2M6YA

The solution structure of the j-domain of human dnaja1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'MGHHHHHHSHMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily A member 1
molecule tags Chaperone
source organism Homo sapiens
publication title Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.
pubmed doi rcsb
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2m6yA01
2DMXA 2LO1A 2QWNB 4IT5A 3UCSC 2YUAA 3APQA 3UO2A 2GUZA 2QWRB 1FAFA 3APOA 3BVOA 2CTWA 2N04A 2CTPA 1WJZA 2GUZB 2QSAA 2YS8A 2CUGA 2QWOB 1BQZA 2OCHA 1XBLA 1NZ6A 2CTQA 2Y4TA 4RWUA 2N05A 1IURA 2QWQB 2L6LA 1N4CA 3AG7A 2DN9A 4J7ZA 1HDJA 2CTRA 2PF4E 2QWPB 1FPOA 2Y4UA 2KQXA 2EJ7A 3UO3A 1BQ0A 2LGWA 4J80A 2M6YA 1GH6A
chains in the Genus database with same CATH superfamily
5E79Z 3CCMV 1Q6HA 4B3RO 2Q8VA 2QSAA 5EZYA 2F66C 1JOYA 2QKSA 1FXKA 2ADPA 3ABKB 4I55B 4MW3A 3SR2C 2WAMA 4I5SA 3SPHA 3L75H 5F2VO 3HKBB 4FLUA 2WLLB 3JSNA 4OPHA 2HJDA 4IGGA 3A2FA 3WG7C 1BHBA 2YXYA 2P5OA 1AP6A 1N33O 1IDSA 1YCIA 4H37A 1XEQA 4RWUA 4MVRA 1W2BU 3QNEA 2EIKC 1EM1A 1SESA 1HDJA 3WG7B 2EULA 5EC2C 5LP6C 4RUEA 5D5PA 4R8CA 2IJJA 3JCZA 1WLEA 5K1PA 2HHHB 4YY3O 2HLDG 1VQLV 2OTLV 1OZ0A 4LFBB 3D3IA 4ASUG 1M9NA 1IBKB 3VQVA 1KECA 2OTJV 3AK2A 4J41A 4D7TA 4DR6O 1H2MA 4UCSA 5KX5B 1BS3A 4DV6O 2Q7HA 5BY1A 1DLBA 2ZE6A 1VF5B 3JD1A 1F7YA 4DV2O 4KUMA 1W0JG 3RYHB 2EX3A 3BY6A 4LCUC 2QTSA 1XMQO 4QGPA 1BGYH 1BL8A 4FLWA 2E5LB 1XHXA 3QO7A 4I4TB 1OCCC 3BA8A 3BHPA 3CPWU 1JJ2U 3EHBB 1KP3A 2PTMA 2X6BA 3DC6A 2DQ0A 4LF9B 2ZQMA 3T2MA 1LNQA 2RQ6A 1V55C 4UCOA 1AR5A 4DV0O 1V9PA 4O2AB 5B1AC 4DYLA 1V54C 4HAMA 1Y4MA 4CC6A 4FLTA 5DEDA 1S5HC 3JYCA 2Y4TA 1HNXO 4ZOLB 3K9AA 5IWAB 4I0XA 2X6AA 2L6LA 4U3FH 2ZXWC 4ZHQA 1S72V 4R50A 4JI3B 2QTOA 3UO3A 4J11A 4WBNA 3OM3B 5L3CA 1KD1W 4DR4O 4X62O 4LF5B 4CS4A 3E2EA 3F7YC 4WCEV 2Q67A 5EBMC 4MT8A 2UUBO 2GSMB 1K9MW 5H6RA 1GAXA 2A06H 3SYOA 4DO2A 2YEVA 3H1IH 2AXTZ 3UQ8A 1SQBH 4YY3B 2QJ1A 1YZBA 1N4CA 4X20B 2EINC 4H0LB 5LGUA 2JIZG 4ZI7B 3OMIB 4DV4B 3L71H 5H6QA 5B66Z 5CA0A 4RQEA 4XDLA 3H1HH 4DR5O 2OIGA 1BCCH 2YSUB 2Q73A 3DTUB 1HW7A 4P2ZA 1JX9A 5FNVA 1JVMA 3G80A 3RYIB 5JQGA 4JI4O 1S76D 1KKDA 3ML0A 3LDCA 4YXWG 4DR7B 3K5MA 3FKSG 3THOA 2ETNA 4NTXA 4PDRA 3ZRSA 1H38A 3L74H 1N34O 4W4LA 4G27B 2LW7A 4DV5B 4HYOA 3UCSC 4QE7A 5LBQA 3CCUV 1D5NA 3K03A 1XDCA 1N0NA 5LP6B 3A0BZ 2AHYA 4Q20A 3ABLB 4MSWC 4QJFB 4WFBV 3FB7C 3BFRA 1QLNA 5KHJA 4MVUA 2XAFA 5KX5A 3DXRA 3ZHVA 3SJQC 1GKFA 2WLHA 3QTCA 3VQYA 3SYPA 2WLNA 1ZUQA 3E86A 4B3TB 3T1CA 4O4HB 1UFIA 2HKOA 2BSKB 3ZS8C 5IJ9A 1F4NA 1XBLA 3CP1A 2AHZA 4DV1B 2VS0A 2DW4A 1H8EG 2GBOA 1NTMH 5IWAO 2XAHA 1GTOA 3OUSA 1BE3H 2RMKB 1YJ9V 1PL0A 2UU9B 3ETEA 4KHPO 1AI7A 2A79B 1Z5VA 2DWEC 3M8AA 4DV7O 2N04A 4I50A 1WB7A 1XUQA 3ZHRA 3TK1A 1S77D 4K35A 2W0XA 2V1DA 1M56C 2F1MA 1OJHA 1K97A 1P7GA 3AG3C 3NR7A 3HPLC 3SJAC 3A0RA 5J2TB 1XMQB 1HNZO 1VQ5V 1IBKO 5LA6B 1VQ9V 1LUVA 4B3RB 4H13B 1SQXH 1I5YA 2Z5UA 1XL6A 1QQCA 4DR2O 5LGNA 2JS3A 1J5EB 5J2UA 5GTIZ 5B1AB 3JAMN 5LXTB 1QVGU 3BAAA 1Z2GA 3CX5F 5B1OA 1GM9A 1H2GA 4BW9A 1NH2D 1JPXA 4UV8A 2VRZA 5CB4A 1IBMO 4K0KO 3AG4B 1VQPV 1JQ0A 4DR4B 2ZINA 1G6UA 4MTXA 1KBHA 4X88A 3W7WA 2PI4A 4IIJA 1IXBA 4AILC 5IY5B 1XL4A 2DMXA 4O4LB 1Q3EA 1FAFA 3BRCA 1H8HG 1KKCA 3H1JH 4X9QA 4X89A 3CS5A 4B3TO 1YF2A 4JTCB 2NN4A 1MSDA 1Q86W 4X65B 1DF5A 2LP7A 2YC0A 3KCXA 1KQSU 3ABLC 3C90A 3RYFA 4NKGB 5LHHA 3S3WA 2DYSC 3U11A 1I7FA 1WA8B 1ZAUA 4DR3B 2L35A 3ZRXA 2LFSA 4IHJB 2PY5A 5KHIA 3RYCB 1R6TA 4JPRA 1R73A 1Q8IA 4J9YB 4JAAA 2UXDO 2BOBC 3ZMVA 5JH7B 2EIKB 3MHSC 4HNAB 1FFXA 2EBOA 1QVFU 1MA1A 1NTZH 4LP8A 5H2FZ 4JI1B 2IJHA 1XNQB 3OR6C 2YI8A 3O9OA 3WB1A 1YIJV 3HB3B 2P22C 1OCZC 1EN4A 3ABTA 4LNUA 4CZZA 3ASNC 1MNGA 3SYAA 5E1AC 3IC9A 3TCUA 3G4SV 2YXHA 2R70A 3CSXA 3AG4C 1N32O 4TOIA 4ZHQB 4DV2B 2YXLA 2WLIB 5JVDB 1D2DA 1EZVH 4UB6Z 5EIBC 4F4LA 4TQFA 1ENVA 3ZRWB 2WSSG 5LL6Y 1YEWA 5C8YB 4GUNA 3ZHUA 3B40A 4BIOA 4DV7B 3N2GB 4MVSA 4X62B 