2M8DB

Structure of srsf1 rrm2 in complex with the rna 5'-ugaaggac-3'
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
b'MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(*UP*GP*AP*AP*GP*GP*AP*C)-3')
molecule tags Rna binding protein/rna
source organism Homo sapiens
publication title Isolated pseudo-RNA-recognition motifs of SR proteins can regulate splicing using a noncanonical mode of RNA recognition.
pubmed doi rcsb
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8dB01
4WFBQ 3LQVA 2JVRA 3CXCR 3UE2A 1FO1A 5LXYA 1WTBA 4QU6A 4LIRA 2KXNB 1WHXA 4OZ0A 1X0FA 2DGQA 4WFAQ 3CULA 4WFNQ 2JVOA 5H1SV 5IFMA 4C7QA 5LJ3Y 2E5HA 3MUTP 1NO8A 1YTYA 2OTJS 3SDEB 4C0OC 2XNRA 2CPEA 2CQPA 1VQLS 3FEXB 4Y0FA 1U1KA 3Q2SC 2MKKA 1WF0A 2DNLA 2DGXA 1WI8A 2HVZA 4J5OA 3RW7A 3HI9A 3P5TL 2DGOA 5FJ4A 1HD1A 2KT5A 3P49B 2OIHA 3MXHP 4ERDA 2F9JA 5D77A 5CXTA 1P27B 5CYJA 5DDOC 4V19X 4TU7A 2AD9A 1S72S 3TO8A 2RU3A 1SJFA 3TYTA 3CCRS 2CPZA 1K9MT 1SJQA 3DLLQ 1VQPS 3CC7S 2Q79A 4Z2XA 2A3JA 2DO4A 2CJKA 4QQBA 1R8PA 1F9FA 5GVQA 3BO2A 2DNOA 5IM0B 2OTLS 2I38A 5LJ5Y 1KOHA 1HL6A 2X1AA 2ZJRQ 2MKCA 2SXLA 2EK1A 3P6YC 2M70A 3MDFA 3CUNA 2B0GA 2E44A 3CCMS 1WEXA 4LMZA 2MMYA 1X4BA 2JRSA 2OJ3A 1Q82T 1YJ9S 2MKSA 2M8DB 4WF9Q 2XS5A 3DXBA 3G96A 2CPJA 1ZZFA 2E5GA 1YJNS 2NZ4A 1YI2S 3N9UC 2LYVA 4WCEQ 1WEYA 3VAGA 2DB1A 2KI2A 1PO6A 4TU8A 3BO3A 1KOOA 3JB9k 1K73T 4ZKAA 2MZJA 3S6EA 2UP1A 1JJ2R 1M5VC 2QA4S 2KM8B 5JVHQ 2G0CA 2FPHX 1Q81T 2YWKA 4IO9Q 2GO9A 2L08A 2MPUA 1WI6A 2MKHA 2DISA 2VONA 1YHQS 3ZZYA 1M5OC 3I55S 3VAJA 3MOJB 2LA6A 2OSQA 2DNYA 2CQ2A 2KRRA 2HZCA 2DGVA 1X5PA 3G9CA 2DH7A 2XSFA 1A9NB 2DIUA 3MD1A 5GMKa 2RNEA 2CQGA 4W90B 3ULHA 4C4WA 2AYBA 1X5TA 3OW2R 2LECA 2U1AA 2J76E 2DNNA 3R1LA 3CCJS 2F3JA 2M7SA 3UCGA 3CCQS 1VC0A 1FJCA 2MZTA 1H2VZ 1P1TA 1HD0A 3NMRA 4QPTA 2OSRA 2DGWA 2FY1A 2DNKA 1D9AA 1WEZA 2GHPA 1M1KT 2ADBA 2M8HA 1URNA 2D9PA 3FEYB 2PEHA 