2M6YA

The solution structure of the j-domain of human dnaja1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily A member 1
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2m6yA01
2QWRB 3UO3A 2DMXA 2QWPB 4IT5A 2CTWA 2L6LA 1WJZA 1IURA 2QSAA 2N05A 1FPOA 2CUGA 1FAFA 2CTQA 2QWOB 1GH6A 2DN9A 1NZ6A 2CTRA 2GUZA 3APQA 1N4CA 2YS8A 2CTPA 2QWNB 2Y4TA 2EJ7A 2KQXA 3UO2A 2N04A 2PF4E 1HDJA 2LO1A 2Y4UA 2LGWA 1BQZA 2OCHA 4J7ZA 1BQ0A 2GUZB 4RWUA 3AG7A 3APOA 4J80A 2M6YA 1XBLA 3UCSC 2QWQB 2YUAA 3BVOA
chains in the Genus database with same CATH superfamily
2XTAA 1NS1A 2X7RB 2QEXV 5KX5A 5E1AC 1A32A 1R3IC 2WLJA 3OT7A 3ASNC 1FD9A 1F4NA 3JATB 3AG7A 4CS2A 4DV0B 3UCSC 2KG7A 4LR3A 2X6BA 2FB5A 1VQ5V 1KC8W 1Y4MA 1AI5A 3AK2A 3TXQA 2F4VO 3K5OA 4LC1A 3WG7B 1URFA 1BHBA 4DR2B 5DM6V 2CTRA 1SS3A 2PYLA 2OIEA 1W59A 1B3QA 1Q6HA 1AJNA 1BQ0A 2YDEA 3L71H 5KHKA 2XAHA 3OTFA 4H0LB 4G2KA 4X64B 4IIJA 1PV0A 4PA3A 1NH2D 4WFEA 3CB2A 5BR8B 4BAYA 1PNLA 3DC5A 3OR7C 4FLZA 2P67A 1COWG 1NBMG 1OCRB 2L35A 2LW1A 1VP7A 5H6QA 2ZM6B 3L70H 5B1NA 4LF7O 3TJTA 3E22A 2AGAA 3JAWA 3K08A 4DV0O 1FXKA 2GTAA 1GN6A 1M90W 2JS3A 2YEVB 2K1EA 4HAMA 1JJ2U 3K57A 4O4LB 2YUAA 2CAZC 1DK1A 1VF6C 2O57A 4GZRB 3F7VC 1KUQA 2LJ2A 1VEWA 1IXMA 4B3MB 2JGDB 4UVCA 3ZX6A 1NJIW 1GAXA 1X59A 4BWAA 4LF6O 5JCOA 1SETA 1XMOO 3WU2Z 1XUQA 2GHYA 1R73A 2WLMA 1PP9H 2VQEO 1IBKO 1THZA 2X6CA 5KHGA 3JATA 1M9NA 2Q7GA 4X62B 1NTZH 1QR8A 3CJHB 2P06A 1KBHA 4J7KA 2R9RB 2YIDA 3JASA 2OYQA 1XREA 1HNXO 1ENVA 4RAIA 1S76D 2P4VA 2XT9A 1XNRO 1SQPH 2MW2B 2CGOA 3AG2C 2L6LA 3K58A 1FFXB 3B40A 1HR0B 3AG2B 3BPZA 3A2FA 2RJZA 5B3SC 2HVJC 4TQFA 2JDIG 1WPXA 4CS4A 3K79A 4YY3O 3C3TA 1ZAUA 3KG2A 1YZBA 1SQXH 4W4LA 1Y76B 1KQSU 4U7OA 4X1KB 3FB6C 1FYJA 1AI7A 1HNWO 4X1KA 5IE9A 2Q0OC 2BOCC 1FXVA 5JH7B 1DGSA 3BHPA 2JEXA 4X8AA 1BL8A 2UXNA 2DWDC 3ZHUA 3BA8A 4DV5B 2UXBB 4GT1A 3I55V 3FD9A 4C7UA 4J7JA 5LP6B 1PNMA 3UQ8A 4DR7B 1MG1A 1RM1C 3B09A 3FAVB 4MTOA 2DMXA 4I9QA 1OCCB 2LFSA 4LBEC 3SYAA 5A9GA 4B3RB 1QVFU 1EN6A 3ZMUA 1GO3F 2YI9A 1Z5VA 1PM9A 2JVDA 4L87A 3ZMZA 4I5SA 1WNSA 5GTIZ 3I56V 4LF4O 1OJHA 3N27A 2UXCB 1QQCA 3T1YB 2LGWA 4LNUA 3CCLV 2DYRB 3ZS8C 4F4LA 2GSMB 2RNBA 2B5UA 1L1FA 1QCEA 4CC6A 3F5WC 3ZMVA 4YXWG 2P4KA 3HKDB 4CC5A 2ZIMA 5CA1B 4PA9A 4ZHQA 1HDJA 3CRMA 3CCVV 2EIJB 4FLVA 4IHJB 4MS2A 4DV5O 2UXBO 3ZRXA 2KSDA 3HR0A 4O4IA 5E79Z 2E5LB 3HKEB 1JCHA 4FLTA 3UT5B 4DV3O 2XASA 4X1YB 5EK0A 1KYOF 5GW7A 3ABMC 1K34A 1AI4A 1R6NA 4JI2O 1GM7A 1PKXA 1J95A 5BMVB 2QWPB 1N33O 1RPRA 3VQWA 4DR2O 1EBOA 4JZ2A 4HBNA 1GN3A 2CGNA 2QKCA 1MOFA 5H6RA 2HHHB 1JJOA 4GLXA 1FFXA 2A06H 2RCVA 3DSQA 2Y0IA 4DV7O 1Q86W 1AR5A 3RVYA 1WA8B 2ZNIA 1OZ0A 3EXAA 1H2GA 5IT9N 1BSMA 3SJAC 1ZL8A 2QKSA 2XAJA 1LNQA 1N0NA 1S77D 4JYYA 4AQYO 4JI7O 5EIBC 4X1YA 2P90A 4DK0A 1LR1A 4LNUB 3IAYA 4D7TA 2F95B 4K3AA 2QA4V 3LNNA 4DV3B 4JAAA 3K5NA 4YJ2B 2NNUA 2IJKA 3G6EV 4XBFA 4TWKA 4WFHA 1MZEA 1TUBA 4JI6O 2VWJA 3D8CA 3TETA 5CA1A 2DJVA 2Q4PA 1I7FA 4BIZA 4PA7A 3CXCU 4TV9B 1V55C 3F5TA 1FJGO 4I55A 3CXHF 5CB4A 3NXSA 3U11A 4GKJO 5EYPB 4YJ3A 4DV4O 4Z2WA 4K0KO 2P22C 4QE9A 4O4JA 2QWOB 4DUYB 2QM4A 4NXMB 3RWRD 3JSNA 2UUAB 3CS5A 2Y48A 4OX9B 1IBMO 4JTDB 2EBOA 3ZRWB 4FFBA 4DR3B 1HR0O 2FMLA 2IH1C 2VRZA 1UPGA 1R3LC 3BVOA 5L3EA 1WB8A 1GN2A 3FB5C 4MVMA 4Z1VA 2F1MA 1FXKC 4PJ0Z 3JARA 4B3SO 3ML0A 5JWPA 4PHZA 4WFAV 3S3XA 3JSLA 2PF4E 4MVQA 3QO8A 1R6TA 1AB3A 1DTOA 2AHZA 1L8DA 2D2CB 1WN7A 1K7DA 4ZHQB 2QKAA 3ABLB 4JI6B 3M7MX 1FPOA 3JALB 3CP1A 4X20A 3P3PA 1Q82W 3K5LA 2IH3C 4FZ0A 3RYHA 2YS8A 5H5NA 1NT2B 3UM7A 4QE7A 2NN4A 2ZIOA 4MTXA 4R7CA 5B1AB 5LP6C 3CRAA 2UXXA 2FTKA 3ZBHA 5LHGA 4B3RO 1KD1W 1US6A 1SESA 2BSKA 4MSWC 1AROP 4NYKA 5J2TB 2F4VB 1R6KA 4DW0A 1IBMB 2CDYA 4XDJA 2BTQA 5J2UA 2EIJC 2P7TC 4P9PA 1NI8A 4I55B 3GWOA 3IGAC 4JAVA 5CN0A 3QF7A 5KUKA 4OPAA 1YTFD 1GTOA 3CCQV 4X89A 1S0VA 1U96A 4H13B 3D3QA 5HFMA 2AW9A 3AG4B 4O4LA 5CBFA 4CS3A 1J5EO 3RYFB 1VQKV 1JFFA 2EJ7A 