1VF6A 3FFQA 1FS0G 5KHKA 3GWKC 2XHBA 1HWYA 4O2BA 3MD0A 3D3QA 1QHTA 1D5AA 1GM8A 1MZEA 1MMMA 3JSLA 2UXCB 3ZN0A 4RUFA 1M90W 3OE7G 4PDMA 4F6RB 4JI2B 4DV4O 5L3EA 4UFZA 5CBFA 3B8NA 3B77A 2QM7A 2Y48A 3APQA 5KUKA 2UUAO 1K33A 1AI6A 3FAVB 2WLLA 1AJQA 3RGBA 3HKDB 1AJNA 5LHGA 3RYHA 3RT3C 2RJZA 3CB2A 2V4DA 2NR5A 1Q81W 4LFAB 1B3QA 1COWG 1YTFD 4F6RA 2EJRA 1CEZA 2ZM6O 3S3XA 4IYHA 3OD4A 2LO1A 1VEWA 2JGUA 1US6A 1VQ8V 4UCRA 3CD6V 5JJNB 1IBMB 4K0KB 4OXSA 5LYJB 5JJJB 4X64O 3ZHSA 1VQ7V 4PA6A 1MABG 2R72A 1M56B 4NXMB 1URFA 1S0VA 3QVNA 4LWSA 4EB6B 4X1IA 1AJPA 4WFFA 3K5LA 4DUZO 4DRXA 3CC2V 2Q9LA 5KLVH 2F23A 4PDLA 4QE9A 2VQFO 3ZMSA 2EIMB 1GN3A 3CC4V 2Q0OC 3SPIA 3IC7A 2XNDG 3RBZA 1RFYA 2LGWA 3FB6C 1VP7A 3SJBC 2HG5C 4MTFA 2VWKA 5KA6A 5EZYB 3L9DA 2IJKA 4DV3B 2N74A 4QPKA 1Q90D 3DGEA 2XOKG 3P3NA 4ZI7A 2QA4V 3WB2A 3G6EV 5B3SB 1WPBA 1SF9A 3OW2U 5LOVA 1CP9A 4LF6B 2GUZA 2Y0IA 3JATB 3K08A 2ZE8A 1VF6C 4BIUA 1BZKA 1YSCA 3U0ZA 4X1KB 2E75B 1O9GA 4FLYA 3AK1A 4J7KA 2QM4A 4IYIA 3H01A 3OMNB 4E4EA 4B08A 4UXNA 1VQOV 3MDSA 3FAVA 1XHZA 4HNAA 5L3DA 4LFBO 4IHJA 3UKMA 4JI0B 2Z0AA 1YJWV 1G1XB 1OCCB 3B4SA 1F51A 4FFBB 3F5WC 2E3CA 4LNUB 4QNHB 5HFLA 2DYRC 2E74B 4CH5A 1GN6A 1ZWIC 3T4DA 3T4ZA 2QWRB 2BSKA 1R3LC 2GTAA 3H1LH 4H33A 1RM1B 2PZSA 1RPOA 5IYBO 1FFXB 4I9QA 5KAIZ 3I55V 3OFNG 2UUCB 4PDVA 2ODMA 1Y76A 1SRYA 3K58A 2CE4A 3T1YO 2GV9A 1VF7A 4JTDB 1B06A 1AI4A 2M6YA 1TAEA 2IBZH 1XMOO 4TV8A 2IM9A 2YIBA 3BPZA 2A9HA 4QIWF 3WFVA 5B1NA 3ZIAG 4WFGA 1OCZB 4NVPA 5L3GA 2YICA 4DUZB 3ZHQA 4I50B 4DUYO 2B1IA 4PA7A 2UXDB 1K3EA 3JARA 4J7ZA 3CRCA 4X20A 3SYCA 4LF7B 1FJGO 3BABA 3N2GA 1XOUA 3CRAA 5LA6A 3H9VA 4PA4A 2CGOA 3CJHA 2A0LA 1YDXA 3AG2C 1SQFA 5J2TA 2V7QG 3ZJZA 3CXCU 2D3OW 5FNVB 2WA3A 4GX5A 1JA8A 1QR9A 2E76B 3ZEDA 1O9HA 3GB7C 2K9PA 2Q0AA 3JALA 4HZ3A 5FPOA 2W6IG 1ZX3A 3JCUZ 5BMVA 1B6QA 2EZOA 4OX9B 2DN9A 1THZA 3AG1B 1R3IC 3UT5A 2AW9A 1S5JA 2WLKA 1WPXA 2H94A 3CJHB 3W7UA 2RCVA 3X2QC 1ROPA 4DV3O 1DF4A 4FLXA 1NJIW 3GWOA 3CCEV 3JAKB 1HR0O 1LUWA 5IYCO 2HJFC 3C3TA 1AILA 1RP3B 4FK5C 5EYPB 4O4LA 5LXTA 1MSWD 4J42A 5LMUB 4LF8O 2D2CB 2CGNA 1NQTA 4YJ2A 3STLC 5EBLC 2UXBO 2VQFB 1DGSA 1KC8W 1GRJA 3CCRV 3KKYA 4I9WA 1N34B 5BXZA 3ZX6A 2R9RB 3RVZA 3CRQA 5IYZA 4MTOA 3CCSV 4JAVA 1FXHA 4DRXB 4JZ2A 4LC1A 1HNXB 3OAAG 1M4UA 3RFRA 2QGNA 3D36C 2ARHA 2ZDIC 4N23A 3DC5A 4LFAO 1SKVA 4Z1MG 4UVBA 1EN5A 1IZ3A 3K06A 4DK1A 2EIMC 4CS3A 4X66O 1XILA 3F5TA 2QKAA 3ZMTA 2VWJA 1W0KG 2YIAA 3K9SA 3IJ4A 2UXNA 3K0GA 1I94B 1YHQV 2NNUA 1P49A 4RO2A 4DR1O 4TUYA 4K3AA 5ITZB 2HHHO 3TJTA 5KA5A 2PUSA 3JATA 5EK0A 1OHHG 4EFBA 2BCCH 4MTGA 3OT7A 1VQNV 2CH7B 4TT3G 1J95A 4BIZA 1HNWB 1TGOA 3B2EE 1ZTEA 1XNRB 4F6EA 4P9PA 4YJ3A 5J2UB 2EINB 1R6KA 4MVQA 4WF9V 4JYBA 1PP9H 4JTAB 4JV5O 2X0LA 1KB9F 2LW1A 5C8YA 1N33B 1SA0A 2WLJA 4FFBA 4JAUA 1PL4A 3B8MA 2ZCEA 1CPYA 3O65A 1MOFA 4PA9A 4U7OA 1GMGA 1K4DC 4DV5O 4W4KA 2QDOA 4YIPA 4GT1A 1GN4A 4X66B 4DV1O 1SQVH 1AR4A 4U3JB 3IAYA 1NTKH 5CBHA 4LF6O 2OIEA 2UUBB 4BWAA 1UPGA 2FTKA 2ZD9A 4ZKIA 5KMGA 4O4JA 2XASA 3DXRB 1K92A 2ZIMA 1N36B 1N32B 1Y76B 3K5OA 2GHYA 1JFFB 3EFFK 3X2QB 5LYJA 3PJSK 4QPJA 2Y69C 1YI2V 3HKDA 3D8CA 4KFMA 4NTWA 3RYCA 5L3FA 4EB6A 5DN6G 1HNZB 2ZR3A 1XNRO 1F4MA 3E22A 5A9GA 3B09A 4E2LA 2HP8A 4KHPB 4LR3A 1M5IA 4TQDA 1NH2B 5IE9A 3LSUA 4D7SA 3F7VC 2OWOA 3JD0A 1P7BA 5BR8O 4P30A 4LWSB 4LFCO 3CYOA 3UM7A 5D5QA 4FMTA 3SJCC 2K1EA 1B04A 4UVCA 5LMUO 3AK3A 5KUMA 1SZXA 1FXKB 4JI8O 1OCRB 4X65O 4MW8A 1TUBA 2WLIA 1S3JA 4JI5B 2EZPA 5H5NA 5LMNB 3ZRWA 1BQZA 2OCHA 1NZ6A 5KHGA 4FVMA 1ORQC 3E8HA 1YJNV 3WB0A 1SQQH 1G4YB 3TXQA 1IBLO 2OYQA 2JJ2G 4I7ZB 3BA9A 3OEEG 4GZRB 2LFRA 3DSQA 3SPJA 2KKWA 1FFTB 3IGAC 1Y74B 1FXKC 1RPRA 2UU9O 2WA4A 1L0LH 3AG3B 2HVKC 1J5EO 2FL4A 1VQ6V 2F43G 2M7WA 3P32A 1FXVA 3CMEV 4OX9O 5EYPA 2Y0PA 4X1KA 4YHHB 2AZ0A 4G2KA 2BTQB 4MVZA 1MZFA 4PELA 2AZ2A 1N36O 2H3OA 4JI1O 1KMIZ 3K5NA 1NU1H 5LHIA 5B5EZ 2GDSA 4DW0A 5K1XA 4UCTA 3JASA 4KL1A 4GKJO 2FMLA 2F4VB 3CCVV 4OPAA 