQX A;  1K73 W;  1YVW A;  2WA3 A;  1SER A;  3RVZ A;  3EFF K;  1GN2 A;  5IYB O;  4WFF A;  5EBM C;  2P67 A;  1YTF D;  1OCR B;  4JZG A;  1WPB A;  3CRA A;  1AVM A;  2FYU H;  1YEW A;  2R9R B;  3QO5 A;  4PI2 A;  3ZRV A;  4GT1 A;  3DGE A;  2CGO A;  3EVK A;  4O2A B;  3FB8 C;  2JJ2 G;  1IBK B;  2F93 B;  5C93 A;  1Z5W A;  2QTO A;  1SA0 A;  4I9Q A;  3B8M A;  2P6J A;  5H2F Z;  3E22 A;  3FKS G;  2HP8 A;  3JAL B;  3AG1 C;  4XDK A;  3G71 V;  4I50 A;  4LWS B;  3SYO A;  5DM6 V;  4CH5 A;  5L3B A;  2OT5 A;  1IXB A;  1QR8 A;  3SJB C;  3W7T A;  2X6C A;  2YUA A;  4TUY B;  2C2A A;  4PA9 A;  1IBL O;  4GKK O;  3K03 A;  4FVM A;  4MT8 A;  5KMG B;  4B3R B;  2QWP B;  3S3W A;  4HNA B;  2HEP A;  2R9A A;  4A5U B;  1WB8 A;  1EFR G;  2VQF B;  1MAB G;  3E8B A;  2HJF C;  2DQ0 A;  4NTW A;  3MHS C;  4QIW F;  1AI7 A;  2GHY A;  1Y76 B;  3G6E V;  2BE3 A;  1H2K A;  4J10 A;  1CXZ B;  4UCO A;  3A0B Z;  2LP7 A;  3HKB B;  5H6Q A;  2ZT9 B;  3G67 A;  3K3W A;  4HBN A;  1FXV A;  4UCR A;  4IIJ B;  1OCC B;  4C7U A;  5HFL A;  1EBO A;  3N2G A;  1N34 B;  3CCM V;  1QHT A;  2Y4T A;  5KHJ A;  5IWA B;  4JI0 B;  3FAV A;  2IM9 A;  4LF7 B;  1P84 F;  1U96 A;  1AP5 A;  3IC9 A;  4TV8 B;  1F7Y A;  3JAK B;  1R3L C;  1I0H A;  2QSA A;  2JVD A;  3OW2 U;  1V55 C;  1L1F A;  3GWK C;  4F4L A;  4JYC A;  2HHH B;  2RNB A;  5IDJ A;  3Q4H A;  1PM9 A;  4DR2 B;  1VIB A;  4O4J A;  5BXZ A;  1WB7 A;  3BPZ A;  2XAH A;  3A0R A;  3JAW B;  1OJH A;  5IE9 A;  1CEZ A;  1GTO A;  5LGU A;  1QCE A;  4TQF A;  1GM8 A;  2Q0A A;  3AG4 C;  3D36 C;  3CC2 V;  2YXY A;  1WA8 A;  1X4T A;  4JTD B;  2E76 B;  1TUB A;  1D5N A;  4NB5 A;  1ENV A;  4FIP C;  1IUR A;  1FFT B;  4LF4 O;  5LP6 C;  4O2A A;  1VP7 A;  2HLD G;  1YJW V;  3ZN1 A;  4I55 B;  5LOV A;  3KCX A;  1VMG A;  1NR7 A;  2YSU B;  1GM7 A;  5CN0 A;  1TVK A;  2OIE A;  1J5E B;  3E35 A;  1MOF A;  3B40 A;  4X88 A;  4F6R A;  1QLN A;  1XOU A;  1AJP A;  4B7E A;  4LF9 B;  2UXX A;  3JSN A;  1RP3 B;  4JTC B;  2VWK A;  2H3O A;  1OCR C;  2RQ6 A;  1GN3 A;  5JVD A;  1M4U A;  