4UCTA 3OUSA 4TT3G 2Q6AA 4QJFB 5EBMC 4U3JB 5FNVB 1K5SA 3OTOO 1O9GA 1PL0A 4PI2A 4MVZA 4UV9A 5LYJB 1WB7A 3CE2A 3OMAB 4DYLA 4IGGA 4JV5O 3B8NA 4X65B 1Q3EA 4ICGA 5GONA 3OMIB 3H1JH 3JD3A 1VF6A 1BCCH 1R1BA 3EFFK 4FK5C 3HPLC 2OWOA 4PI0A 4DV6O 4B3TO 3N2KA 4MT8A 4Z1MG 4DUZO 1HW7A 3Q4HB 3ZJZA 2Q68A 1XILA 2CUGA 2Y0PA 5ITZB 3W7TA 3FB8C 4LFBB 3J7AU 4FFBB 3CCEV 5LHIA 4EFEA 2BSKB 1VMGA 3EHBB 1QBZA 3SGIA 2EZOA 4CH6A 2QE7G 5B3SB 4TSFG 5CMUA 3W7UA 2FL4A 5LA6B 1E1RG 4DR6B 4KFMA 3CPWU 2Q73A 2A7WA 4DR5O 4L8JA 4GX5A 4KHPB 1YXBA 3G6BA 5IYZA 4JV5B 3OEEG 3W7XA 1G1XB 2QJ1A 3G71V 1D2DA 3AK3A 3CC2V 2A79B 2DYSB 3BY6A 1XNRB 4LF9O 1ROPA 5IWAO 3ABKC 4JI8B 5L3CA 4FM0A 4MVRA 5KMGB 5LOVB 5BXZA 5IY5C 4LFCB 3P3NA 4YY3B 1QLEB 1XHXA 1M5IA 5KAFZ 2B9ZA 2XOKG 4TUYA 5FNVA 4CH4A 1H2LA 3H9VA 2A3QA 2FKXA 1RP3B 5KX5B 4YHHB 4MVOA 1HNWB 4TUYB 4R6ZA 2EIMB 4ABMA 3OM3B 4MW3A 2YXHA 5B66Z 1VQPV 2LP7A 4UVBA 2K9PA 2QWNB 2HG5C 2WLKA 1FKAO 2UU9O 1ORQC 3JARB 3CC7V 3U0ZA 5JCOC 4DR6O 1NR7A 2QTSA 3HKCA 1FS0G 2XAQA 1SQQH 4I50A 2V4DA 4DR1O 2B1IA 4FPPA 5B1AC 3HB3B 3MAQA 1IVSA 2Q5ZA 1FFTB 4U3JA 1TAEA 3JD2A 4ZOLA 2PI5A 5LBQA 2N04A 3ZIAG 1G8MA 4MVUA 4LF8O 3TK1A 3ABTA 4O4IB 5KA6A 4PA6A 1JA8A 1S3JA 3STZC 1JPXA 1V54C 3B77A 3KCYA 2QSAA 1VF5B 3SPHA 5L3GA 5K1PA 2YIBD 3FYEB 2Q69A 5CBHA 5DEDA 4WF9V 1IXBA 1H38A 3JAKB 4I4TA 3PN1A 3SR2C 2F93B 4F6EA 3HKDA 1XBLA 3DGEA 3Q4HA 3ZRVA 1N32O 4DR4O 5LMNO 3DC6A 3ZRSA 1WAZA 3QG5A 1WP8A 4O2AB 4WBNB 4F6RA 2AZ0A 1EM1A 3SDLA 4JI0O 3CD6V 2BE3A 3JAWB 2CTPA 3FKSG 4FMTA 4UCUA 3IC9A 4ZKIA 2E5LO 4G28B 2UUBO 2ZE5A 2PTMA 2JGDA 4RQEA 1P7GA 3WB0A 3T2MA 3GWKC 3ASNB 1IZ3A 3BABA 4JI2B 3CRRA 1D5AA 4JI5O 4JTAB 5KAIZ 1W2BU 4X66B 2ZE7A 1P49A 1H2SB 3ABMB 1UFIA 2DQ0A 3HKEA 1UJWB 2HP8A 2WLLA 3KCXA 4QIWF 4U7NA 1N34B 4LF8B 3SJQC 1LUVA 1O9HA 3W7WA 2KB1A 4DRXB 2R9IA 3WG7C 3CCRV 2YI8A 2P5OA 1Y74A 4O4HB 3TCUA 2WA4A 5IYZB 1M57C 3BA9A 4DRXA 2BOBC 2ZQMA 3AG1B 4FFKA 3ASOB 2W0FC 4FVMA 1JOYA 2GUZA 1VQ7V 4DV6B 2PI4A 2QM8A 1NTMH 4DR4B 2EIKC 4J42A 1NR1A 3OTOB 2Y4UA 3RFRA 1Q90D 2RDCA 3K03A 1MZFA 3RN4A 2C2AA 4FLYA 3AG3C 5IJ0A 5J2TA 4AI8A 4CBCA 1IBLB 4JYCA 5LHHA 3OFNG 3ETDA 5IYDO 3CCJV 2W0XA 1SC5B 1AP5A 4TQDA 5B5EZ 2OCCC 4OPHA 2ZXWB 4AILC 4MVSA 3QO7A 5LL6Y 3CEIA 3QNEA 4X1IB 3JAKA 1FXHA 1U97A 2UXDB 3ZHSA 5F2VO 4J80A 2GBOA 5J2UB 3ETQA 4I50B 4DR7O 2VS0A 1K4CC 3K3WA 5LP6A 4FJCC 4J41A 1EN4A 3CCSV 4RUEA 4JI4O 3FAVA 3BFRA 1N36O 3LSUA 3IC7A 2A0LA 4NVPA 4N21A 3AG3B 3T4ZA 4DV4B 1AILA 3ZHVA 4OX9O 4K0KB 4H37A 1GMGA 4NXMO 1SQFA 4JI1B 3O9OA 3H1LH 4KXRA 4UVAA 4A5UB 4WCEV 3CCUV 3ZRWA 3P32A 4ZOLB 2CTWA 2R72A 3RYHB 2UUCB 3THOA 4GX0A 4OGQB 1OV9A 1H2NA 1HNZO 1QU7A 1M56B 4O4JB 5C8YB 1P4RA 2KQXA 4D7SA 2WAMA 1X4TA 2HEPA 2Z0AA 3ICXA 2XNDG 1KP2A 5TISZ 1ZUQA 4LF9B 3NR7A 4P30A 3F7YC 5JJNB 4EB6B 2ARHA 2ZM6O 4KL1A 2OTJV 3RBZA 1XHZA 4LFCO 1K9MW 1RFYA 1WPBA 4UCSA 4UXNA 5EC2C 4BW9A 3N2GB 2ITCC 3TGUH 3T1HO 3UT5A 1AR1B 1V54B 4UB6Z 2LFRA 4JZGA 4DR1B 2VQFO 1OHHG 2ADQB 5BY1A 4YHHO 2EIMC 1R3JC 5L3BA 1VQOV 2P6JA 1BMFG 4CH5A 3KZIZ 4I7ZB 2AZ2A 4JI1O 1MMMA 2WPDG 1JX9A 3VQVA 3J80N 2H94A 3BAAA 4KP4A 2LQTA 2UUCO 1QR9A 4DV2B 1YEWA 2HHHO 1M4UA 3HKBA 2BTOA 5LA6A 5LGTA 1Y66A 1XMQO 4JTCB 3A8TA 1J5EB 1VF7A 3LDCA 1YIJV 1W0JG 3X2QB 1BS3A 4I0XB 3ZEDA 1Q6IA 3CRCA 3ETEA 1H2KA 1MABG 2CH7B 2ZD9A 2N74A 1YF2A 3N2GA 4NXNB 1K97A 3K9SA 3CX5F 1OCRC 1TUEB 1IX9A 2RN9A 3H1IH 1WA8A 3APQA 4JASA 1KU9A 1S5HC 5KHJA 4FLXA 2IJHA 1NU1H 1N32B 1EZVH 2XAGA 5KUMA 3BRCA 2JJ1G 2HVKC 1SQVH 4X1IA 1JR9A 1ZSPA 3HKBB 5BZBA 5H2FZ 2GTSA 5KA5A 1NQTA 1XL4A 3SYCA 5LXTB 4PV1B 4NTXA 1YJNV 3VQXA 4LP8A 4IIJB 4UCOA 4QNHB 3RYCA 3IFXA 2GDSA 2W6IG 1SQBH 3OR6C 1FAFA 3SYOA 1M1KW 2F66C 2QTOA 5EZYB 3RT3C 2M7WA 1VQ8V 3TXSA 4YIPA 5JQGB 5EZYA 4O4HA 1S5LZ 2EULA 4DV1B 1I08A 1AJPA 2H3OA 4JI8O 5GONB 2UXDO 2W6JG 1Q5OA 3CJHA 3CMAV 2DN9A 2B1GA 4BIUA 2DYRC 4JGSA 3OAAG 1YJWV 2DWEC 2XHBA 5IJ9A 2OIGA 4K8XA 4B08A 3E89A 1MSWD 4R50A 