3E89A 1QLEB 1EBOA 4DV0B 3G6BA 5IJ0B 2PYJA 4PI2A 1YVWA 5CN0A 2PF4E 1K8AW 2UXXA 3T1YB 2UXCO 3SDLA 2P06A 5CMUA 4DXWA 5BR8B 3M7MX 2DYSB 2CK3G 2ITDC 3TETA 1S5LZ 1NVPD 5KAFZ 4WFHA 5EIBD 1TUBB 1SA0B 4GYCB 1HP8A 4X1YB 3L72H 4TV9A 4JF3A 1NVPB 4KXRA 4DR5B 2LQTA 4LFCB 4JASA 3KZIZ 5J9PC 3A0HZ 5HFMA 1XREA 3WU2Z 3JAKA 4FLVA 2JDIG 1H2NA 3T1HB 3K04A 4UB8Z 1HNWO 3ZHTA 4AQYO 3ABKC 4YIOA 3UT5B 1JJOA 2GUZB 1VMGA 2KSDA 2QKCA 1EZJA 5CA1B 2X7RB 2N05A 3JD4A 3JD2A 3L73H 4LF5O 3P3PA 4OGQB 3KG2A 4EEQA 1BQ0A 5EBWC 5FPRA 2F93B 4IIJB 4J80A 1Y6XA 1H2LA 2BTOA 1K73W 3N2KA 1U97A 3CCQV 4O4IA 3C3SA 1GN2A 3QF7A 4NR1A 2JGDA 2UXBB 1ZL8A 3E35A 2KB1A 3ZBHA 3IFXA 1PNMA 1PKXA 1TUEB 1Y67A 4B3SB 3ASNB 2CDYA 4WBNB 5IYZB 4LF4O 3LSQA 3E83A 1Q5OA 3MHHC 4O4IB 4FM1A 4GX0A 3OMAB 3Q4HA 3SGIA 3SYQA 2QWOB 4ZBMA 1PPJH 1ZL8B 3PN1A 2B5UA 3J7AU 5ITZA 4JV5B 3ASOB 5DECA 4DR6B 2JEXA 2DE0X 2P6JA 2HEPA 4PHZA 2HVJC 2Q68A 4R7CA 3NXSA 1M93A 1K5QA 4AQYB 3W7XA 2CH7A 2IH3C 2P67A 2JRIA 1VQMV 3ABUA 1P84F 3LDEA 1IXMA 3U10A 2IU0A 3I5DA 5JQGB 1N8RW 4GKJB 1AB3A 2W0FC 3HKBA 3ZMZA 2JK5C 5GTHZ 5LOVB 2YUAA 5EC1C 2PI5A 5KHHA 1SQGA 2CUGA 3VOUA 2QWQB 1H2KA 2W6JG 1AP5A 4CBCA 1IVSA 5GONB 3CCJV 3N27A 1WP7A 4CH6A 4GLXA 1IBLB 4B7KA 2RN9A 3AG1C 2YIBD 1ZSPA 3HR0A 4CH4A 2ADQB 1WP8A 5LMNO 2B9ZA 1K4CC 3W7SA 4JZGA 4MVMA 4DK0A 4JI4B 1LR1A 1R6NA 1Q6UA 4JYCA 4U7NA 3RN4A 4G28B 5TISZ 3D36A 2ILMA 4PA3A 5JJEB 1KYOF 1VQKV 1BSMA 4CS2A 2CTPA 2DWDC 2OCCB 3I56V 2JEUA 3SPGA 2ZKOA 4C7UA 1XMOB 1YXBA 4GKKB 3ABMB 1I94O 1W59A 5IYDO 2WPDG 1PNKA 1IURA 1U96A 1FPOA 1R1BA 1TA8A 5KMGB 1WN7A 4DR7O 2EILB 3AG2B 4CH3A 2BE3A 1BMFG 4XDKA 1JMKC 3BVOA 2ITCC 4ZOLA 2UUCO 5IJ0A 5GW7A 4TWKA 1YITV 2HR3A 3EXAA 4YHHO 1R3JC 4KP4A 4UUJC 5JVDA 2LGQA 4LBEC 1P4RA 3G67A 1GH6A 4ICGA 4NTYA 4NYKA 4MS2A 3TGUH 3CCLV 4IL6Z 2IW5A 2XAJA 1IX9A 3CRRA 4NXNO 4JYAO 5CB4B 2ZXWB 2X6CA 1BHAA 2R9IA 4K8XA 4ZIBA 3J81N 4RAIA 3OR7C 4J10A 4CC5A 3GVMA 2OT5A 2MK3A 4HBNA 3M99B 1Q7YW 1L1FA 3MAQA 4AI8A 4JI7B 1VQ4V 3E8GA 1HR0B 1WAZA 1EFRG 3K3WA 1E1QG 3VBBA 4DUYB 4JI5O 2QEXV 3OGIB 3FYIB 2CTQA 3JD3A 3FX7A 4Z2WA 3ETGA 5CBGA 3JAWA 4XBFA 1M57C 1OCOB 1SC5B 5GONA 1I08A 4LH7A 3K79A 1BT8A 2P4KA 4IT5A 2IH1C 4GKKO 4JI6B 1Z5WA 3OEHG 2A7WA 2CTWA 2XAQA 2JJ1G 3CE2A 2Q4PA 2C2AA 1YTFB 1KP2A 4D6TH 2ZNJA 4UCUA 2YDEA 5LGTA 2ZR2A 1FJGB 4LF7O 1NBMG 5FLXN 4EFEA 4JI0O 1VIBA 3APOA 1CXZB 2IU3A 2H8PC 3LNNA 1WB8A 1R3KC 4BAYA 3AEIA 1AVMA 1RSOA 4O4HA 1G8MA 2QR4A 3A8TA 4FPPA 4BW5A 3ABMC 1XNQO 1NR7A 4YJ2B 1QBZA 1WA8A 4J7JA 2FKXA 1Q82W 4FM0A 4JI8B 4PD4F 3FD9A 4ABMA 2P7TC 3ASOC 1JFFA 1Q6IA 2Z3YA 4JI7O 3E22B 1MG1A 4FZ1A 3K0DA 2YEVB 1VARA 3RWRD 4N21A 3RVYA 4DR3O 2RDCA 3ICXA 3ETQA 4AHCA 3L70H 2XTAA 3CRMA 3T1HO 3VQXA 5B1BC 2XUMA 2HFEC 4DV6B 4DR2B 2Q69A 3HKEB 1WNSA 1FD9A 2G38A 2DYRB 4B7EA 1JCHA 1T5EA 1F23A 4I0XB 1QR8A 4UV9A 4RQFA 2JVDA 2EIJC 1FYJA 4GX1A 2QE7G 4TSFG 4NB5A 2KQXA 3FB5C 4P9OA 1SQPH 3E8FA 2EILC 4J9ZB 1QNMA 1I0HA 1SZTA 4DW1A 2CAZC 1KU9A 5AG2A 2VQEB 5IY5C 2ZIOA 2WWWA 4TV9B 1AI5A 2R9AA 2AGAA 3P30A 3R65A 5B3SC 2WLMA 4JGSA 1NKDA 3AG7A 4JYYA 2CTRA 3ZMUA 3ZN1A 2FB5A 2MW2B 5CA0B 1AR1B 3R66A 2QWNB 5LP6A 4FFKA 4H44B 3HKCA 3TXSA 1SETA 4U3JA 3QO5A 2JS5A 4PV1B 4YJ3B 5IJ9B 2F4VO 3LNMB 3CEIA 4B3MB 4K8ZA 3OTOB 3LDDA 2EJ7A 2ZDIA 3N2KB 2Y69B 4JI2O 1A32A 3CXHF 2ZNIA 3H1KH 5DM6V 1XQ8A 2E5LO 4WFEA 2ZT9B 2UUAB 4I4TA 1RSOB 5JH7A 4A5UB 1AROP 4R6ZA 4FLZA 2A3QA 1H2SB 3VQWA 5H9CA 4JI3O 1NI8A 4TV8B 1E79G 1RM1C 4B3SO 2OCCC 2PGGA 2PYLA 2YS8A 4X8AA 2JGDB 5IT9N 1E1RG 3ZCCA 2DQ3A 3Q4HB 3SPCA 3BEHA 4GX2A 4X64B 3JARB 4L87A 3OGCC 4LH6A 1V55B 1K7DA 2ZE5A 4FM2A 2NLJC 4FZ0A 3UO2A 4NXMO 5B1BB 4DR1B 4FJCC 4L8JA 3J80N 3CWBH 4PJ0Z 3CC7V 1L8DA 2Q7GA 5CA3A 3ZRVA 3K59A 5IDJA 5BZBA 1I5XA 2ZM6B 5JWPA 4LF8B 3JALB 1QCEA 4O2BB 5BMVB 2QM8A 1FKAO 3E8BA 1X59A 2RNBA 1NS1A 1PV0A 4LF9O 3OUFA 2YI9A 1KUQA 4X1YA 2IJIA 1EN6A 2DJVA 2F95B 4UCVA 3LUTB 3RYIA 2ATKC 4BR6A 4Z1VA 3JAWB 5JCOC 2KG7A 3RYFB 2QWPB 2Q6AA 