2M7PA

Rxfp1 utilises hydrophobic moieties on a signalling surface of the ldla module to mediate receptor activation
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
42
structure length
42
Chain Sequence
GSQDVTCSLGYFPCGNITKCIPQFWRCDGQVDCDNGSDEQGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The relaxin receptor (RXFP1) utilises hydrophobic moieties on a signalling surface of its N-terminal low density lipoprotein class A module to mediate receptor activation
doi rcsb
molecule keywords Low-density lipoprotein receptor, Relaxin receptor 1
molecule tags Protein binding
source organism Homo sapiens
total genus 4
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2013-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2m7pA00
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH superfamily
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH topology
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
#chains in the Genus database with same CATH topology
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
#chains in the Genus database with same CATH homology
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...