3UO3A 3ZN0A 1F51A 1NVPD 3FB7C 2WA3A 3SJBC 1JFFB 3H1KH 1XL6A 4FLUA 5KHHA 4UUJC 2RMKB 4PA4A 2UU9B 3STLC 3UO2A 2IU3A 4XDLA 1F23A 2KKWA 2WLIB 2M6YA 1HNZB 3LDDA 2QR4A 2JJ2G 3BCCH 2HKOA 1BE3H 3ZHTA 3ABLC 3L74H 4E2LA 1XI1A 1NH2B 1GH6A 1Q6UA 1JQ0A 4RUFA 4RO2A 2R9AA 2OT5A 1G4YB 1H8HG 2BTQB 4P2ZA 3I5DA 1YSCA 4DXWA 5D5QA 1S5JA 4OXSA 2VWKA 3OGIB 1Q43A 1NTKH 2HR3A 3RYCB 4LF5B 3RYIA 3E86A 5LXTA 3LSQA 4WFFA 3EVKA 2EIKB 4LCUC 3K06A 1VQMV 3FX7A 3CHXA 4NKGB 4HNAA 2VQFB 5JQGA 4W4KA 1JVMA 2Z3YA 1GM8A 4FM2A 3OMNB 2ETNA 4LWSB 1F4MA 2YICA 3H1HH 1K3EA 2QWRB 4EEQA 1ZTEA 3ZMTA 2AXTZ 1PNKA 5LMUB 3A0BZ 5B1BC 4DUZB 2KG7B 1JMKC 4LFBO 3P30A 1FXKB 1GN4A 1LUWA 2ZNJA 2EILC 4K8ZA 3AG4C 2UUBB 4JI3O 2GUZB 3ZHQA 5FPRA 3QVNA 4EFBA 1RPOA 4LF4B 1HP8A 4NTYA 4JF3A 1N34O 2IU0A 3CWBH 5ITZA 4GKKB 3SPGA 2ZR2A 3H01A 4X66O 3CMEV 1AR4A 2RQ6A 3DTUB 3E35A 4NR1A 4ZBMA 2DQ3A 2Q7HA 3R65A 4HYOA 4IYHA 4MTGA 4GCZA 4TV9A 2DOSA 5JJEB 1QHTA 1SZXA 4J11A 5IWAB 3D36A 2LGQA 4YJ2A 1Z5WA 3ZCCA 3JASB 1TUBB 3VOUA 1Q7YW 3ASOC 4LF7B 3B2EE 4NXNO 1M93A 1CEZA 1M57B 2IW5A 1KKCA 4KHPO 5IYBO 4BW5A 2OTLV 2PY5A 3CRQA 3E8FA 1I5YA 2ATKC 3OW2U 4I9WA 3B8MA 2VQEB 1IBKB 1VQNV 1DLBA 1N33B 5B1OA 4JYBA 2WLIA 2QWQB 2PGGA 2NR5A 1RSOB 4TV8A 3W7SA 2D3OW 1AI6A 4ZI7B 4IT5A 4FM1A 1PPJH 1HNXB 4LFAO 2F23A 1N36B 1Q8IA 3ZN1A 3K59A 3RGBA 3OEHG 1VARA 2LO1A 4J7ZA 5JJJB 4JAUA 1IDSA 2OCCB 4AHCA 3A0HZ 2JGUA 1XNQO 1GK9A 1V55B 2EILB 3OD4A 1QLEC 4LH7A 2F43G 1Y76A 4YJ3B 5EBLC 2EINC 1E79G 1TVKA 3GB7C 4ZIBA 3ABKB 1Y6XA 4D6TH 4GYCB 2BCCH 1N8RW 3K0GA 4BIOA 1MA1A 3OE7G 1M56C 3C3SA 1D5NA 1OCOC 1IURA 1OCCC 4LWSA 4NTWA 1K5QA 5EBWC 3AK1A 2YSUB 1XQ8A 3WB2A 5KLVH 2IJIA 1BGYH 2Y4TA 4MTFA 1SA0B 2GV9A 3K9AA 4DW1A 4BR6A 4I0XA 1VQ9V 5IJ9B 4LFAB 2Q67A 4HZ3A 1I5XA 3C90A 1H2MA 2X0LA 4J10A 3LDEA 3E2EA 1SRYA 1H8EG 2V1DA 2WLHA 4KUMA 2ILMA 1KB9F 1KMIZ 4JPRA 4J9ZB 2OCHA 3JALA 4JI0B 2HFEC 3JD4A 1EN5A 4I4TB 2V7QG 4PELA 3SPJA 4B7KA 3J81N 1S72V 1Y74B 5IY5B 3G67A 4JI5B 5C93A 5L3DA 1TA8A 5D5PA 3M99B 3S3WA 2WLLB 5FPOA 3ETGA 4E4EA 1DF5A 5K1XA 1Q81W 1VIBA 3E8GA 2CH7A 4MW8A 4EB6A 1I94O 2Q7EA 2WWWA 4QPKA 4GX1A 2IJJA 4G27B 4JI3B 4IL6Z 3PJSK 3SYQA 2XUMA 1SZTA 5FL7G 1ZLZA 3T4DA 1DF4A 3D3IA 2FYUH 4TV8B 1BQZA 4ASUG 2R70A 1PD3A 2JEUA 1MSDA 3LNMB 3QO5A 4X88A 4WFGA 2ZKOA 4ZI7A 4PDLA 2PZSA 5LYJA 2MK3A 3WB1A 1GKFA 4LH6A 2NLJC 4Q20A 3JD0A 5CA3A 4X9QA 1B04A 2ZE6A 3MDSA 5CBGA 4O2BB 2JS5A 3R66A 1ZX3A 1CXZB 3E83A 2DW4A 1SQGA 3E8BA 1BHAA 4O2AA 5FLXN 2HJFC 1B06A 1RM1B 2DE0X 3RYFA 4GKKO 1MNGA 1GM9A 4J9YB 5EYPA 3AEIA 2XAFA 3LUTB 5J9PC 5L3FA 1L0NH 5H9CA 1N4CA 4CZZA 4DV7B 1ZWIC 5KHIA 1YI2V 4DV1O 3JCZA 2LW7A 1P7BA 4WFBV 4N23A 5GTHZ 4U3FH 3ZMSA 1K33A 5CA0B 1T5EA 2CTQA 4UV8A 3B4SA 1SERA 2EINB 4PDMA 4AQYB 1XOUA 1I0HA 3L73H 1AJQA 4B3TB 4GUNA 1SF9A 5IDJA 1WLEA 2WSSG 3T1HB 3G4SV 1YJ9V 3MHHC 1P84F 2E75B 4R8CA 1NVPB 3FYIB 1F7YA 2YIBA 4IYIA 1B6QA 5JVDB 3T1CA 4WBNA 2JIZG 3K04A 5CB4B 3L9DA 4UCRA 1VQ4V 3DXRA 5LGNA 2QDOA 5CA0A 3CC4V 1K92A 5C8YA 3L72H 4DR5B 1AVMA 4GKJB 5HFLA 4TOIA 1AP6A 1QNMA 1RSOA 1YTFB 3JYCA 1WJZA 2JRIA 2AHYA 4DUYO 1YCIA 1NZ6A 2PYJA 4QGPA 5JH7A 3BEHA 4PDRA 3VQYA 2E3CA 3JAMN 3A0RA 5BR8O 3M8AA 3T1YO 1N0JA 1XNQB 1NKDA 5KMGA 2ODMA 2ZDIA 2CK3G 3WFVA 4LF5O 2IM9A 4B3SB 2DYSC 2CE4A 3GVMA 4X20B 2ZT9B 2EX3A 1EZJA 2ZE8A 1XMQB 3IJ4A 3HKCB 4X64O 3MD0A 4IHJA 1ZL8B 3O65A 1PL4A 4QPJA 4HNAB 4RQFA 4H44B 1KECA 3DXRB 2YXYA 5IYCO 2ITDC 4EKWA 1YITV 5LMUO 1YDXA 1R3KC 3RYIB 3L75H 4UCVA 1SKVA 2YXLA 5DN6G 3VBBA 5IJ0B 1K4DC 2X6AA 4O2BA 1XEQA 1IBLO 2Q0AA 3X2QC 4DO2A 1KP3A 1TGOA 1EFRG 4LF6B 3CSXA 4H33A 1CP9A 4K35A 4FLWA 3OUFA 5LGUA 2Y69B 1L0LH 3N2KB 3SYPA 3FFQA 2HJDA 4UB8Z 3CCMV 2EJRA 2E74B 2YC0A 3LSSA 4JI4B 1WP7A 4B7EA 3K0DA 5LOVA 1W0KG 4B3MO 5B1BB 3RW0A 2WLNA 3KKYA 3APOA 5JVDA 3K5MA 4P9OA 2QGNA 4GX2A 1TVKB 1BZKA 4CH3A 1OCZB 1XMOB 2JK5C 4Q6GA 3D36C 1HWYA 1OCZC 5AG2A 2Q8VA 1VQ6V 3SJCC 5EIBD 4XDKA 4X62O 5LMNB 5A2QN 1QLNA 4JI7B 4RWUA 4JYAO 2Q9LA 1I94B 1K8AW 4X65O 2N05A 1V9PA 2Y69C 1Y67A 3MHSC 4FZ1A 1SA0A 2ZR3A 1YHQV 1G6UA 1E1QG 2HLDG 3SPIA 1Z2GA 4DK1A 3AG1C 2ZCEA 3E8HA 3RVZA 2ZXWC 4YIOA 2Z5UA 1FJGB 2QM7A 2IBZH 3QTCA 2YIAA 2A9HA 4PD4F 1KKDA 2UUAO 3JCUZ 5DECA 1CPYA 1VQLV 3ABUA 4PDVA 2E76B 4DR3O 2UXCO 1K73W 1YVWA 5EC1C 2ADPA 3UKMA 1BT8A 1XDCA 2ZINA 3ZHRA 3E22B 2PUSA 5BMVA 3G80A 4UFZA 2G38A 4DV2O 1OCOB 1QVGU 4NB5A 2H8PC 1GRJA 2EZPA 4F6RB 2ZDIC 4JYAB 3JD1A 4FIPC 3CYOA 3U10A 3OGCC 3SPCA 2YEVA