5HL7Q 3PIPQ 1O0PA 3UCZP 2MQQA 2YTCA 3US5A 4BS2A 3UCUP 2D3OR 3CCSS 1U1MA 1VBYA 3BS9A 1WF1A 5MLCV 3VAFA 2CQBA 2LEBA 2QEXS 2XB2D 1X5OA 4CIOA 1KC8T 2M2BA 2MXYA 1UP1A 4IOCQ 2CPYA 3S8SA 1L3KA 3NS6A 3IRWP 5EN1A 1U1RA 2KVIA 1X4AA 1NU4A 2ZJQQ 1RKJA 5HO4A 1U1PA 1X4GA 1B7FA 1X5SA 4FXVA 2L9WA 4WKRA 2KXFA 3R27A 1VBZA 2LCWA 2KRBA 2N3OA 1FNXH 1N54B 2EK6A 4M5DB 1VQ9S 2CQDA 2K3KA 5JVGQ 2MSSA 1S79A 1X4DA 2M4MA 4PKDB 5IM0A 3VF0B 3LPYA 1YIJS 1XN9A 2DNPA 2DNGA 3MURP 3MUMP 2DHGA 2X1BA 2CQ4A 1U1OA 2BOPA 2WBRA 2KG1A 3IWNC 2KHCA 2MB0B 2CQ3A 1VQ8S 1VQMS 2HYIB 1WHWA 1YWXA 3CMAS 1M5PC 3BO4A 2MJUA 2RQCA 3SXLA 1QVFR 2MZSA 2FC9A 2HGNA 4YB1P 2LXUA 4RU2A 4IUFA 2N82B 2RUGA 3EGZA 1N52B 2MY8A 1DBDA 2RRAA 2M52A 3NNAA 1FXLA 1JMTA 3CMES 2L41A 2XNQA 2MKIA 1UFWA 2KFYA 2KH9A 2RS2A 2MZ1A 3MD3A 1FJEB 1M5KC 1VC6A 3TP2A 2KN4A 2CPDA 2MJNA 3B4MA 1VBXA 2DNRA 2LEAA 1UAWA 2D9OA 2M88A 1PGZA 1DHMA 1QM9A 2F9DA 4CH1A 3UD3P 2HGLA 2XS7A 3CPWR 2DITA 3K0JA 5GAEU 2MZRA 5LSLA 1N88A 1WWHA 3EX7B 3CC4S 3ZZZA 1X4CA 2X1FA 2MQMA 2DK2A 2N7CA 2KG0A 2MGZB 3D2WA 4A8XA 1U6FA 1AUDA 4TLQA 5D78A 1OPIA 4PRFA 2FHOB 5DETA 1N8RT 1SJ3P 1JJ4A 2MKJA 2KU7A 2MSTA 4TU9A 3MUVP 2RVJA 3PIOQ 1WELA 1U2FA 3G8SA 2DNQA 3NNHA 1WG4A 5GAHU 2BZ2A 2HGMA 3RW6A 4W92B 2DH9A 4IOAQ 3CCLS 1WF2A 5BJRA 2ERRA 2NLWA 2RQ4A 2X1GA 3CCES 2DO0A 2DHXA 5LXRA 1ZZNA 2DIVA 1X4HA 1IQTA 4EGLA 2J0SD 2DGTA 3H2VE 2KXHA 2CPIA 3S01A 4F02A 3CCUS 1VQKS 2RT3A 1OWXA 2MQPA 3I56S 2DHSA 4ED5A 4YOEA 5DM6Q 1HA1A 3NNCA 1FHTA 2VOOA 2MQOA 3CC2S 1VQ5S 2MZQA 1ZH5A 1G2EA 3L3CA 2CQCA 2LQ5A 1U1NA 2EVZA 2E5IA 2JX2A 3J7YU 4YUDA 2CQHA 1U1QA 2DH8A 1SJ4P 2VOPA 4Y00A 3UWTA 4CH0S 4CQ1A 1H2TZ 3R1HA 3NS5A 1CVJA 5GAGU 3VAKA 3CD6S 2CPFA 2FC8A 5ITHA 3J7ZT 1M90T 2U2FA 2G1DA 2LXIA 3P3DA 4QU7A 3THTA 2DGSA 2RS8A 1U6BA 2G4BA 3G71S 4U67Q 3Q2TC 2O3DA 5DDQC 1KQSR 3VAMA 3HHNB 1RK8A 2YKAA 3B4DA 1WG1A 1D8ZA 1DRZA 2DGUA 2CPXA 3SMZA 3G6ES 1Q86T 3S7RA 1JJHA 