4WFA V;  4BR6 A;  2PYJ A;  1BGY H;  4FLV A;  2V4D A;  1G6U A;  1FXH A;  1K34 A;  1E79 G;  4FLY A;  4JGS A;  3IJ4 A;  2V7Q G;  2ZE7 A;  1IVS A;  1KMI Z;  1VQ9 V;  4TV9 B;  4DV6 B;  4EEQ A;  1Q3E A;  1YDX A;  2XAS A;  2WLJ A;  2UXD B;  3N27 A;  1K9M W;  3ZHV A;  4ZHQ B;  1NVP D;  3W7U A;  2ZNJ A;  3T4D A;  1N34 O;  4QE7 A;  3VQX A;  2IW5 A;  5EK0 A;  1V54 B;  1KU9 A;  4JYY A;  4D7S A;  5DN6 G;  2NNU A;  4WCE V;  2ZIN A;  4FFB A;  2YEV B;  1BQZ A;  4X1Y A;  2GDS A;  4TOI A;  3MAQ A;  2WLN A;  1Y74 A;  3UKM A;  3QVN A;  4BIZ A;  3SGI A;  5GON A;  1WLE A;  4DUY B;  1SQF A;  1I94 B;  4J7K A;  3P32 A;  1WA8 B;  5KUK A;  3E8G A;  4DV5 B;  1Z2G A;  4FLZ A;  1M90 W;  4FZ0 A;  3BY6 A;  1OCC C;  2F66 C;  4H44 B;  3JD2 A;  4NXN B;  1RPO A;  3OMA B;  3B4S A;  1OHH G;  1RFY A;  1E1R G;  3ABM C;  4IYI A;  2A7W A;  1TVK B;  3F7Y C;  4R50 A;  1TUB B;  1JVM A;  3OT7 A;  1GRJ A;  3K9S A;  4PI0 A;  2KSD A;  4GKK B;  3ZRS A;  4DO2 A;  3FB7 C;  4WFB V;  4I50 B;  4H37 A;  2QA4 V;  1NKD A;  3ABT A;  4MW3 A;  5DEC A;  1W0K G;  1NVP B;  1YHQ V;  1PL4 A;  2PYL A;  5KHG A;  3K79 A;  1H2G A;  2N74 A;  3CXH F;  3ZS8 C;  1XIL A;  3CCU V;  3BA9 A;  3ZMZ A;  2CAZ C;  5H9C A;  1S76 D;  3K9A A;  1I08 A;  3D8C A;  4DK0 A;  4YHH O;  2V1D A;  1X59 A;  5BZB A;  1BE3 H;  5JQG B;  4DV2 O;  4LFA B;  1K92 A;  5KHK A;  4TV9 A;  3SYQ A;  1NTZ H;  4NTY A;  4GKJ O;  2ADP A;  3HB3 B;  2EIK C;  2ZNI A;  3HR0 A;  4TSF G;  3DXR A;  2A06 H;  4G2K A;  1E1Q G;  3N2G B;  4X64 O;  3K57 A;  1FFX B;  4GUN A;  4PV1 B;  3ABK B;  4JYA O;  2EIJ C;  2WLI A;  3CE2 A;  2ZXW C;  3L75 H;  3VBB A;  2UXB O;  1ZSP A;  1XMQ O;  2W6J G;  1BCC H;  2CTW A;  5JJN B;  3CCQ V;  3RW0 A;  4JI1 O;  3BVO A;  4EFE A;  3Q4H B;  1HNW O;  2F95 B;  4JYB A;  5EIB C;  1AR1 B;  3CRR A;  3GWO A;  4NXM B;  5J9P C;  2ADQ B;  2QR4 A;  2QDO A;  4RUE A;  3ZJZ A;  4X62 O;  3RYF A;  4DV6 O;  1B6Q A;  4U3F H;  4X8A A;  3JAT A;  4LFC B;  2X0L A;  4LNU B;  4K3A A;  4CH4 A;  1BZK A;  3TCU A;  1XNR O;  1A32 A;  