chains in the Genus database with same CATH topology
2QWRB 3UO3A 2DMXA 2QWPB 4IT5A 2CTWA 2L6LA 1WJZA 1IURA 2QSAA 2N05A 1FPOA 2CUGA 1FAFA 2CTQA 2QWOB 1GH6A 2DN9A 1NZ6A 2CTRA 2GUZA 3APQA 1N4CA 2YS8A 2CTPA 2QWNB 2Y4TA 2EJ7A 2KQXA 3UO2A 2N04A 2PF4E 1HDJA 2LO1A 2Y4UA 2LGWA 1BQZA 2OCHA 4J7ZA 1BQ0A 2GUZB 4RWUA 3AG7A 3APOA 4J80A 2M6YA 1XBLA 3UCSC 2QWQB 2YUAA 3BVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWR B;  3UO3 A;  2DMX A;  2QWP B;  4IT5 A;  2CTW A;  2L6L A;  1WJZ A;  1IUR A;  2QSA A;  2N05 A;  1FPO A;  2CUG A;  1FAF A;  2CTQ A;  2QWO B;  1GH6 A;  2DN9 A;  1NZ6 A;  2CTR A;  2GUZ A;  3APQ A;  1N4C A;  2YS8 A;  2CTP A;  2QWN B;  2Y4T A;  2EJ7 A;  2KQX A;  3UO2 A;  2N04 A;  2PF4 E;  1HDJ A;  2LO1 A;  2Y4U A;  2LGW A;  1BQZ A;  2OCH A;  4J7Z A;  1BQ0 A;  2GUZ B;  4RWU A;  3AG7 A;  3APO A;  4J80 A;  2M6Y A;  1XBL A;  3UCS C;  2QWQ B;  2YUA A;  3BVO A; 
#chains in the Genus database with same CATH topology
 2XTA A;  1NS1 A;  2X7R B;  2QEX V;  5KX5 A;  5E1A C;  1A32 A;  1R3I C;  2WLJ A;  3OT7 A;  3ASN C;  1FD9 A;  1F4N A;  3JAT B;  3AG7 A;  4CS2 A;  4DV0 B;  3UCS C;  2KG7 A;  4LR3 A;  2X6B A;  2FB5 A;  1VQ5 V;  1KC8 W;  1Y4M A;  1AI5 A;  3AK2 A;  3TXQ A;  2F4V O;  3K5O A;  4LC1 A;  3WG7 B;  1URF A;  1BHB A;  4DR2 B;  5DM6 V;  2CTR A;  1SS3 A;  2PYL A;  2OIE A;  1W59 A;  1B3Q A;  1Q6H A;  1AJN A;  1BQ0 A;  2YDE A;  3L71 H;  5KHK A;  2XAH A;  3OTF A;  4H0L B;  4G2K A;  4X64 B;  4IIJ A;  1PV0 A;  4PA3 A;  1NH2 D;  4WFE A;  3CB2 A;  5BR8 B;  4BAY A;  1PNL A;  3DC5 A;  3OR7 C;  4FLZ A;  2P67 A;  1COW G;  1NBM G;  1OCR B;  2L35 A;  2LW1 A;  1VP7 A;  5H6Q A;  2ZM6 B;  3L70 H;  5B1N A;  4LF7 O;  3TJT A;  3E22 A;  2AGA A;  3JAW A;  3K08 A;  4DV0 O;  1FXK A;  2GTA A;  1GN6 A;  1M90 W;  2JS3 A;  2YEV B;  2K1E A;  4HAM A;  1JJ2 U;  3K57 A;  4O4L B;  2YUA A;  2CAZ C;  1DK1 A;  1VF6 C;  2O57 A;  4GZR B;  3F7V C;  1KUQ A;  2LJ2 A;  1VEW A;  1IXM A;  4B3M B;  2JGD B;  4UVC A;  3ZX6 A;  1NJI W;  1GAX A;  1X59 A;  4BWA A;  4LF6 O;  5JCO A;  1SET A;  1XMO O;  3WU2 Z;  1XUQ A;  2GHY A;  1R73 A;  2WLM A;  1PP9 H;  2VQE O;  1IBK O;  1THZ A;  2X6C A;  5KHG A;  3JAT A;  1M9N A;  2Q7G A;  4X62 B;  1NTZ H;  1QR8 A;  3CJH B;  2P06 A;  1KBH A;  4J7K A;  2R9R B;  2YID A;  3JAS A;  2OYQ A;  1XRE A;  1HNX O;  1ENV A;  4RAI A;  1S76 D;  2P4V A;  2XT9 A;  1XNR O;  1SQP H;  2MW2 B;  2CGO A;  3AG2 C;  2L6L A;  3K58 A;  1FFX B;  3B40 A;  1HR0 B;  3AG2 B;  3BPZ A;  3A2F A;  2RJZ A;  5B3S C;  2HVJ C;  4TQF A;  2JDI G;  1WPX A;  4CS4 A;  3K79 A;  4YY3 O;  3C3T A;  1ZAU A;  3KG2 A;  1YZB A;  1SQX H;  4W4L A;  1Y76 B;  1KQS U;  4U7O A;  4X1K B;  3FB6 C;  1FYJ A;  1AI7 A;  1HNW O;  4X1K A;  5IE9 A;  2Q0O C;  2BOC C;  1FXV A;  5JH7 B;  1DGS A;  3BHP A;  2JEX A;  4X8A A;  1BL8 A;  2UXN A;  2DWD C;  3ZHU A;  3BA8 A;  4DV5 B;  2UXB B;  4GT1 A;  3I55 V;  3FD9 A;  4C7U A;  4J7J A;  5LP6 B;  1PNM A;  3UQ8 A;  4DR7 B;  1MG1 A;  1RM1 C;  3B09 A;  3FAV B;  4MTO A;  2DMX A;  4I9Q A;  1OCC B;  2LFS A;  4LBE C;  3SYA A;  5A9G A;  4B3R B;  1QVF U;  1EN6 A;  3ZMU A;  1GO3 F;  2YI9 A;  1Z5V A;  1PM9 A;  2JVD A;  4L87 A;  3ZMZ A;  4I5S A;  1WNS A;  5GTI Z;  3I56 V;  4LF4 O;  1OJH A;  3N27 A;  2UXC B;  1QQC A;  3T1Y B;  2LGW A;  4LNU A;  3CCL V;  2DYR B;  3ZS8 C;  4F4L A;  2GSM B;  2RNB A;  2B5U A;  1L1F A;  1QCE A;  4CC6 A;  