2ZE7A 3EVKA 4B3MO 1NR1A 2BTQA 2YIDA 2DOSA 1QLEC 3RW0A 2P90A 3FYEB 4UVAA 1M1KW 4WFAV 1V54B 3BCCH 4EKWA 4NXNB 4JYAB 3HKCB 3QO8A 3STZC 3W7TA 4JI6O 1PM9A 5CA1A 4LF4B 5JCOA 1QU7A 2P4VA 1NT2B 1PNLA 1OCRC 1M57B 1OCOC 3K57A 1DK1A 2KG7B 3QG5A 2Y4UA 1GK9A 1XI1A 1GM7A 1ZLZA 3OTOO 1K34A 1UJWB 2GTSA 1Y74A 2VQEO 1SERA 1X4TA 3KCYA 5FL7G 1JR9A 1L0NH 1PD3A 3G71V 2BOCC 1Y66A 2XAGA 3CHXA 5A2QN 4Q6GA 5C93A 1TVKA 1K5SA 4MVOA 4GCZA 1DTOA 4O4JB 1N0JA 4XDJA 1Q43A 3FB8C 4X1IB 4FIPC 5L3BA 3ETDA 2Q5ZA 4O2AA 1WJZA 3HKEA 3OTFA 4TUYB 3CMAV 2O57A 2FYUH 1TVKB 2B1GA 4PI0A 2Q7EA 1SS3A 3LSSA 1OV9A 2EIJB 3JASB 2XT9A 4I55A 1GO3F 2LJ2A
chains in the Genus database with same CATH topology
2DMXA 2LO1A 2QWNB 4IT5A 3UCSC 2YUAA 3APQA 3UO2A 2GUZA 2QWRB 1FAFA 3APOA 3BVOA 2CTWA 2N04A 2CTPA 1WJZA 2GUZB 2QSAA 2YS8A 2CUGA 2QWOB 1BQZA 2OCHA 1XBLA 1NZ6A 2CTQA 2Y4TA 4RWUA 2N05A 1IURA 2QWQB 2L6LA 1N4CA 3AG7A 2DN9A 4J7ZA 1HDJA 2CTRA 2PF4E 2QWPB 1FPOA 2Y4UA 2KQXA 2EJ7A 3UO3A 1BQ0A 2LGWA 4J80A 2M6YA 1GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMX A;  2LO1 A;  2QWN B;  4IT5 A;  3UCS C;  2YUA A;  3APQ A;  3UO2 A;  2GUZ A;  2QWR B;  1FAF A;  3APO A;  3BVO A;  2CTW A;  2N04 A;  2CTP A;  1WJZ A;  2GUZ B;  2QSA A;  2YS8 A;  2CUG A;  2QWO B;  1BQZ A;  2OCH A;  1XBL A;  1NZ6 A;  2CTQ A;  2Y4T A;  4RWU A;  2N05 A;  1IUR A;  2QWQ B;  2L6L A;  1N4C A;  3AG7 A;  2DN9 A;  4J7Z A;  1HDJ A;  2CTR A;  2PF4 E;  2QWP B;  1FPO A;  2Y4U A;  2KQX A;  2EJ7 A;  3UO3 A;  1BQ0 A;  2LGW A;  4J80 A;  2M6Y A;  1GH6 A; 
#chains in the Genus database with same CATH topology
 5E79 Z;  3CCM V;  1Q6H A;  4B3R O;  2Q8V A;  2QSA A;  5EZY A;  2F66 C;  1JOY A;  2QKS A;  1FXK A;  2ADP A;  3ABK B;  4I55 B;  4MW3 A;  3SR2 C;  2WAM A;  4I5S A;  3SPH A;  3L75 H;  5F2V O;  3HKB B;  4FLU A;  2WLL B;  3JSN A;  4OPH A;  2HJD A;  4IGG A;  3A2F A;  3WG7 C;  1BHB A;  2YXY A;  2P5O A;  1AP6 A;  1N33 O;  1IDS A;  1YCI A;  4H37 A;  1XEQ A;  4RWU A;  4MVR A;  1W2B U;  3QNE A;  2EIK C;  1EM1 A;  1SES A;  1HDJ A;  3WG7 B;  2EUL A;  5EC2 C;  5LP6 C;  4RUE A;  5D5P A;  4R8C A;  2IJJ A;  3JCZ A;  1WLE A;  5K1P A;  2HHH B;  4YY3 O;  2HLD G;  1VQL V;  2OTL V;  1OZ0 A;  4LFB B;  3D3I A;  4ASU G;  1M9N A;  1IBK B;  3VQV A;  1KEC A;  2OTJ V;  3AK2 A;  4J41 A;  4D7T A;  4DR6 O;  1H2M A;  4UCS A;  5KX5 B;  1BS3 A;  4DV6 O;  2Q7H A;  5BY1 A;  1DLB A;  2ZE6 A;  1VF5 B;  3JD1 A;  1F7Y A;  4DV2 O;  4KUM A;  1W0J G;  3RYH B;  2EX3 A;  3BY6 A;  4LCU C;  2QTS A;  1XMQ O;  4QGP A;  1BGY H;  1BL8 A;  4FLW A;  2E5L B;  1XHX A;  3QO7 A;  4I4T B;  1OCC C;  3BA8 A;  3BHP A;  3CPW U;  1JJ2 U;  3EHB B;  1KP3 A;  2PTM A;  2X6B A;  3DC6 A;  2DQ0 A;  4LF9 B;  2ZQM A;  3T2M A;  1LNQ A;  2RQ6 A;  1V55 C;  4UCO A;  1AR5 A;  4DV0 O;  1V9P A;  4O2A B;  5B1A C;  4DYL A;  1V54 C;  4HAM A;  1Y4M A;  4CC6 A;  4FLT A;  5DED A;  1S5H C;  3JYC A;  2Y4T A;  1HNX O;  4ZOL B;  3K9A A;  5IWA B;  4I0X A;  2X6A A;  2L6L A;  4U3F H;  2ZXW C;  4ZHQ A;  1S72 V;  4R50 A;  4JI3 B;  2QTO A;  3UO3 A;  4J11 A;  4WBN A;  3OM3 B;  5L3C A;  1KD1 W;  4DR4 O;  4X62 O;  4LF5 B;  4CS4 A;  3E2E A;  3F7Y C;  4WCE V;  2Q67 A;  5EBM C;  4MT8 A;  2UUB O;  2GSM B;  1K9M W;  5H6R A;  1GAX A;  2A06 H;  3SYO A;  4DO2 A;  2YEV A;  3H1I H;  2AXT Z;  3UQ8 A;  1SQB H;  4YY3 B;  2QJ1 A;  1YZB A;  1N4C A;  4X20 B;  2EIN C;  4H0L B;  5LGU A;  2JIZ G;  4ZI7 B;  3OMI B;  4DV4 B;  3L71 H;  5H6Q A;  5B66 Z;  5CA0 A;  4RQE A;  4XDL A;  3H1H H;  4DR5 O;  2OIG A;  1BCC H;  2YSU B;  2Q73 A;  3DTU B;  1HW7 A;  4P2Z A;  1JX9 A;  5FNV A;  1JVM A;  3G80 A;  3RYI B;  5JQG A;  4JI4 O;  1S76 D;  1KKD A;  3ML0 A;  3LDC A;  4YXW G;  4DR7 B;  3K5M A;  3FKS G;  3THO A;  2ETN A;  4NTX A;  4PDR A;  3ZRS A;  1H38 A;  3L74 H;  1N34 O;  4W4L A;  4G27 B;  2LW7 A;  4DV5 B;  4HYO A;  3UCS C;  4QE7 A;  5LBQ A;  3CCU V;  1D5N A;  3K03 A;  1XDC A;  1N0N A;  5LP6 