5DDRC 2YH1A 1NJIT 2J0QD 1UW4A 1WHVA 2QFJA 1U1LA 3UD4P 3U1MA 3V4MA 2JWNA 1R8HA 1H2UX 3G4SS 5GADU 3BEGB 2DHAA 1X4EA 3MI7X 2DNMA 2M9KA 2LA4A 2AYEA 2DNZA 2RRBA 1QVGR 1BY9A 3CTRA 2CQ0A 1OIAA 1VQNS 2YH0A 2MQNA 2CPHA 2MY7A 4UQTA 3H2UB 1OO0B 2V94A 3VAIA 3G8TA 2CQ1A 1VQOS 3THPA 1Q7YT 2MGZA 1VQ7S 2LKZA 2ADCA 1VQ6S 2VODA 1A7GE 3CCVS 1WG5A 4P6QA 3VALA 5DM7Q 2LMIA 4WIIA 2PE8A 2MHNA 1K8AT 2MQLA 1DZ5A 2AYGA 2AYMA 2N3LA 4FXWA 3VAHA 1KD1T 3EGNA 1SXLA 1YJWS 5CA5A 1VQ4S 1X4FA 5DDPC 1SJRA 3SDEA 1FT8A 2E5JA 2ZJPQ 1FJ7A 4F25A 2KM8C 1WHYA 4PR6A 2KYXA 4OZ1A 4F26A 2CQIA 2MYFA 2DNHA 5IQQA 2K8GA 1W2BR 2M0GB 2J8AA 2I2YA 2XS2A 1VC5A 4UY8T 4LJMA 1H6KX 5LSOA 1YITS 3CF5Q 3U1LA
chains in the Genus database with same CATH superfamily
3R5AA 4I64A 4RW4A 3LQVA 2E5LF 1FX4A 5KFKA 5KFRA 1URRA 2HKEA 1FO1A 1UPPA 1GMUA 1GMWD 3OFHA 2BOAA 3HX9A 3FQKA 3AQOA 3OD2A 4DL2A 4DJBA 2BANA 4OZ0A 2GZOA 4NLTA 2DGQA 3H5SA 3PRBA 4JI4J 4WFAQ 4FYXB 3CULA 2JVOA 4E0DA 1S6OA 2XLKA 4YR3A 1U49A 3DI6A 2AX0A 1EETA 1NZAA 2E5HA 2RHQB 3OL9A 2JOQA 4RJVA 3T6BA 2KT3A 1S77D 3SDEB 5CCLA 2UXDJ 4C0OC 2YNFB 2ZUAA 2CPEA 4XTTA 1V3ZA 4G1QA 3H40A 1EZZB 3CJ8A 5KFWA 3D3BJ 2DNLA 2DGXA 1FRIA 1RJJA 1WI8A 4IH5A 4M95A 2B9YA 3P5TL 3HXMA 1FFSB 1P9YA 3I5AA 3O1LA 3O3LA 4DCOB 1RGVA 2QJ3A 4LSLB 3W63A 5ETTA 3LP0B 3BN4A 4JI2F 1JNRB 3C3LA 2ZOGA 4JI0F 1FK9A 4NEYA 4B3TF 2RDIA 3P49B 3MXHP 1RT3B 2GX8A 4QYZJ 2UVUA 2G1HA 4JI7J 3DU5A 3IR6B 1TVRA 2W8KA 5ETPA 4QIVA 3D6TB 2UUAF 4UW2A 4DOZA 1NHVA 3W61A 2YNIA 2HHPA 3UNYA 1S7HA 4DR1J 1U24A 2DT9A 4ETZA 1S9GB 2GQQA 3MMAB 4H4MA 4LR8A 4OX6A 4DX7A 3WC2A 2KYZA 2JEIA 4TN2A 2IBOA 2DYAA 4E8UA 3T9ZA 2CPZA 1JLCB 2EC0A 2R8KA 2ZNYA 1SC6A 1SJQA 2UZAA 3GG0A 1RKIA 3GYGA 4FPRA 2GQ2A 4NZ7A 5L39A 4DZDA 4DQPA 2DO4A 4DV0F 4HEA9 3KHHA 1R8PA 2EFPA 3IG1B 3BV8A 4PWWA 3NS7B 4O4GB 3W5XA 5GVQA 3J81U 1X9SA 3BO2A 1Q8IA 4C97A 2DNOA 4UOFA 5IM0B 3D68A 1XC9A 4I67A 2HAFA 4QYRA 1BQMB 