3F5W C;  3ZMV A;  4YXW G;  2P4K A;  3HKD B;  4CC5 A;  2ZIM A;  5CA1 B;  4PA9 A;  4ZHQ A;  1HDJ A;  3CRM A;  3CCV V;  2EIJ B;  4FLV A;  4IHJ B;  4MS2 A;  4DV5 O;  2UXB O;  3ZRX A;  2KSD A;  3HR0 A;  4O4I A;  5E79 Z;  2E5L B;  3HKE B;  1JCH A;  4FLT A;  3UT5 B;  4DV3 O;  2XAS A;  4X1Y B;  5EK0 A;  1KYO F;  5GW7 A;  3ABM C;  1K34 A;  1AI4 A;  1R6N A;  4JI2 O;  1GM7 A;  1PKX A;  1J95 A;  5BMV B;  2QWP B;  1N33 O;  1RPR A;  3VQW A;  4DR2 O;  1EBO A;  4JZ2 A;  4HBN A;  1GN3 A;  2CGN A;  2QKC A;  1MOF A;  5H6R A;  2HHH B;  1JJO A;  4GLX A;  1FFX A;  2A06 H;  2RCV A;  3DSQ A;  2Y0I A;  4DV7 O;  1Q86 W;  1AR5 A;  3RVY A;  1WA8 B;  2ZNI A;  1OZ0 A;  3EXA A;  1H2G A;  5IT9 N;  1BSM A;  3SJA C;  1ZL8 A;  2QKS A;  2XAJ A;  1LNQ A;  1N0N A;  1S77 D;  4JYY A;  4AQY O;  4JI7 O;  5EIB C;  4X1Y A;  2P90 A;  4DK0 A;  1LR1 A;  4LNU B;  3IAY A;  4D7T A;  2F95 B;  4K3A A;  2QA4 V;  3LNN A;  4DV3 B;  4JAA A;  3K5N A;  4YJ2 B;  2NNU A;  2IJK A;  3G6E V;  4XBF A;  4TWK A;  4WFH A;  1MZE A;  1TUB A;  4JI6 O;  2VWJ A;  3D8C A;  3TET A;  5CA1 A;  2DJV A;  2Q4P A;  1I7F A;  4BIZ A;  4PA7 A;  3CXC U;  4TV9 B;  1V55 C;  3F5T A;  1FJG O;  4I55 A;  3CXH F;  5CB4 A;  3NXS A;  3U11 A;  4GKJ O;  5EYP B;  4YJ3 A;  4DV4 O;  4Z2W A;  4K0K O;  2P22 C;  4QE9 A;  4O4J A;  2QWO B;  4DUY B;  2QM4 A;  4NXM B;  3RWR D;  3JSN A;  2UUA B;  3CS5 A;  2Y48 A;  4OX9 B;  1IBM O;  4JTD B;  2EBO A;  3ZRW B;  4FFB A;  4DR3 B;  1HR0 O;  2FML A;  2IH1 C;  2VRZ A;  1UPG A;  1R3L C;  3BVO A;  5L3E A;  1WB8 A;  1GN2 A;  3FB5 C;  4MVM A;  4Z1V A;  2F1M A;  1FXK C;  4PJ0 Z;  3JAR A;  4B3S O;  3ML0 A;  5JWP A;  4PHZ A;  4WFA V;  3S3X A;  3JSL A;  2PF4 E;  4MVQ A;  3QO8 A;  1R6T A;  1AB3 A;  1DTO A;  2AHZ A;  1L8D A;  2D2C B;  1WN7 A;  1K7D A;  4ZHQ B;  2QKA A;  3ABL B;  4JI6 B;  3M7M X;  1FPO A;  3JAL B;  3CP1 A;  4X20 A;  3P3P A;  1Q82 W;  3K5L A;  2IH3 C;  4FZ0 A;  3RYH A;  2YS8 A;  5H5N A;  1NT2 B;  3UM7 A;  4QE7 A;  2NN4 A;  2ZIO A;  4MTX A;  4R7C A;  5B1A B;  5LP6 C;  3CRA A;  2UXX A;  2FTK A;  3ZBH A;  5LHG A;  4B3R O;  1KD1 W;  1US6 A;  1SES A;  2BSK A;  4MSW C;  1ARO P;  4NYK A;  5J2T B;  2F4V B;  1R6K A;  4DW0 A;  1IBM B;  2CDY A;  4XDJ A;  2BTQ A;  5J2U A;  2EIJ C;  2P7T C;  4P9P A;  1NI8 A;  4I55 B;  3GWO A;  3IGA C;  4JAV A;  5CN0 A;  3QF7 A;  5KUK A;  4OPA A;  1YTF D;  1GTO A;  3CCQ V;  4X89 A;  1S0V A;  1U96 A;  4H13 B;  3D3Q A;  5HFM A;  2AW9 A;  3AG4 B;  4O4L A;  5CBF A;  4CS3 A;  1J5E O;  3RYF B;  1VQK V;  1JFF A;  2EJ7 A;  4UCT A;  3OUS A;  4TT3 G;  2Q6A A;  4QJF B;  5EBM C;  4U3J B;  5FNV B;  1K5S A;  3OTO O;  1O9G A;  1PL0 A;  4PI2 A;  4MVZ A;  4UV9 A;  5LYJ B;  1WB7 A;  3CE2 A;  3OMA B;  4DYL A;  4IGG A;  4JV5 O;  3B8N A;  4X65 B;  1Q3E A;  4ICG A;  5GON A;  3OMI B;  3H1J H;  3JD3 A;  1VF6 A;  1BCC H;  1R1B A;  3EFF K;  4FK5 C;  3HPL C;  2OWO A;  4PI0 A;  4DV6 O;  4B3T O;  3N2K A;  4MT8 A;  4Z1M G;  4DUZ O;  1HW7 A;  3Q4H B;  3ZJZ A;  2Q68 A;  1XIL A;  2CUG A;  2Y0P A;  5ITZ B;  3W7T A;  3FB8 C;  4LFB B;  3J7A U;  4FFB B;  3CCE V;  5LHI A;  4EFE A;  2BSK B;  1VMG A;  3EHB B;  1QBZ A;  3SGI A;  2EZO A;  4CH6 A;  2QE7 G;  5B3S B;  4TSF G;  5CMU A;  3W7U A;  2FL4 A;  5LA6 B;  1E1R G;  4DR6 B;  4KFM A;  3CPW U;  2Q73 A;  2A7W A;  4DR5 O;  4L8J A;  4GX5 A;  4KHP B;  1YXB A;  3G6B A;  5IYZ A;  4JV5 B;  3OEE G;  3W7X A;  1G1X B;  2QJ1 A;  3G71 V;  1D2D A;  3AK3 A;  3CC2 V;  2A79 B;  2DYS B;  3BY6 A;  1XNR B;  4LF9 O;  1ROP A;  5IWA O;  3ABK C;  4JI8 B;  5L3C A;  4FM0 A;  4MVR A;  5KMG B;  5LOV B;  5BXZ A;  5IY5 C;  4LFC B;  3P3N A;  4YY3 B;  1QLE B;  1XHX A;  1M5I A;  5KAF Z;  2B9Z A;  2XOK G;  4TUY A;  5FNV A;  4CH4 A;  1H2L A;  3H9V A;  2A3Q A;  2FKX A;  1RP3 B;  5KX5 B;  4YHH B;  4MVO A;  1HNW B;  4TUY B;  4R6Z A;  2EIM B;  4ABM A;  3OM3 B;  4MW3 A;  2YXH A;  5B66 Z;  1VQP V;  