B;  3A0B Z;  2AHY A;  4Q20 A;  3ABL B;  4MSW C;  4QJF B;  4WFB V;  3FB7 C;  3BFR A;  1QLN A;  5KHJ A;  4MVU A;  2XAF A;  5KX5 A;  3DXR A;  3ZHV A;  3SJQ C;  1GKF A;  2WLH A;  3QTC A;  3VQY A;  3SYP A;  2WLN A;  1ZUQ A;  3E86 A;  4B3T B;  3T1C A;  4O4H B;  1UFI A;  2HKO A;  2BSK B;  3ZS8 C;  5IJ9 A;  1F4N A;  1XBL A;  3CP1 A;  2AHZ A;  4DV1 B;  2VS0 A;  2DW4 A;  1H8E G;  2GBO A;  1NTM H;  5IWA O;  2XAH A;  1GTO A;  3OUS A;  1BE3 H;  2RMK B;  1YJ9 V;  1PL0 A;  2UU9 B;  3ETE A;  4KHP O;  1AI7 A;  2A79 B;  1Z5V A;  2DWE C;  3M8A A;  4DV7 O;  2N04 A;  4I50 A;  1WB7 A;  1XUQ A;  3ZHR A;  3TK1 A;  1S77 D;  4K35 A;  2W0X A;  2V1D A;  1M56 C;  2F1M A;  1OJH A;  1K97 A;  1P7G A;  3AG3 C;  3NR7 A;  3HPL C;  3SJA C;  3A0R A;  5J2T B;  1XMQ B;  1HNZ O;  1VQ5 V;  1IBK O;  5LA6 B;  1VQ9 V;  1LUV A;  4B3R B;  4H13 B;  1SQX H;  1I5Y A;  2Z5U A;  1XL6 A;  1QQC A;  4DR2 O;  5LGN A;  2JS3 A;  1J5E B;  5J2U A;  5GTI Z;  5B1A B;  3JAM N;  5LXT B;  1QVG U;  3BAA A;  1Z2G A;  3CX5 F;  5B1O A;  1GM9 A;  1H2G A;  4BW9 A;  1NH2 D;  1JPX A;  4UV8 A;  2VRZ A;  5CB4 A;  1IBM O;  4K0K O;  3AG4 B;  1VQP V;  1JQ0 A;  4DR4 B;  2ZIN A;  1G6U A;  4MTX A;  1KBH A;  4X88 A;  3W7W A;  2PI4 A;  4IIJ A;  1IXB A;  4AIL C;  5IY5 B;  1XL4 A;  2DMX A;  4O4L B;  1Q3E A;  1FAF A;  3BRC A;  1H8H G;  1KKC A;  3H1J H;  4X9Q A;  4X89 A;  3CS5 A;  4B3T O;  1YF2 A;  4JTC B;  2NN4 A;  1MSD A;  1Q86 W;  4X65 B;  1DF5 A;  2LP7 A;  2YC0 A;  3KCX A;  1KQS U;  3ABL C;  3C90 A;  3RYF A;  4NKG B;  5LHH A;  3S3W A;  2DYS C;  3U11 A;  1I7F A;  1WA8 B;  1ZAU A;  4DR3 B;  2L35 A;  3ZRX A;  2LFS A;  4IHJ B;  2PY5 A;  5KHI A;  3RYC B;  1R6T A;  4JPR A;  1R73 A;  1Q8I A;  4J9Y B;  4JAA A;  2UXD O;  2BOB C;  3ZMV A;  5JH7 B;  2EIK B;  3MHS C;  4HNA B;  1FFX A;  2EBO A;  1QVF U;  1MA1 A;  1NTZ H;  4LP8 A;  5H2F Z;  4JI1 B;  2IJH A;  1XNQ B;  3OR6 C;  2YI8 A;  3O9O A;  3WB1 A;  1YIJ V;  3HB3 B;  2P22 C;  1OCZ C;  1EN4 A;  3ABT A;  4LNU A;  4CZZ A;  3ASN C;  1MNG A;  3SYA A;  5E1A C;  3IC9 A;  3TCU A;  3G4S V;  2YXH A;  2R70 A;  3CSX A;  3AG4 C;  1N32 O;  4TOI A;  4ZHQ B;  4DV2 B;  2YXL A;  2WLI B;  5JVD B;  1D2D A;  1EZV H;  4UB6 Z;  5EIB C;  4F4L A;  4TQF A;  1ENV A;  3ZRW B;  2WSS G;  5LL6 Y;  1YEW A;  5C8Y B;  4GUN A;  3ZHU A;  3B40 A;  4BIO A;  4DV7 B;  3N2G B;  4MVS A;  4X62 B;  1VF6 A;  3FFQ A;  1FS0 G;  5KHK A;  3GWK C;  2XHB A;  1HWY A;  4O2B A;  3MD0 A;  3D3Q A;  1QHT A;  1D5A A;  1GM8 A;  1MZE A;  1MMM A;  3JSL A;  2UXC B;  3ZN0 A;  4RUF A;  1M90 W;  3OE7 G;  4PDM A;  4F6R B;  4JI2 B;  4DV4 O;  5L3E A;  4UFZ A;  5CBF A;  3B8N A;  3B77 A;  2QM7 A;  2Y48 A;  3APQ A;  5KUK A;  2UUA O;  1K33 A;  1AI6 A;  3FAV B;  2WLL A;  1AJQ A;  3RGB A;  3HKD B;  1AJN A;  5LHG A;  3RYH A;  3RT3 C;  2RJZ A;  3CB2 A;  2V4D A;  2NR5 A;  1Q81 W;  4LFA B;  1B3Q A;  1COW G;  1YTF D;  4F6R A;  2EJR A;  1CEZ A;  2ZM6 O;  3S3X A;  4IYH A;  3OD4 A;  2LO1 A;  1VEW A;  2JGU A;  1US6 A;  1VQ8 V;  4UCR A;  3CD6 V;  5JJN B;  1IBM B;  4K0K B;  4OXS A;  5LYJ B;  5JJJ B;  4X64 O;  3ZHS A;  1VQ7 V;  4PA6 A;  1MAB G;  2R72 A;  1M56 B;  4NXM B;  1URF A;  1S0V A;  3QVN A;  4LWS A;  4EB6 B;  4X1I A;  1AJP A;  4WFF A;  3K5L A;  4DUZ O;  4DRX A;  3CC2 V;  2Q9L A;  5KLV H;  2F23 A;  4PDL A;  4QE9 A;  2VQF O;  3ZMS A;  2EIM B;  1GN3 A;  3CC4 V;  2Q0O C;  3SPI A;  3IC7 A;  2XND G;  3RBZ A;  1RFY A;  2LGW A;  3FB6 C;  1VP7 A;  3SJB C;  2HG5 C;  4MTF A;  2VWK A;  5KA6 A;  5EZY B;  3L9D A;  2IJK A;  4DV3 B;  2N74 A;  4QPK A;  1Q90 D;  3DGE A;  2XOK G;  3P3N A;  4ZI7 A;  2QA4 V;  3WB2 A;  3G6E V;  5B3S B;  1WPB A;  1SF9 A;  3OW2 U;  5LOV A;  1CP9 A;  4LF6 B;  2GUZ A;  2Y0I A;  3JAT B;  3K08 A;  2ZE8 A;  1VF6 C;  4BIU A;  1BZK A;  1YSC A;  3U0Z A;  4X1K B;  2E75 B;  1O9G A;  4FLY A;  3AK1 A;  4J7K A;  2QM4 A;  4IYI A;  3H01 A;  3OMN B;  4E4E A;  4B08 A;  4UXN A;  1VQO