5LJ5Y 3IFEA 2F8HA 2OEKA 3CWJA 3SCJE 2ZJRQ 1IJFB 5IT9U 4NLUA 3UVJB 4F0MA 1N4LA 3NCQA 5FD1A 1RZMA 2UU9J 3VVUA 5E3CA 2ZEJA 2EFVA 1CS4A 2EK1A 3CIMA 1Y7PA 2FIUA 2KVQE 3TA2A 1S97A 1MNEA 2VG6B 3MDFA 2DR6A 4R25A 2ZD1A 2ZH8A 2ATCB 4N47A 3C6UA 4AQYF 3C6TA 4GVBA 1QUVA 4LMZA 1JLEA 3LA0A 4OJ3A 1BWVA 1X4BA 2M5YA 4OHVA 2UUBJ 2MEWA 5CZXA 1I94F 1IR0A 5DO2A 3CJKB 5L1KA 1U8WA 2HS3A 5EX3A 1LOUA 4X4RA 1YJ9S 2MKSA 1GK8A 2VJVA 4WF9Q 2XS5A 3QYYA 4RO0A 4LF9J 5C2CA 3PKMA 4A46A 1JLBB 2E5GA 4F2RA 2YKNA 3GJTB 4JI6F 2XLIA 2XY7A 3T19A 4ICLA 2DXFA 1N33F 3I31A 1F3VA 1K8AT 2VPWB 4WZMA 4GKJJ 2DKOB 2N4DA 4OJHA 4A8YA 2B4UA 3AA8A 4ED0A 2NZCA 2HZVA 4WFXA 5B0AA 3S6EA 4C11B 3DLHA 1Y4ZB 1RT4B 2FVPA 4LF4F 1KWMA 4ECSA 1N36F 1DAXA 1LXNA 1M5HA 1ZAVA 1VRTB 2WSEC 3CEDA 3FRZA 4L73A 3ZXWA 2KM8B 2QV6A 5JVHQ 4DV7J 1FCAA 5C24B 1Q81T 2W2QP 3AH6A 4IO9Q 1N5VA 2COLA 2D1CA 2GO9A 2JFKA 3HD2A 4MTPA 3PXGa 5I4MA 5DGBA 1SB6A 5MAOA 1JLQB 1P9QC 1CC8A 2DISA 3LGHA 2NYIA 4Y28C 1AB8A 2VONA 3W5YA 4JV0A 3QRRA 2IJRA 3L7UA 4ECRA 3Q8RB 2XTJP 1RHKB 3C16B 5AJ3F 4DPOA 4LRBA 3VAJA 3MOJB 2OLWA 1IKYA 1XBWA 2YBVA 4AXJA 4WYWA 2JLFA 2ATLA 2HHSA 3JSMB 2HZCA 3MM6B 3K5LA 2DGVA 3G87A 4IFVA 4NRUA 2HRUA 3UI3A 1T3NA 2VA3A 4K0KF 1FRMA 1HNWJ 2DH7A 3CJTA 1FJGJ 1A9NB 4S0MA 5LMUF 2ZZTA 3MD1A 3J81Y 2W2PP 1S6QA 4GKKF 5I42B 4FYVB 4PCQA 4W90B 2RAQA 2JDJA 3MR3A 3FMBA 1Z2LA 2K7JA 1Y5LB 3CCTA 2HWIA 1F3FA 5C5JA 3WBZA 4M8LA 4ZS6A 4NASA 4F4YA 5E41A 3RRHA 1T03B 1C0TB 2XYGB 4CYUB 4KFBA 3ISZA 1SQFA 1T3OA 2VKZG 2VC0A 1R0CB 3CCQS 1VC0A 2MZTA 2W01A 4TXSA 3QGPA 5AE1A 2R2UA 1GXLA 4B9TA 2NCKL 1VHIA 3UN5A 1S0VA 4QPTA 1HWLA 1RT7A 2DGWA 4CLWA 3GILA 1YBUA 2Y9HA 1GMWA 2Z0GA 1NKEA 2AKWB 1IR1A 4DPXA 1UWBB 4C3MA 4HDGA 4YDDB 1FRXA 3PYFA 1WEZA 4Y2KA 5CD4H 1TU0B 4O0NA 2V2QA 4LF5F 4LFBJ 2M8HA 1URNA 4Z37A 1S0MA 4CLKA 3PIPQ 1HHSA 1LWEB 2VBWA 1O0PA 2YQ0A 1K1QA 4FKXA 1BXNA 2VQFF 4ELUA 2MQQA 1M5SA 2NUUG 3TZZA 2QFIA 3CW2C 