1XL4 A;  3BRC A;  1YJN V;  3ZHT A;  3HPL C;  2CH7 B;  1RSO B;  3ASO C;  3AK2 A;  4R7C A;  4NXM O;  3ETG A;  4E2L A;  3CP1 A;  2Y48 A;  5EIB D;  2UUA O;  3CB2 A;  4MSW C;  4CS3 A;  2LFR A;  3B77 A;  2Y0I A;  2HR3 A;  2OYQ A;  3A0H Z;  1GN4 A;  4Q20 A;  4PHZ A;  4BW5 A;  4KP4 A;  3NXS A;  3I5D A;  1AR5 A;  2UUC O;  4B3S B;  1SQQ H;  3K5M A;  1FXK A;  1N33 B;  1DGS A;  4J9Y B;  3JAM N;  2WA4 A;  3BFR A;  3TJT A;  3AEI A;  3E86 A;  1PNL A;  4CH6 A;  3W7S A;  2CTR A;  5L3D A;  4WFE A;  3BAB A;  4OX9 O;  1HR0 O;  3K04 A;  1YSC A;  3ZMU A;  2WWW A;  4OXS A;  5JJJ B;  2WLH A;  1S3J A;  2CTP A;  5B1O A;  1Q6I A;  1QR9 A;  2Z3Y A;  3IGA C;  3I56 V;  3D36 A;  4KFM A;  4ZI7 A;  4JI5 O;  4D6T H;  5BR8 O;  3I55 V;  1XEQ A;  1JR9 A;  3APQ A;  4JI7 B;  2W0F C;  2AZ2 A;  4DR4 B;  1ROP A;  2MK3 A;  1Q82 W;  1F51 A;  1Q90 D;  1K3E A;  3M7M X;  2ZD9 A;  4O2B B;  2WPD G;  1BHB A;  3AG3 B;  1NI8 A;  4X66 B;  4GX0 A;  4LF9 O;  5KAF Z;  1XMO O;  1JA8 A;  1L8D A;  1NT2 B;  3L70 H;  1ZTE A;  2EJR A;  4O4L B;  4TT3 G;  3RYH A;  2W6I G;  4DV0 B;  4DV3 B;  2Q6A A;  2EUL A;  3OD4 A;  1P4R A;  1MSD A;  4P9P A;  4X65 B;  1Y4M A;  1XHZ A;  3CC4 V;  2QWR B;  2PY5 A;  2OWO A;  4IGG A;  4IT5 A;  2IU3 A;  4UXN A;  4LFB O;  3ZRX A;  3J81 N;  2RCV A;  3CRQ A;  1QNM A;  1KUQ A;  2PZS A;  3SJA C;  1Q8I A;  1OCO C;  1XUQ A;  2ZM6 O;  1N36 B;  3LSU A;  4UCU A;  3SPC A;  3D3I A;  4LNU A;  3QF7 A;  2N05 A;  4LF8 O;  2BOB C;  1HNZ O;  3JCZ A;  3CPW U;  3CX5 F;  1S5L Z;  3E22 B;  2JS5 A;  5LXT A;  1FYJ A;  4FLW A;  3FX7 A;  4YY3 O;  2XT9 A;  1N8R W;  1YF2 A;  4GZR B;  4UFZ A;  5GW7 A;  4DRX B;  2AZ0 A;  2A9H A;  4WFG A;  5IY5 B;  2P06 A;  5LYJ A;  4KHP B;  1G8M A;  4PJ0 Z;  4TUY A;  4MVR A;  3FYE B;  4H0L B;  3UM7 A;  1QLE B;  4JI3 O;  5E79 Z;  4JI6 O;  5B5E Z;  2Q69 A;  4FM1 A;  2VQE B;  3UT5 A;  3SYC A;  3P3N A;  2ZIM A;  2LO1 A;  2D2C B;  4UVA A;  1EN6 A;  1TAE A;  4U7O A;  5D5P A;  2UXN A;  2R70 A;  4GX1 A;  1HDJ A;  2XOK G;  3IFX A;  1VQ8 V;  3K0G A;  