V;  3MDS A;  3FAV A;  1XHZ A;  4HNA A;  5L3D A;  4LFB O;  4IHJ A;  3UKM A;  4JI0 B;  2Z0A A;  1YJW V;  1G1X B;  1OCC B;  3B4S A;  1F51 A;  4FFB B;  3F5W C;  2E3C A;  4LNU B;  4QNH B;  5HFL A;  2DYR C;  2E74 B;  4CH5 A;  1GN6 A;  1ZWI C;  3T4D A;  3T4Z A;  2QWR B;  2BSK A;  1R3L C;  2GTA A;  3H1L H;  4H33 A;  1RM1 B;  2PZS A;  1RPO A;  5IYB O;  1FFX B;  4I9Q A;  5KAI Z;  3I55 V;  3OFN G;  2UUC B;  4PDV A;  2ODM A;  1Y76 A;  1SRY A;  3K58 A;  2CE4 A;  3T1Y O;  2GV9 A;  1VF7 A;  4JTD B;  1B06 A;  1AI4 A;  2M6Y A;  1TAE A;  2IBZ H;  1XMO O;  4TV8 A;  2IM9 A;  2YIB A;  3BPZ A;  2A9H A;  4QIW F;  3WFV A;  5B1N A;  3ZIA G;  4WFG A;  1OCZ B;  4NVP A;  5L3G A;  2YIC A;  4DUZ B;  3ZHQ A;  4I50 B;  4DUY O;  2B1I A;  4PA7 A;  2UXD B;  1K3E A;  3JAR A;  4J7Z A;  3CRC A;  4X20 A;  3SYC A;  4LF7 B;  1FJG O;  3BAB A;  3N2G A;  1XOU A;  3CRA A;  5LA6 A;  3H9V A;  4PA4 A;  2CGO A;  3CJH A;  2A0L A;  1YDX A;  3AG2 C;  1SQF A;  5J2T A;  2V7Q G;  3ZJZ A;  3CXC U;  2D3O W;  5FNV B;  2WA3 A;  4GX5 A;  1JA8 A;  1QR9 A;  2E76 B;  3ZED A;  1O9H A;  3GB7 C;  2K9P A;  2Q0A A;  3JAL A;  4HZ3 A;  5FPO A;  2W6I G;  1ZX3 A;  3JCU Z;  5BMV A;  1B6Q A;  2EZO A;  4OX9 B;  2DN9 A;  1THZ A;  3AG1 B;  1R3I C;  3UT5 A;  2AW9 A;  1S5J A;  2WLK A;  1WPX A;  2H94 A;  3CJH B;  3W7U A;  2RCV A;  3X2Q C;  1ROP A;  4DV3 O;  1DF4 A;  4FLX A;  1NJI W;  3GWO A;  3CCE V;  3JAK B;  1HR0 O;  1LUW A;  5IYC O;  2HJF C;  3C3T A;  1AIL A;  1RP3 B;  4FK5 C;  5EYP B;  4O4L A;  5LXT A;  1MSW D;  4J42 A;  5LMU B;  4LF8 O;  2D2C B;  2CGN A;  1NQT A;  4YJ2 A;  3STL C;  5EBL C;  2UXB O;  2VQF B;  1DGS A;  1KC8 W;  1GRJ A;  3CCR V;  3KKY A;  4I9W A;  1N34 B;  5BXZ A;  3ZX6 A;  2R9R B;  3RVZ A;  3CRQ A;  5IYZ A;  4MTO A;  3CCS V;  4JAV A;  1FXH A;  4DRX B;  4JZ2 A;  4LC1 A;  1HNX B;  3OAA G;  1M4U A;  3RFR A;  2QGN A;  3D36 C;  2ARH A;  2ZDI C;  4N23 A;  3DC5 A;  4LFA O;  1SKV A;  4Z1M G;  4UVB A;  1EN5 A;  1IZ3 A;  3K06 A;  4DK1 A;  2EIM C;  4CS3 A;  4X66 O;  1XIL A;  3F5T A;  2QKA A;  3ZMT A;  2VWJ A;  1W0K G;  2YIA A;  3K9S A;  3IJ4 A;  2UXN A;  3K0G A;  1I94 B;  1YHQ V;  2NNU A;  1P49 A;  4RO2 A;  4DR1 O;  4TUY A;  4K3A A;  5ITZ B;  2HHH O;  3TJT A;  5KA5 A;  2PUS A;  3JAT A;  5EK0 A;  1OHH G;  4EFB A;  2BCC H;  4MTG A;  3OT7 A;  1VQN V;  2CH7 B;  4TT3 G;  1J95 A;  4BIZ A;  1HNW B;  1TGO A;  3B2E E;  1ZTE A;  1XNR B;  4F6E A;  4P9P A;  4YJ3 A;  5J2U B;  2EIN B;  1R6K A;  4MVQ A;  4WF9 V;  4JYB A;  1PP9 H;  4JTA B;  4JV5 O;  2X0L A;  1KB9 F;  2LW1 A;  5C8Y A;  1N33 B;  1SA0 A;  2WLJ A;  4FFB A;  4JAU A;  1PL4 A;  3B8M A;  2ZCE A;  1CPY A;  3O65 A;  1MOF A;  4PA9 A;  4U7O A;  1GMG A;  1K4D C;  4DV5 O;  4W4K A;  2QDO A;  4YIP A;  4GT1 A;  1GN4 A;  4X66 B;  4DV1 O;  1SQV H;  1AR4 A;  4U3J B;  3IAY A;  1NTK H;  5CBH A;  4LF6 O;  2OIE A;  2UUB B;  4BWA A;  1UPG A;  2FTK A;  2ZD9 A;  4ZKI A;  5KMG A;  4O4J A;  2XAS A;  3DXR B;  1K92 A;  2ZIM A;  1N36 B;  1N32 B;  1Y76 B;  3K5O A;  2GHY A;  1JFF B;  3EFF K;  3X2Q B;  5LYJ A;  3PJS K;  4QPJ A;  2Y69 C;  1YI2 V;  3HKD A;  3D8C A;  4KFM A;  4NTW A;  3RYC A;  5L3F A;  4EB6 A;  5DN6 G;  1HNZ B;  2ZR3 A;  1XNR O;  1F4M A;  3E22 A;  5A9G A;  3B09 A;  4E2L A;  2HP8 A;  4KHP B;  4LR3 A;  1M5I A;  4TQD A;  1NH2 B;  5IE9 A;  3LSU A;  4D7S A;  3F7V C;  2OWO A;  3JD0 A;  1P7B A;  5BR8 O;  4P30 A;  4LWS B;  4LFC O;  3CYO A;  3UM7 A;  5D5Q A;  4FMT A;  3SJC C;  2K1E A;  1B04 A;  4UVC A;  5LMU O;  3AK3 A;  5KUM A;  1SZX A;  1FXK B;  4JI8 O;  1OCR B;  4X65 O;  4MW8 A;  1TUB A;  2WLI A;  1S3J A;  4JI5 B;  2EZP A;  5H5N A;  5LMN B;  3ZRW A;  1BQZ A;  2OCH A;  1NZ6 A;  5KHG A;  4FVM A;  1ORQ C;  3E8H A;  1YJN V;  3WB0 A;  1SQQ H;  1G4Y B;  3TXQ A;  1IBL O;  2OYQ A;  2JJ2 G;  4I7Z B;  3BA9 A;  3OEE G;  4GZR B;  2LFR A;  3DSQ A;  3SPJ A;  2KKW A;  1FFT B;  3IGA C;  1Y74 B;  1FXK C;  1RPR A;  2UU9 