2V2KA 4MIBA 2Z56B 2FVRA 4BS2A 2W7AA 1ZM2A 1S1UA 3JSYA 5LMNF 3DLEB 1Q8LA 3ZZRA 4URSA 4HH0A 4J9UE 1UA0A 1D09B 1PYOB 3V6HA 3RB0A 2D3UA 2YPZA 1TKTA 4FDFA 2LEBA 3IS9A 3MR2A 2RUSA 1IM4A 5KG0A 5A0YA 1BGXT 4LF7J 4IOCQ 1FKPA 2GNKA 2R3VA 2I8EA 3AT1B 3RR8A 3KHLA 2V8DA 2XYPB 3NRBA 3T5HA 2KVIA 5M2RA 3NL0A 4QYZK 2IC3B 1DURA 2BJ1A 3I5CA 3SSSA 3EZ5A 1TAUA 2YQ3A 1AFJA 2Y1RI 2ASYA 1X4GA 1YSJA 4DI6A 4LF8J 1B7FA 3G2XA 1X5SA 1HYSA 2KZZA 1FXDA 2L9WA 3HSJA 3K5OA 4UTGA 2QO3A 4LF7F 1E6VA 1HWJA 5B0FA 1FNXH 5HMZA 4MIWA 4DPWA 3OXLA 2ZE2B 2ZH9A 4M5DB 3IR7B 1HKAA 1QAXA 2K3KA 4LSLA 5T41A 5A8WA 2WONB 3HPOA 3EGVA 1RWPB 2YVSA 2M4MA 5KT4A 3W8PA 2ZFHA 3VF0B 2XMAA 4KV8B 3K8WA 4W98A 4XAKA 4PUOB 1D9DA 2H4WB 2V67A 1OY8A 4CT9A 3MHYA 4ZCKA 1VMBA 4CTAB 3EM1A 2QLJB 4Y2AA 1U1OA 2UUBF 3BB5A 5EWEA 2WBRA 2JLGA 4J37A 1RBLA 2MB0B 2CQ3A 3DGPB 1VQ8S 3IWNC 4EYIB 1NSKL 1T9TA 4DV3J 1LW0A 4K59A 4CO0A 4YS2A 3CMAS 3ET6A 2IYIA 3BN7A 4OI0A 3SXLA 4HDHA 2K1RB 4CO2A 4DS5A 3B6BA 2HQGA 4O3NA 3JYTA 2E9ZA 2QTWA 4KY3A 4YB1P 3WX8A 2HRTA 3D1OA 3G82B 2GS8A 5HROB 4K4TA 4IUFA 3R5CA 2RUGA 2N82B 2VH7A 4DV6J 5D8HB 3QJJA 3HM9A 1RSCA 3J80Y 5HP1B 4FF2A 2A1BA 2M52A 1WNEA 1JMTA 1G6BA 4OYWA 1DQ9A 3CMES 1FXLA 1MWQA 4ILMA 2O01C 4OYMA 3X3UA 2W1BA 2RS2A 3F73A 1GXUA 1B0TA 4EUVA 1RTIA 1M5KC 2VDHA 4O44B 1IQZA 1HNIA 3VV2B 2KN4A 4C2MA 4ZJQA 4ZVTB 2DR5A 5GAGI 4HR2A 3M9MB 2OFHX 2WAQD 2QL7B 2AX1A 1IN0A 1ACMB 1LFPA 1RWOB 4DG1A 2R7VA 1DLOB 1NH8A 3T1YJ 4NCGB 3KJVB 2MQ8A 4JB8B 1N5TA 1DTTA 5EWGA 1AA1B 2M88A 4NYZA 3SEOA 3TRGA 3RTVA 2FJBB 1NDLA 2H5JB 2NQPA 5FIIA 4Y34A 1NM2A 3CPWR 2CZ4A 2BYCA 2RF2B 3IXQA 3JAMY 4RBUA 4F50A 1FWPA 5LSLA 1OSCA 2ZUGA 3CT9A 4EI2A 4DV3F 5KFLA 1WWHA 5B09A 2VG6A 3PACA 2OP5A 3GFXA 3BYRA 4CNZA 3D1QA 3JQMA 3JYTB 1F2HA 4RZRA 4HHUA 4DSJA 2WVFA 3D66A 2V8VA 5LOQA 4YB5A 1YJ7A 1U6ZA 3TAPA 1UVNA 3B54A 3PJ9A 4A4JA 3Q23A 3DM2B 1OPIA 6AT1B 4JV1A 1FKOB 4Q0BA 4X66F 1HQUB 2GJFA 