3DTU B;  4DV5 O;  1JMK C;  1Y76 A;  5IJ0 B;  4MTO A;  2LW1 A;  4DK1 A;  4QE9 A;  1R6K A;  3VOU A;  2MW2 B;  5IYC O;  4B3T B;  4FM2 A;  2Y4U A;  2YIA A;  3H1K H;  1F4M A;  1ZX3 A;  2L35 A;  4PD4 F;  3ZN0 A;  3LNM B;  1LUW A;  2WLI B;  5IYD O;  4EB6 B;  4PEL A;  2YIB A;  2Q0O C;  3RBZ A;  3LDD A;  4CC6 A;  2AHY A;  1AP6 A;  2HKO A;  3ETD A;  4YIP A;  4P30 A;  1UFI A;  2QM7 A;  4YY3 B;  1JOY A;  2HVJ C;  5B1A B;  3CJH A;  2PI4 A;  1IXM A;  3ZCC A;  1SQB H;  5H6R A;  1KEC A;  3BEH A;  2HG5 C;  3OUS A;  4TV8 A;  2ZDI C;  3L71 H;  5B66 Z;  3NR7 A;  2BCC H;  5AG2 A;  5BR8 B;  5BY1 A;  1TGO A;  4UB6 Z;  4WF9 V;  2EIL C;  5F2V O;  1TUE B;  2UU9 B;  4JI3 B;  3N2K A;  1GMG A;  4RQE A;  1PNK A;  3C3T A;  1J5E O;  3WFV A;  2NR5 A;  4I55 A;  5LOV B;  3AG3 C;  3OUF A;  5EBW C;  1ZAU A;  4UV9 A;  4UVC A;  1NTM H;  5JH7 A;  2ZE8 A;  3BAA A;  5IJ9 B;  2IJI A;  3SPI A;  3CHX A;  3L72 H;  1I7F A;  1V54 C;  3K5O A;  3FYI B;  4X9Q A;  5CA0 B;  3JD1 A;  1Q43 A;  5LYJ B;  4F6R B;  5EZY B;  4DR2 O;  3JCU Z;  4QPJ A;  4UV8 A;  1LNQ A;  4FLX A;  2EIM C;  4B3M O;  2XUM A;  1AJQ A;  1JCH A;  3ZED A;  1XMO B;  4JYA B;  4JAA A;  2XND G;  5H5N A;  2O57 A;  1W0J G;  4X20 B;  5GTH Z;  3K08 A;  4LF7 O;  3LNN A;  5FNV B;  2JGU A;  1YJ9 V;  3WG7 B;  3VQY A;  1SQP H;  2ZM6 B;  1OCZ C;  3ZRW A;  4MW8 A;  4TWK A;  1P49 A;  4I4T B;  2X6B A;  2VS0 A;  3ABM B;  1URF A;  4YXW G;  1IX9 A;  3CYO A;  2DYR C;  3LSQ A;  5A9G A;  3SDL A;  2GUZ B;  3ZIA G;  2LQT A;  3JAS A;  1M93 A;  1H2N A;  1U97 A;  2L6L A;  5EC1 C;  3JYC A;  4O2B A;  4Z2W A;  1N33 O;  2DN9 A;  3ZMT A;  2JK5 C;  5IY5 C;  1EM1 A;  2HHH O;  1B04 A;  2IJK A;  4J41 A;  3STL C;  2E5L B;  2DMX A;  4JI4 O;  1DK1 A;  2Z5U A;  3QO7 A;  1PL0 A;  1KB9 F;  2EJ7 A;  4UVB A;  2EIN B;  5J2T A;  3THO A;  2QWQ B;  1YZB A;  3E8H A;  1S72 V;  1QLE C;  3E83 A;  2UUB B;  1AI4 A;  2F4V O;  1FJG O;  2YEV A;  3JD0 A;  3FFQ A;  3RWR D;  3APO A;  2Y69 C;  1B06 A;  1M5I A;  5LA6 B;  2QJ1 A;  2YS8 A;  3TET A;  4DR7 