O;  2WA4 A;  1L0L H;  3AG3 B;  2HVK C;  1J5E O;  2FL4 A;  1VQ6 V;  2F43 G;  2M7W A;  3P32 A;  1FXV A;  3CME V;  4OX9 O;  5EYP A;  2Y0P A;  4X1K A;  4YHH B;  2AZ0 A;  4G2K A;  2BTQ B;  4MVZ A;  1MZF A;  4PEL A;  2AZ2 A;  1N36 O;  2H3O A;  4JI1 O;  1KMI Z;  3K5N A;  1NU1 H;  5LHI A;  5B5E Z;  2GDS A;  4DW0 A;  5K1X A;  4UCT A;  3JAS A;  4KL1 A;  4GKJ O;  2FML A;  2F4V B;  3CCV V;  4OPA A;  3E89 A;  1QLE B;  1EBO A;  4DV0 B;  3G6B A;  5IJ0 B;  2PYJ A;  4PI2 A;  1YVW A;  5CN0 A;  2PF4 E;  1K8A W;  2UXX A;  3T1Y B;  2UXC O;  3SDL A;  2P06 A;  5CMU A;  4DXW A;  5BR8 B;  3M7M X;  2DYS B;  2CK3 G;  2ITD C;  3TET A;  1S5L Z;  1NVP D;  5KAF Z;  4WFH A;  5EIB D;  1TUB B;  1SA0 B;  4GYC B;  1HP8 A;  4X1Y B;  3L72 H;  4TV9 A;  4JF3 A;  1NVP B;  4KXR A;  4DR5 B;  2LQT A;  4LFC B;  4JAS A;  3KZI Z;  5J9P C;  3A0H Z;  5HFM A;  1XRE A;  3WU2 Z;  3JAK A;  4FLV A;  2JDI G;  1H2N A;  3T1H B;  3K04 A;  4UB8 Z;  1HNW O;  3ZHT A;  4AQY O;  3ABK C;  4YIO A;  3UT5 B;  1JJO A;  2GUZ B;  1VMG A;  2KSD A;  2QKC A;  1EZJ A;  5CA1 B;  2X7R B;  2N05 A;  3JD4 A;  3JD2 A;  3L73 H;  4LF5 O;  3P3P A;  4OGQ B;  3KG2 A;  4EEQ A;  1BQ0 A;  5EBW C;  5FPR A;  2F93 B;  4IIJ B;  4J80 A;  1Y6X A;  1H2L A;  2BTO A;  1K73 W;  3N2K A;  1U97 A;  3CCQ V;  4O4I A;  3C3S A;  1GN2 A;  3QF7 A;  4NR1 A;  2JGD A;  2UXB B;  1ZL8 A;  3E35 A;  2KB1 A;  3ZBH A;  3IFX A;  1PNM A;  1PKX A;  1TUE B;  1Y67 A;  4B3S B;  3ASN B;  2CDY A;  4WBN B;  5IYZ B;  4LF4 O;  3LSQ A;  3E83 A;  1Q5O A;  3MHH C;  4O4I B;  4FM1 A;  4GX0 A;  3OMA B;  3Q4H A;  3SGI A;  3SYQ A;  2QWO B;  4ZBM A;  1PPJ H;  1ZL8 B;  3PN1 A;  2B5U A;  3J7A U;  5ITZ A;  4JV5 B;  3ASO B;  5DEC A;  4DR6 B;  2JEX A;  2DE0 X;  2P6J A;  2HEP A;  4PHZ A;  2HVJ C;  2Q68 A;  4R7C A;  3NXS A;  1M93 A;  1K5Q A;  4AQY B;  3W7X A;  2CH7 A;  2IH3 C;  2P67 A;  2JRI A;  1VQM V;  3ABU A;  1P84 F;  3LDE A;  1IXM A;  3U10 A;  2IU0 A;  3I5D A;  5JQG B;  1N8R W;  4GKJ B;  1AB3 A;  2W0F C;  3HKB A;  3ZMZ A;  2JK5 C;  5GTH Z;  5LOV B;  2YUA A;  5EC1 C;  2PI5 A;  5KHH A;  1SQG A;  2CUG A;  3VOU A;  2QWQ B;  1H2K A;  2W6J G;  1AP5 A;  4CBC A;  1IVS A;  5GON B;  3CCJ V;  3N27 A;  1WP7 A;  4CH6 A;  4GLX A;  1IBL B;  4B7K A;  2RN9 A;  3AG1 C;  2YIB D;  1ZSP A;  3HR0 A;  4CH4 A;  2ADQ B;  1WP8 A;  5LMN O;  2B9Z A;  1K4C C;  3W7S A;  4JZG A;  4MVM A;  4DK0 A;  4JI4 B;  1LR1 A;  1R6N A;  1Q6U A;  4JYC A;  4U7N A;  3RN4 A;  4G28 B;  5TIS Z;  3D36 A;  2ILM A;  4PA3 A;  5JJE B;  1KYO F;  1VQK V;  1BSM A;  4CS2 A;  2CTP A;  2DWD C;  2OCC B;  3I56 V;  2JEU A;  3SPG A;  2ZKO A;  4C7U A;  1XMO B;  1YXB A;  4GKK B;  3ABM B;  1I94 O;  1W59 A;  5IYD O;  2WPD G;  1PNK A;  1IUR A;  1U96 A;  1FPO A;  1R1B A;  1TA8 A;  5KMG B;  1WN7 A;  4DR7 O;  2EIL B;  3AG2 B;  4CH3 A;  2BE3 A;  1BMF G;  4XDK A;  1JMK C;  3BVO A;  2ITC C;  4ZOL A;  2UUC O;  5IJ0 A;  5GW7 A;  4TWK A;  1YIT V;  2HR3 A;  3EXA A;  4YHH O;  1R3J C;  4KP4 A;  4UUJ C;  5JVD A;  2LGQ A;  4LBE C;  1P4R A;  3G67 A;  1GH6 A;  4ICG A;  4NTY A;  4NYK A;  4MS2 A;  3TGU H;  3CCL V;  4IL6 Z;  2IW5 A;  2XAJ A;  1IX9 A;  3CRR A;  4NXN O;  4JYA O;  5CB4 B;  2ZXW B;  2X6C A;  1BHA A;  2R9I A;  4K8X A;  4ZIB A;  3J81 N;  4RAI A;  3OR7 C;  4J10 A;  4CC5 A;  3GVM A;  2OT5 A;  2MK3 A;  4HBN A;  3M99 B;  1Q7Y W;  1L1F A;  3MAQ A;  4AI8 A;  4JI7 B;  1VQ4 V;  3E8G A;  1HR0 B;  1WAZ A;  1EFR G;  3K3W A;  1E1Q G;  3VBB A;  4DUY B;  4JI5 O;  2QEX V;  3OGI B;  3FYI B;  2CTQ A;  3JD3 A;  3FX7 A;  4Z2W A;  3ETG A;  5CBG A;  3JAW A;  4XBF A;  1M57 C;  1OCO B;  1SC5 B;  5GON A;  1I08 A;  4LH7 A;  3K79 A;  1BT8 A;  2P4K A;  4IT5 A;  2IH1 C;  4GKK O;  4JI6 B;  1Z5W A;  3OEH G;  2A7W A;  2CTW A;  2XAQ A;  2JJ1 G;  3CE2 A;  2Q4P A;  2C2A A;  1YTF B;  1KP2 A;  4D6T H;  2ZNJ A;  4UCU A;  2YDE A;  5LGT A;  2ZR2 A;  1FJG B;  4LF7 O;  1NBM G;  5FLX N;  4EFE A;  4JI0 O;  1VIB