2UV8G 4K5SA 4MKBA 2E5LJ 3DLBA 3OTDA 4CWBA 2AEMA 2XZDB 4NLDA 3FBBA 1JJ4A 1EQMA 3W1YC 1B99A 3HKWA 2HFVA 4DX8H 4KJIA 4TU9A 2RVJA 2D3O1 3I96A 3PIOQ 1WELA 3TEHB 4DSFA 3SBMA 4R5PA 4LRAA 4ED7A 4KHPJ 3G8SA 4XDDA 2DNQA 2J0WA 1V5VA 3NNHA 1FVSA 3UR3C 4NRTA 1FDAA 3LAMA 1KTQA 2YNIB 3NOCA 1NK0A 2HGMA 5CYMB 5J1PA 2DH9A 4ID8A 3EYZA 2V9KA 4EBEA 2ZE2A 4PUOA 2P8IA 3CCLS 3J7A1 4NLRA 2ZBQA 2ERRA 5HSPA 3M30B 3LWMA 1XMQJ 2B9XA 1U2CA 2V69A 2RMLA 2X1GA 3QATA 5G0RA 1X8DA 2C1EB 5A8WB 3KLFA 1SL2A 1HNXF 1HYSB 2R7RA 3MR7A 2J9DA 5HN0A 4JI3J 2JFDA 3ZZTA 1TL4A 1ZZNA 3M9NB 3L4BC 3GIRA 1IQTA 1LK5A 2FGCA 2IC3A 3EICA 3GIMA 2W25A 1CJTB 3RG6A 2KXHA 2J7UA 1WC0A 2QMWA 4DQRA 1N34F 1QJHA 4OYXA 3CCUS 2RT3A 1NSPA 1OWXA 2WW8A 3NCRA 3MPVA 4DU8A 5K8OA 4G1QB 3AY0A 2W2OP 4RW6A 2AEJA 4Z7YA 2DHSA 2YNGB 4ED5A 5IT9Y 4YOEA 2BQRA 5F8JA 2Z2MA 2J6TA 2IAJB 2IYGA 3NNCA 2RB7A 3P4UB 4DR6J 2MQOA 1EETB 3C46A 5D4LA 4OL8A 2AF6A 2MZQA 2WBMA 4P2XA 1ZH5A 1U1NA 1O5JA 4X4TA 4N5SA 2E5IA 4KGXB 2UVRA 1U1QA 5D4NA 2ASJA 2OEMA 1SJ4P 2AV5A 4DDFA 4IG3B 2IJNA 1GMVA 1LWEA 1H2TZ 3LTOA 4CH0S 1CVJA 3KUHA 3I0RB 3HVTB 5KFEA 2C2MB 2FY8A 3DRXA 3J7ZT 4DUYJ 4GO5X 3LOUA 2JNJA 3K89A 3V5RA 5L9NA 3A8IA 3THTA 1SUQB 2A10A 1RWNB 4ALZA 3OSNA 2DGSA 2WVCA 3SQOP 4RU9A 2RS8A 3NGKA 2A6MA 2FZCB 3G71S 2AU0A 5KT6A 4I69A 1UCNA 3OL8A 1SV5B 1HI0P 4ANCA 4OX9F 1S57A 3GLJA 4X62F 3M2UB 4DLGA 2R4FA 3IWXA 3CD5A 4K5RA 3VAMA 4CCHA 1RK8A 2YKAA 3DNCA 2WZ1A 1NKCA 2ZHAA 5E7OB 2DPJA 1D8ZA 4ZDNA 5IT4A 4ILLA 4FVMA 5KT3A 3SMZA 3G6ES 2ZBIA 2CNNB 4F4KA 4MAKA 4CT8A 2LVWA 4F04B 2W8LA 2DR7A 1Y3KA 1UW4A 4HHJA 2Y1LB 4QIWD 1HQEA 1RTHB 1C0TA 1VK8A 3KWMA 3RJMB 3UD4P 4X4NA 2B4VA 1SKUB 4MK8A 2E1PA 1XIQA 3MF5A 5JXSA 3U1MA 2JWNA 1R8HA 4F0HA 3TUZC 2V4JB 2XGPA 3PTWA 3G4SS 3E3XA 3QGHA 2O67A 4NI2B 5DLGA 2W4PA 5B7WA 3MM6A 4NPOA 2AEFA 3H90A 2E7XA 4HT7A 1OYDA 4ZPBA 4AT1B 4OZNA 3MI7X 4CI0B 4QR2A 3H4BA 2PT0A 3AD8C 2DNZA 2RRBA 5K8MA 1T11A 