2LP7 A;  4UVB A;  2K9P A;  2QWN B;  2HG5 C;  2WLK A;  1FKA O;  2UU9 O;  1ORQ C;  3JAR B;  3CC7 V;  3U0Z A;  5JCO C;  4DR6 O;  1NR7 A;  2QTS A;  3HKC A;  1FS0 G;  2XAQ A;  1SQQ H;  4I50 A;  2V4D A;  4DR1 O;  2B1I A;  4FPP A;  5B1A C;  3HB3 B;  3MAQ A;  1IVS A;  2Q5Z A;  1FFT B;  4U3J A;  1TAE A;  3JD2 A;  4ZOL A;  2PI5 A;  5LBQ A;  2N04 A;  3ZIA G;  1G8M A;  4MVU A;  4LF8 O;  3TK1 A;  3ABT A;  4O4I B;  5KA6 A;  4PA6 A;  1JA8 A;  1S3J A;  3STZ C;  1JPX A;  1V54 C;  3B77 A;  3KCY A;  2QSA A;  1VF5 B;  3SPH A;  5L3G A;  5K1P A;  2YIB D;  3FYE B;  2Q69 A;  5CBH A;  5DED A;  4WF9 V;  1IXB A;  1H38 A;  3JAK B;  4I4T A;  3PN1 A;  3SR2 C;  2F93 B;  4F6E A;  3HKD A;  1XBL A;  3DGE A;  3Q4H A;  3ZRV A;  1N32 O;  4DR4 O;  5LMN O;  3DC6 A;  3ZRS A;  1WAZ A;  3QG5 A;  1WP8 A;  4O2A B;  4WBN B;  4F6R A;  2AZ0 A;  1EM1 A;  3SDL A;  4JI0 O;  3CD6 V;  2BE3 A;  3JAW B;  2CTP A;  3FKS G;  4FMT A;  4UCU A;  3IC9 A;  4ZKI A;  2E5L O;  4G28 B;  2UUB O;  2ZE5 A;  2PTM A;  2JGD A;  4RQE A;  1P7G A;  3WB0 A;  3T2M A;  3GWK C;  3ASN B;  1IZ3 A;  3BAB A;  4JI2 B;  3CRR A;  1D5A A;  4JI5 O;  4JTA B;  5KAI Z;  1W2B U;  4X66 B;  2ZE7 A;  1P49 A;  1H2S B;  3ABM B;  1UFI A;  2DQ0 A;  3HKE A;  1UJW B;  2HP8 A;  2WLL A;  3KCX A;  4QIW F;  4U7N A;  1N34 B;  4LF8 B;  3SJQ C;  1LUV A;  1O9H A;  3W7W A;  2KB1 A;  4DRX B;  2R9I A;  3WG7 C;  3CCR V;  2YI8 A;  2P5O A;  1Y74 A;  4O4H B;  3TCU A;  2WA4 A;  5IYZ B;  1M57 C;  3BA9 A;  4DRX A;  2BOB C;  2ZQM A;  3AG1 B;  4FFK A;  3ASO B;  2W0F C;  4FVM A;  1JOY A;  2GUZ A;  1VQ7 V;  4DV6 B;  2PI4 A;  2QM8 A;  1NTM H;  4DR4 B;  2EIK C;  4J42 A;  1NR1 A;  3OTO B;  2Y4U A;  3RFR A;  1Q90 D;  2RDC A;  3K03 A;  1MZF A;  3RN4 A;  2C2A A;  4FLY A;  3AG3 C;  5IJ0 A;  5J2T A;  4AI8 A;  4CBC A;  1IBL B;  4JYC A;  5LHH A;  3OFN G;  3ETD A;  5IYD O;  3CCJ V;  2W0X A;  1SC5 B;  1AP5 A;  4TQD A;  5B5E Z;  2OCC C;  4OPH A;  2ZXW B;  4AIL C;  4MVS A;  3QO7 A;  5LL6 Y;  3CEI A;  3QNE A;  4X1I B;  3JAK A;  1FXH A;  1U97 A;  2UXD B;  3ZHS A;  5F2V O;  4J80 A;  2GBO A;  5J2U B;  3ETQ A;  4I50 B;  4DR7 O;  2VS0 A;  1K4C C;  3K3W A;  5LP6 A;  4FJC C;  4J41 A;  1EN4 A;  3CCS V;  4RUE A;  4JI4 O;  3FAV A;  3BFR A;  1N36 O;  3LSU A;  3IC7 A;  2A0L A;  4NVP A;  4N21 A;  3AG3 B;  3T4Z A;  4DV4 B;  1AIL A;  3ZHV A;  4OX9 O;  4K0K B;  4H37 A;  1GMG A;  4NXM O;  1SQF A;  4JI1 B;  3O9O A;  3H1L H;  4KXR A;  4UVA A;  4A5U B;  4WCE V;  3CCU V;  3ZRW A;  3P32 A;  4ZOL B;  2CTW A;  2R72 A;  3RYH B;  2UUC B;  3THO A;  4GX0 A;  4OGQ B;  1OV9 A;  1H2N A;  1HNZ O;  1QU7 A;  1M56 B;  4O4J B;  5C8Y B;  1P4R A;  2KQX A;  4D7S A;  2WAM A;  1X4T A;  2HEP A;  2Z0A A;  3ICX A;  2XND G;  1KP2 A;  5TIS Z;  1ZUQ A;  4LF9 B;  3NR7 A;  4P30 A;  3F7Y C;  5JJN B;  4EB6 B;  2ARH A;  2ZM6 O;  4KL1 A;  2OTJ V;  3RBZ A;  1XHZ A;  4LFC O;  1K9M W;  1RFY A;  1WPB A;  4UCS A;  4UXN A;  5EC2 C;  4BW9 A;  3N2G B;  2ITC C;  3TGU H;  3T1H O;  3UT5 A;  1AR1 B;  1V54 B;  4UB6 Z;  2LFR A;  4JZG A;  4DR1 B;  2VQF O;  1OHH G;  2ADQ B;  5BY1 A;  4YHH O;  2EIM C;  1R3J C;  5L3B A;  1VQO V;  2P6J A;  1BMF G;  4CH5 A;  3KZI Z;  4I7Z B;  2AZ2 A;  4JI1 O;  1MMM A;  2WPD G;  1JX9 A;  3VQV A;  3J80 N;  2H94 A;  3BAA A;  4KP4 A;  2LQT A;  2UUC O;  1QR9 A;  4DV2 B;  1YEW A;  2HHH O;  1M4U A;  3HKB A;  2BTO A;  5LA6 A;  5LGT A;  1Y66 A;  1XMQ O;  4JTC B;  3A8T A;  1J5E B;  1VF7 A;  3LDC A;  1YIJ V;  1W0J G;  3X2Q B;  1BS3 A;  4I0X B;  3ZED A;  1Q6I A;  3CRC A;  3ETE A;  1H2K A;  1MAB G;  2CH7 B;  2ZD9 A;  2N74 A;  1YF2 A;  3N2G A;  4NXN B;  1K97 A;  3K9S A;  3CX5 F;  1OCR C;  1TUE B;  1IX9 A;  2RN9 A;  3H1I H;  1WA8 A;  3APQ A;  4JAS A;  1KU9 A;  1S5H C;  5KHJ A;  4FLX A;  2IJH A;  1NU1 H;  1N32 B;  1EZV H;  2XAG A;  5KUM A;  3BRC A;  2JJ1 G;  2HVK C;  1SQV H;  4X1I A;  1JR9 A;  1ZSP A;  3HKB B;  5BZB A;  