O;  1NTK H;  2UU9 O;  3SPG A;  3OGC C;  1EZV H;  1S5J A;  4OPH A;  1K5Q A;  3J80 N;  3N2K B;  3SJC C;  1NBM G;  3FB5 C;  3ZBH A;  3WU2 Z;  1O9G A;  1GM9 A;  2GV9 A;  3B09 A;  4X1K B;  4N21 A;  1VQ4 V;  3K06 A;  1COW G;  4B3M B;  2CGN A;  1M56 C;  1FJG B;  3JAL A;  2PI5 A;  1NJI W;  2OIG A;  5FL7 G;  1YXB A;  2GBO A;  1XL6 A;  4BIO A;  2UXB B;  2A0L A;  3ZHQ A;  1Q5O A;  5LBQ A;  1K5S A;  4LF5 O;  1IBK O;  2R9I A;  5B1A C;  5KHH A;  1HNX O;  4PDV A;  3WB1 A;  3E89 A;  3JD4 A;  5D5Q A;  3CD6 V;  1SKV A;  4ZIB A;  4K0K B;  4LC1 A;  4JPR A;  2NN4 A;  1KKC A;  4LF6 B;  5L3F A;  3U10 A;  4AI8 A;  2P5O A;  2M7W A;  1MMM A;  1XI1 A;  2H8P C;  4JI5 B;  2KG7 B;  4Q6G A;  4MVS A;  1WNS A;  3ZHU A;  1BSM A;  1ARO P;  2LGW A;  3ICX A;  4IIJ A;  4JAS A;  3CCJ V;  3ETQ A;  3ZMS A;  4QNH B;  3JAR B;  5EYP A;  1KKD A;  4O4I B;  2YC0 A;  4I4T A;  5LP6 A;  3CCE V;  1QVG U;  3OTO O;  2JEU A;  4LR3 A;  4WFH A;  1VQK V;  2CDY A;  4KL1 A;  3SPH A;  3CC7 V;  3RN4 A;  5B1B C;  5ITZ A;  4EKW A;  3ZHR A;  3ZHS A;  4U3J A;  5CA1 A;  1BS3 A;  2EIM B;  3W7W A;  1AIL A;  5IT9 N;  2Q5Z A;  3HKE B;  1NH2 B;  4B3T O;  4X64 B;  4YJ2 B;  3FD9 A;  2JGD A;  3ML0 A;  3WG7 C;  3UO2 A;  2YDE A;  3PN1 A;  5J2T B;  2DYS C;  2CUG A;  2ARH A;  3MDS A;  1AJN A;  3C90 A;  1QQC A;  1ZLZ A;  1WP8 A;  2OCC B;  5EBL C;  1N36 O;  3P30 A;  4LF6 O;  4DV1 B;  4XDL A;  1WPX A;  4X1K A;  1SS3 A;  3T1H B;  2P22 C; 
#chains in the Genus database with same CATH homology
 4J80 A;  2QWN B;  3AG7 A;  1NZ6 A;  1GH6 A;  3UO2 A;  4RWU A;  2QWP B;  4J7Z A;  3APQ A;  2CUG A;  2N04 A;  1BQ0 A;  2QSA A;  1N4C A;  1XBL A;  2L6L A;  2CTW A;  2CTQ A;  2LO1 A;  2QWO B;  3APO A;  2OCH A;  2QWR B;  1FPO A;  2KQX A;  2PF4 E;  2Y4U A;  2YS8 A;  2LGW A;  2CTP A;  2DN9 A;  3BVO A;  3UCS C;  3UO3 A;  1BQZ A;  4IT5 A;  2N05 A;  1HDJ A;  2Y4T A;  2DMX A;  1WJZ A;  2EJ7 A;  1IUR A;  2GUZ A;  2CTR A;  2GUZ B;  2M6Y A;  1FAF A;  2YUA A;  2QWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...