1I5OB 2Z8QA 2R8HA 2BKOA 2VQFJ 3CVKA 3AXKA 2HVDA 2PA3A 4IFVB 3H25A 1XJWB 2CQ0A 3MFIA 4DV0J 1S4EA 1IWGA 3M2UA 4WXWA 3OVBA 1RU2A 4DZ6A 3GCXP 1U4BA 4LF6F 1DFDA 2FHMA 4NLWA 1JLAA 1R8AA 2CPHA 3NLCA 3GFHA 3OQ2A 1C2PA 1TKXA 3V81B 2MLYA 1S1XA 2V94A 2I5JB 4KQZA 3GZ7A 3QSYB 1VIXA 1PJ7A 4USJC 1YZ6A 5KFUA 5IQ6A 4XPEA 1VQ7S 5IXUA 2GVDB 5J2NA 5AE3A 4H54A 4CZCA 2HG4A 1A7GE 1H73A 1VR6A 3CCVS 4D3GA 4G3IA 3BBCA 3ZTRA 3W9JA 5A8RA 3WX4A 3VALA 2AYGA 2QLXA 1JKHA 3KFWX 2MQLA 2OPRB 1TZ0A 4NYPA 4ZP9A 4ZCIA 2VB6A 3TNVA 1TK0A 2QA4G 3LGMA 2JZ5A 3OR1A 4KPYA 2BE7D 3EVWA 2Q43A 4LRDA 5DQIA 2AJ1A 5DDPC 2UXBJ 5K9FA 3UNGC 2GGPB 2ZJPQ 1DTTB 3EXYA 1XR5A 1CJUB 3BKUA 4ICLB 1S48A 1NDPA 2R7SA 2KM8C 1E6YA 1SVDA 2FZGB 1QLNA 4RW7B 3OR2A 2FUG9 1HNIB 3PR4A 2MYFA 1YBTA 3Q89A 3H5XA 2YY3A 4F4AA 2PSZA 3M6UA 2FB0A 2HHQA 3M8QA 1VC5A 3I6PA 2IIHA 1D3WA 2OPSA 1PC5A 5D0HA 1BWEA 4ZHRA 1OSDA 2CJYB 5HATA 4QR1A 4M5IA 1C0UB 5K14B 4B08A 1T95A 4CYUA 2BJDA 1S9EA 3U1LA 5HP1A 1FVQA 2QA1A 1T03A 3CJ2A 3CXCR 3DLKA 2CDQA 3UE2A 4KGKA 5LXYA 1HBNB 1U2RA 4QU6A 3F41A 3K2YA 1OY6A 4M63A 3HCXA 1T7PA 1JXEA 2FDNA 1FA0A 2B3TB 2GMLA 1SC1B 1X0FA 1W7WA 4CP5A 3RBEA 1U8SA 2NR0A 2HQFA 1RAFB 4DLEA 2EBGA 4JI7F 3D67A 1VRUA 1Q53A 3KLIA 1LW0B 1NH7A 3BBFA 1C1BA 2PEBA 1BD6A 1UJ5A 3MUTP 4Y2CA 1Q4RA 2ZOMA 2AIRB 1NO8A 2MLXA 1H7XA 2BE9B 2CWKA 2VD3A 2HNDA 1HW9A 3R8YA 5D15A 3W62A 1RTJB 3FEXB 1U1KA 3BM7A 4M5HA 1OJ4A 1D8YA 5AXKA 4C8MA 2MKKA 1RAEB 1TFYA 4BDPA 2HVZA 2OMLA 1QUPA 1GNKA 2FJVA 2Z57B 2DGOA 3RUBL 1AUSL 2DY9A 1F0XA 1R3NA 2DY1A 4R0JA 3T9NA 1V3RA 3EGWB 1VBKA 3W60A 2ZZNA 8AT1B 2IVFB 2BW7A 4HHHA 3D0HE 2F63A 1RAJA 1RHMB 4NE9C 4CNYA 1DZ5A 1MN9A 2LQJA 9ATCB 5CXTA 4ZVQB 3Q0AA 5DQGA 2XEXA 3CIZA 4V19X 4Q45A 4C6AA 1QSSA 1S72S 3BH7B 2Q1LA 3MCSA 2QN6B 3M8ZA 4ZVFA 2RU3A 3K5MA 5KFPA 1YJTA 3MEDA 2IMOA 4LUBA 4OYPA 1LWXA 5ETOA 3NAIA 1CSJA 1DLOA 3NGUA 3PYDA 3PV8A 1EB0A 2WVEA 3PRDA 3PJXA 4ZPDA 2RHSB 