5H2F Z;  2GTS A;  5KA5 A;  1NQT A;  1XL4 A;  3SYC A;  5LXT B;  4PV1 B;  4NTX A;  1YJN V;  3VQX A;  4LP8 A;  4IIJ B;  4UCO A;  4QNH B;  3RYC A;  3IFX A;  2GDS A;  2W6I G;  1SQB H;  3OR6 C;  1FAF A;  3SYO A;  1M1K W;  2F66 C;  2QTO A;  5EZY B;  3RT3 C;  2M7W A;  1VQ8 V;  3TXS A;  4YIP A;  5JQG B;  5EZY A;  4O4H A;  1S5L Z;  2EUL A;  4DV1 B;  1I08 A;  1AJP A;  2H3O A;  4JI8 O;  5GON B;  2UXD O;  2W6J G;  1Q5O A;  3CJH A;  3CMA V;  2DN9 A;  2B1G A;  4BIU A;  2DYR C;  4JGS A;  3OAA G;  1YJW V;  2DWE C;  2XHB A;  5IJ9 A;  2OIG A;  4K8X A;  4B08 A;  3E89 A;  1MSW D;  4R50 A;  3UO3 A;  3ZN0 A;  1F51 A;  1NVP D;  3FB7 C;  2WA3 A;  3SJB C;  1JFF B;  3H1K H;  1XL6 A;  4FLU A;  5KHH A;  4UUJ C;  2RMK B;  4PA4 A;  2UU9 B;  3STL C;  3UO2 A;  2IU3 A;  4XDL A;  1F23 A;  2KKW A;  2WLI B;  2M6Y A;  1HNZ B;  3LDD A;  2QR4 A;  2JJ2 G;  3BCC H;  2HKO A;  1BE3 H;  3ZHT A;  3ABL C;  3L74 H;  4E2L A;  1XI1 A;  1NH2 B;  1GH6 A;  1Q6U A;  1JQ0 A;  4RUF A;  4RO2 A;  2R9A A;  2OT5 A;  1G4Y B;  1H8H G;  2BTQ B;  4P2Z A;  3I5D A;  1YSC A;  4DXW A;  5D5Q A;  1S5J A;  4OXS A;  2VWK A;  3OGI B;  1Q43 A;  1NTK H;  2HR3 A;  3RYC B;  4LF5 B;  3RYI A;  3E86 A;  5LXT A;  3LSQ A;  4WFF A;  3EVK A;  2EIK B;  4LCU C;  3K06 A;  1VQM V;  3FX7 A;  3CHX A;  4NKG B;  4HNA A;  2VQF B;  5JQG A;  4W4K A;  1JVM A;  2Z3Y A;  1GM8 A;  4FM2 A;  3OMN B;  2ETN A;  4LWS B;  1F4M A;  2YIC A;  3H1H H;  1K3E A;  2QWR B;  4EEQ A;  1ZTE A;  3ZMT A;  2AXT Z;  1PNK A;  5LMU B;  3A0B Z;  5B1B C;  4DUZ B;  2KG7 B;  1JMK C;  4LFB O;  3P30 A;  1FXK B;  1GN4 A;  1LUW A;  2ZNJ A;  2EIL C;  4K8Z A;  3AG4 C;  2UUB B;  4JI3 O;  2GUZ B;  3ZHQ A;  5FPR A;  3QVN A;  4EFB A;  1RPO A;  4LF4 B;  1HP8 A;  4NTY A;  4JF3 A;  1N34 O;  2IU0 A;  3CWB H;  5ITZ A;  4GKK B;  3SPG A;  2ZR2 A;  3H01 A;  4X66 O;  3CME V;  1AR4 A;  2RQ6 A;  3DTU B;  3E35 A;  4NR1 A;  4ZBM A;  2DQ3 A;  2Q7H A;  3R65 A;  4HYO A;  4IYH A;  4MTG A;  4GCZ A;  4TV9 A;  2DOS A;  5JJE B;  1QHT A;  1SZX A;  4J11 A;  5IWA B;  3D36 A;  2LGQ A;  4YJ2 A;  1Z5W A;  3ZCC A;  3JAS B;  1TUB B;  3VOU A;  1Q7Y W;  3ASO C;  4LF7 B;  3B2E E;  4NXN O;  1M93 A;  1CEZ A;  1M57 B;  2IW5 A;  1KKC A;  4KHP O;  5IYB O;  4BW5 A;  2OTL V;  2PY5 A;  3CRQ A;  3E8F A;  1I5Y A;  2ATK C;  3OW2 U;  4I9W A;  3B8M A;  2VQE B;  1IBK B;  1VQN V;  1DLB A;  1N33 B;  5B1O A;  4JYB A;  2WLI A;  2QWQ B;  2PGG A;  2NR5 A;  1RSO B;  4TV8 A;  3W7S A;  2D3O W;  1AI6 A;  4ZI7 B;  4IT5 A;  4FM1 A;  1PPJ H;  1HNX B;  4LFA O;  2F23 A;  1N36 B;  1Q8I A;  3ZN1 A;  3K59 A;  3RGB A;  3OEH G;  1VAR A;  2LO1 A;  4J7Z A;  5JJJ B;  4JAU A;  1IDS A;  2OCC B;  4AHC A;  3A0H Z;  2JGU A;  1XNQ O;  1GK9 A;  1V55 B;  2EIL B;  3OD4 A;  1QLE C;  4LH7 A;  2F43 G;  1Y76 A;  4YJ3 B;  5EBL C;  2EIN C;  1E79 G;  1TVK A;  3GB7 C;  4ZIB A;  3ABK B;  1Y6X A;  4D6T H;  4GYC B;  2BCC H;  1N8R W;  3K0G A;  4BIO A;  1MA1 A;  3OE7 G;  1M56 C;  3C3S A;  1D5N A;  1OCO C;  1IUR A;  1OCC C;  4LWS A;  4NTW A;  1K5Q A;  5EBW C;  3AK1 A;  2YSU B;  1XQ8 A;  3WB2 A;  5KLV H;  2IJI A;  1BGY H;  2Y4T A;  4MTF A;  1SA0 B;  2GV9 A;  3K9A A;  4DW1 A;  4BR6 A;  4I0X A;  1VQ9 V;  5IJ9 B;  4LFA B;  2Q67 A;  4HZ3 A;  1I5X A;  3C90 A;  1H2M A;  2X0L A;  4J10 A;  3LDE A;  3E2E A;  1SRY A;  1H8E G;  2V1D A;  2WLH A;  4KUM A;  2ILM A;  1KB9 F;  1KMI Z;  4JPR A;  4J9Z B;  2OCH A;  3JAL A;  4JI0 B;  2HFE C;  3JD4 A;  1EN5 A;  4I4T B;  2V7Q G;  4PEL A;  3SPJ A;  4B7K A;  3J81 N;  1S72 V;  1Y74 B;  5IY5 B;  3G67 A;  4JI5 B;  5C93 A;  5L3D A;  1TA8 A;  5D5P A;  3M99 B;  3S3W A;  2WLL B;  5FPO A;  3ETG A;  4E4E A;  1DF5 A;  5K1X A;  1Q81 W;  1VIB A;  3E8G A;  2CH7 A;  4MW8 A;  4EB6 A;  1I94 O;  2Q7E A;  2WWW A;  4QPK A;  4GX1 A;  2IJJ A;  4G27 B;  4JI3 B;  4IL6 Z;  3PJS K;  3SYQ A;  2XUM A;  1SZT A;  5FL7 G;  1ZLZ A;  3T4D A;  1DF4 A;  3D3I A;  2FYU