A;  3APO A;  1CXZ B;  2IU3 A;  2H8P C;  3LNN A;  1WB8 A;  1R3K C;  4BAY A;  3AEI A;  1AVM A;  1RSO A;  4O4H A;  1G8M A;  2QR4 A;  3A8T A;  4FPP A;  4BW5 A;  3ABM C;  1XNQ O;  1NR7 A;  4YJ2 B;  1QBZ A;  1WA8 A;  4J7J A;  2FKX A;  1Q82 W;  4FM0 A;  4JI8 B;  4PD4 F;  3FD9 A;  4ABM A;  2P7T C;  3ASO C;  1JFF A;  1Q6I A;  2Z3Y A;  4JI7 O;  3E22 B;  1MG1 A;  4FZ1 A;  3K0D A;  2YEV B;  1VAR A;  3RWR D;  4N21 A;  3RVY A;  4DR3 O;  2RDC A;  3ICX A;  3ETQ A;  4AHC A;  3L70 H;  2XTA A;  3CRM A;  3T1H O;  3VQX A;  5B1B C;  2XUM A;  2HFE C;  4DV6 B;  4DR2 B;  2Q69 A;  3HKE B;  1WNS A;  1FD9 A;  2G38 A;  2DYR B;  4B7E A;  1JCH A;  1T5E A;  1F23 A;  4I0X B;  1QR8 A;  4UV9 A;  4RQF A;  2JVD A;  2EIJ C;  1FYJ A;  4GX1 A;  2QE7 G;  4TSF G;  4NB5 A;  2KQX A;  3FB5 C;  4P9O A;  1SQP H;  3E8F A;  2EIL C;  4J9Z B;  1QNM A;  1I0H A;  1SZT A;  4DW1 A;  2CAZ C;  1KU9 A;  5AG2 A;  2VQE B;  5IY5 C;  2ZIO A;  2WWW A;  4TV9 B;  1AI5 A;  2R9A A;  2AGA A;  3P30 A;  3R65 A;  5B3S C;  2WLM A;  4JGS A;  1NKD A;  3AG7 A;  4JYY A;  2CTR A;  3ZMU A;  3ZN1 A;  2FB5 A;  2MW2 B;  5CA0 B;  1AR1 B;  3R66 A;  2QWN B;  5LP6 A;  4FFK A;  4H44 B;  3HKC A;  3TXS A;  1SET A;  4U3J A;  3QO5 A;  2JS5 A;  4PV1 B;  4YJ3 B;  5IJ9 B;  2F4V O;  3LNM B;  3CEI A;  4B3M B;  4K8Z A;  3OTO B;  3LDD A;  2EJ7 A;  2ZDI A;  3N2K B;  2Y69 B;  4JI2 O;  1A32 A;  3CXH F;  2ZNI A;  3H1K H;  5DM6 V;  1XQ8 A;  2E5L O;  4WFE A;  2ZT9 B;  2UUA B;  4I4T A;  1RSO B;  5JH7 A;  4A5U B;  1ARO P;  4R6Z A;  4FLZ A;  2A3Q A;  1H2S B;  3VQW A;  5H9C A;  4JI3 O;  1NI8 A;  4TV8 B;  1E79 G;  1RM1 C;  4B3S O;  2OCC C;  2PGG A;  2PYL A;  2YS8 A;  4X8A A;  2JGD B;  5IT9 N;  1E1R G;  3ZCC A;  2DQ3 A;  3Q4H B;  3SPC A;  3BEH A;  4GX2 A;  4X64 B;  3JAR B;  4L87 A;  3OGC C;  4LH6 A;  1V55 B;  1K7D A;  2ZE5 A;  4FM2 A;  2NLJ C;  4FZ0 A;  3UO2 A;  4NXM O;  5B1B B;  4DR1 B;  4FJC C;  4L8J A;  3J80 N;  3CWB H;  4PJ0 Z;  3CC7 V;  1L8D A;  2Q7G A;  5CA3 A;  3ZRV A;  3K59 A;  5IDJ A;  5BZB A;  1I5X A;  2ZM6 B;  5JWP A;  4LF8 B;  3JAL B;  1QCE A;  4O2B B;  5BMV B;  2QM8 A;  1FKA O;  3E8B A;  1X59 A;  2RNB A;  1NS1 A;  1PV0 A;  4LF9 O;  3OUF A;  2YI9 A;  1KUQ A;  4X1Y A;  2IJI A;  1EN6 A;  2DJV A;  2F95 B;  4UCV A;  3LUT B;  3RYI A;  2ATK C;  4BR6 A;  4Z1V A;  3JAW B;  5JCO C;  2KG7 A;  3RYF B;  2QWP B;  2Q6A A;  2ZE7 A;  3EVK A;  4B3M O;  1NR1 A;  2BTQ A;  2YID A;  2DOS A;  1QLE C;  3RW0 A;  2P90 A;  3FYE B;  4UVA A;  1M1K W;  4WFA V;  1V54 B;  3BCC H;  4EKW A;  4NXN B;  4JYA B;  3HKC B;  3QO8 A;  3STZ C;  3W7T A;  4JI6 O;  1PM9 A;  5CA1 A;  4LF4 B;  5JCO A;  1QU7 A;  2P4V A;  1NT2 B;  1PNL A;  1OCR C;  1M57 B;  1OCO C;  3K57 A;  1DK1 A;  2KG7 B;  3QG5 A;  2Y4U A;  1GK9 A;  1XI1 A;  1GM7 A;  1ZLZ A;  3OTO O;  1K34 A;  1UJW B;  2GTS A;  1Y74 A;  2VQE O;  1SER A;  1X4T A;  3KCY A;  5FL7 G;  1JR9 A;  1L0N H;  1PD3 A;  3G71 V;  2BOC C;  1Y66 A;  2XAG A;  3CHX A;  5A2Q N;  4Q6G A;  5C93 A;  1TVK A;  1K5S A;  4MVO A;  4GCZ A;  1DTO A;  4O4J B;  1N0J A;  4XDJ A;  1Q43 A;  3FB8 C;  4X1I B;  4FIP C;  5L3B A;  3ETD A;  2Q5Z A;  4O2A A;  1WJZ A;  3HKE A;  3OTF A;  4TUY B;  3CMA V;  2O57 A;  2FYU H;  1TVK B;  2B1G A;  4PI0 A;  2Q7E A;  1SS3 A;  3LSS A;  1OV9 A;  2EIJ B;  3JAS B;  2XT9 A;  4I55 A;  1GO3 F;  2LJ2 A; 
#chains in the Genus database with same CATH homology
 2DMX A;  2LO1 A;  2QWN B;  4IT5 A;  3UCS C;  2YUA A;  3APQ A;  3UO2 A;  2GUZ A;  2QWR B;  1FAF A;  3APO A;  3BVO A;  2CTW A;  2N04 A;  2CTP A;  1WJZ A;  2GUZ B;  2QSA A;  2YS8 A;  2CUG A;  2QWO B;  1BQZ A;  2OCH A;  1XBL A;  1NZ6 A;  2CTQ A;  2Y4T A;  4RWU A;  2N05 A;  1IUR A;  2QWQ B;  2L6L A;  1N4C A;  3AG7 A;  2DN9 A;  4J7Z A;  1HDJ A;  2CTR A;  2PF4 E;  2QWP B;  1FPO A;  2Y4U A;  2KQX A;  2EJ7 A;  3UO3 A;  1BQ0 A;  2LGW A;  4J80 A;  2M6Y A;  1GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...