H;  4TV8 B;  1BQZ A;  4ASU G;  2R70 A;  1PD3 A;  2JEU A;  1MSD A;  3LNM B;  3QO5 A;  4X88 A;  4WFG A;  2ZKO A;  4ZI7 A;  4PDL A;  2PZS A;  5LYJ A;  2MK3 A;  3WB1 A;  1GKF A;  4LH6 A;  2NLJ C;  4Q20 A;  3JD0 A;  5CA3 A;  4X9Q A;  1B04 A;  2ZE6 A;  3MDS A;  5CBG A;  4O2B B;  2JS5 A;  3R66 A;  1ZX3 A;  1CXZ B;  3E83 A;  2DW4 A;  1SQG A;  3E8B A;  1BHA A;  4O2A A;  5FLX N;  2HJF C;  1B06 A;  1RM1 B;  2DE0 X;  3RYF A;  4GKK O;  1MNG A;  1GM9 A;  4J9Y B;  5EYP A;  3AEI A;  2XAF A;  3LUT B;  5J9P C;  5L3F A;  1L0N H;  5H9C A;  1N4C A;  4CZZ A;  4DV7 B;  1ZWI C;  5KHI A;  1YI2 V;  4DV1 O;  3JCZ A;  2LW7 A;  1P7B A;  4WFB V;  4N23 A;  5GTH Z;  4U3F H;  3ZMS A;  1K33 A;  5CA0 B;  1T5E A;  2CTQ A;  4UV8 A;  3B4S A;  1SER A;  2EIN B;  4PDM A;  4AQY B;  1XOU A;  1I0H A;  3L73 H;  1AJQ A;  4B3T B;  4GUN A;  1SF9 A;  5IDJ A;  1WLE A;  2WSS G;  3T1H B;  3G4S V;  1YJ9 V;  3MHH C;  1P84 F;  2E75 B;  4R8C A;  1NVP B;  3FYI B;  1F7Y A;  2YIB A;  4IYI A;  1B6Q A;  5JVD B;  3T1C A;  4WBN A;  2JIZ G;  3K04 A;  5CB4 B;  3L9D A;  4UCR A;  1VQ4 V;  3DXR A;  5LGN A;  2QDO A;  5CA0 A;  3CC4 V;  1K92 A;  5C8Y A;  3L72 H;  4DR5 B;  1AVM A;  4GKJ B;  5HFL A;  4TOI A;  1AP6 A;  1QNM A;  1RSO A;  1YTF B;  3JYC A;  1WJZ A;  2JRI A;  2AHY A;  4DUY O;  1YCI A;  1NZ6 A;  2PYJ A;  4QGP A;  5JH7 A;  3BEH A;  4PDR A;  3VQY A;  2E3C A;  3JAM N;  3A0R A;  5BR8 O;  3M8A A;  3T1Y O;  1N0J A;  1XNQ B;  1NKD A;  5KMG A;  2ODM A;  2ZDI A;  2CK3 G;  3WFV A;  4LF5 O;  2IM9 A;  4B3S B;  2DYS C;  2CE4 A;  3GVM A;  4X20 B;  2ZT9 B;  2EX3 A;  1EZJ A;  2ZE8 A;  1XMQ B;  3IJ4 A;  3HKC B;  4X64 O;  3MD0 A;  4IHJ A;  1ZL8 B;  3O65 A;  1PL4 A;  4QPJ A;  4HNA B;  4RQF A;  4H44 B;  1KEC A;  3DXR B;  2YXY A;  5IYC O;  2ITD C;  4EKW A;  1YIT V;  5LMU O;  1YDX A;  1R3K C;  3RYI B;  3L75 H;  4UCV A;  1SKV A;  2YXL A;  5DN6 G;  3VBB A;  5IJ0 B;  1K4D C;  2X6A A;  4O2B A;  1XEQ A;  1IBL O;  2Q0A A;  3X2Q C;  4DO2 A;  1KP3 A;  1TGO A;  1EFR G;  4LF6 B;  3CSX A;  4H33 A;  1CP9 A;  4K35 A;  4FLW A;  3OUF A;  5LGU A;  2Y69 B;  1L0L H;  3N2K B;  3SYP A;  3FFQ A;  2HJD A;  4UB8 Z;  3CCM V;  2EJR A;  2E74 B;  2YC0 A;  3LSS A;  4JI4 B;  1WP7 A;  4B7E A;  3K0D A;  5LOV A;  1W0K G;  4B3M O;  5B1B B;  3RW0 A;  2WLN A;  3KKY A;  3APO A;  5JVD A;  3K5M A;  4P9O A;  2QGN A;  4GX2 A;  1TVK B;  1BZK A;  4CH3 A;  1OCZ B;  1XMO B;  2JK5 C;  4Q6G A;  3D36 C;  1HWY A;  1OCZ C;  5AG2 A;  2Q8V A;  1VQ6 V;  3SJC C;  5EIB D;  4XDK A;  4X62 O;  5LMN B;  5A2Q N;  1QLN A;  4JI7 B;  4RWU A;  4JYA O;  2Q9L A;  1I94 B;  1K8A W;  4X65 O;  2N05 A;  1V9P A;  2Y69 C;  1Y67 A;  3MHS C;  4FZ1 A;  1SA0 A;  2ZR3 A;  1YHQ V;  1G6U A;  1E1Q G;  2HLD G;  3SPI A;  1Z2G A;  4DK1 A;  3AG1 C;  2ZCE A;  3E8H A;  3RVZ A;  2ZXW C;  4YIO A;  2Z5U A;  1FJG B;  2QM7 A;  2IBZ H;  3QTC A;  2YIA A;  2A9H A;  4PD4 F;  1KKD A;  2UUA O;  3JCU Z;  5DEC A;  1CPY A;  1VQL V;  3ABU A;  4PDV A;  2E76 B;  4DR3 O;  2UXC O;  1K73 W;  1YVW A;  5EC1 C;  2ADP A;  3UKM A;  1BT8 A;  1XDC A;  2ZIN A;  3ZHR A;  3E22 B;  2PUS A;  5BMV A;  3G80 A;  4UFZ A;  2G38 A;  4DV2 O;  1OCO B;  1QVG U;  4NB5 A;  2H8P C;  1GRJ A;  2EZP A;  4F6R B;  2ZDI C;  4JYA B;  3JD1 A;  4FIP C;  3CYO A;  3U10 A;  3OGC C;  3SPC A;  2YEV A; 
#chains in the Genus database with same CATH homology
 2QWR B;  3UO3 A;  2DMX A;  2QWP B;  4IT5 A;  2CTW A;  2L6L A;  1WJZ A;  1IUR A;  2QSA A;  2N05 A;  1FPO A;  2CUG A;  1FAF A;  2CTQ A;  2QWO B;  1GH6 A;  2DN9 A;  1NZ6 A;  2CTR A;  2GUZ A;  3APQ A;  1N4C A;  2YS8 A;  2CTP A;  2QWN B;  2Y4T A;  2EJ7 A;  2KQX A;  3UO2 A;  2N04 A;  2PF4 E;  1HDJ A;  2LO1 A;  2Y4U A;  2LGW A;  1BQZ A;  2OCH A;  4J7Z A;  1BQ0 A;  2GUZ B;  4RWU A;  3AG7 A;  3APO A;  4J80 A;  2M6Y A;  1XBL A;  3UCS C;  2QWQ B;  2YUA A;  3BVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...