3CC7S 2Q66A 3A1YG 1WOOA 2A3JA 1RTIB 3DYAB 5DZ7A 3D6HB 3Q8PB 4EEYA 2BANB 4K0KJ 2DCLA 1F9FA 1N34J 2H54B 1B70B 3KMSA 3D9BA 2OTLS 1YG0A 2EFQA 2HBQB 1JLEB 7AT1B 4ED8A 1DTQA 5GMDA 1HL6A 1KOHA 3N5FA 4L6V3 3M8PA 2ZD1B 3WIVA 5F3ZA 5HMYA 4TKTA 4EK2A 2X1AA 1S0OA 3OFFA 3SIPB 3DOMB 4IH6A 2J7WA 1CS4B 3KK3A 4X4QA 3DRRA 3B82A 3JTNA 4YN3B 2VFTA 4YP3A 5HLFB 4FF1A 4BCAA 3CUNA 2NSCA 1WC5A 2NYHA 4RW4B 4DQQA 2E44A 3CCMS 4J9LA 2ZKUA 5KFIA 1WEXA 1XMQF 1CEZA 5F9LA 3KLHB 1XNQF 3Q8QB 4DV7F 1OY9A 1EP4B 1UEUA 2X7IA 3QO9A 1Q82T 1HMVB 3QLHA 1N5YB 1TMJA 2GHVC 8ATCB 3BQ1A 1F9EB 1KD1T 1B7YB 4TYBA 4PYDA 3UDEA 1Q16B 2J7KA 3DXBA 1ZTWA 3G96A 2V6AA 2CPJA 2Z2YB 4FVCA 5L9XA 2A18A 4WP3A 1TL5A 1YJNS 4K2JA 4Q7AA 2W7PA 4PZVA 1YI2S 2LYVA 5ETKA 5KFYA 3D3CJ 3IBFB 1AZSB 1HBMA 2IA6A 1WEYA 1KVJA 2ASLA 1ULRA 3VAGA 3HO1A 1N33J 1UKUA 1TV6A 1KOOA 1RLCL 1K73T 3A3PB 2GJIA 4R0EA 3T1HF 1SH0A 2MZJA 2MLZA 2VUGA 3N4WA 2HEKA 3EJMA 1RT5A 3RB4A 2BQUA 1RYRA 2NREA 2GJ2A 3HZGA 1JJ2R 1N6QA 1M5VC 4DFJA 2QZ8A 1T05A 3FZ2A 4V1Ak 2GFFA 5L1IA 1XMBA 2BRLA 1VI7A 1QSLA 2FPHX 3ZTOA 2PO4A 2ZH3A 2UVVA 1GX5A 5HMXA 1N36J 4Y2IA 3TA1A 2BDPA 1Q78A 2MKHA 1SH2A 5KG1A 3CB4A 1S49A 1YRUA 2ZH2A 1YHQS 3OUYA 3ZZYA 1M5OC 5A0YB 1KN6A 1YJVA 4MKYA 3M32A 1DY3A 4DR6F 3TUPA 2RKIA 2LA6A 2DNYA 2VQEF 2XI3A 3AHPA 1U0HA 4UF4A 4NCAA 2HWHA 4LBPA 4ECXA 1PBUA 1H0HB 2KRRA 1RT1B 4LF5J 4KIAA 1RTZA 1RWUA 1VISA 1LNQA 1X5PA 1ZPWX 2CYYA 2GQCA 2Y0BB 4IRKA 4CLUA 3VQTA 4AL6A 2LLZA 3ENAA 4DX6A 2I9SA 4I1TA 5KOWA 2LQ8A 2CQGA 3QZ8A 4PQUA 4C4WA 3DRSB 1HARA 1KDNA 5E3RA 1UFKA 1L3UA 1VGYA 5HQMA 1KQFB 3H5UA 1EKRA 2LP4A 4U7CA 4ED1A 5CZVA 4PWUA 4DPUA 3HHEA 3JSBA 1XWLA 4NZ6A 2BE2A 5I3UB 2VDIA 4QOTA 2F3JA 2B9WA 2M7SA 4KHMA 2HFNA 3UCGA 2KHDA 1R89A 2UUAJ 4DUYF 1U0HB 4EWTA 5D0EA 1L5UA 2R9LA 4M5MA 5F0UA 1S99A 2HLUA 1HD0A 2XMUA 1RA6A 3PEJA 4NA3A 4RPFA 2XO7A 3E2EA 2OSRA 1RISA 1VLOA 2HS0A 3LP1A 4ZJOA 1UJ6A 5HANA 3H98A 1IBKF 2BM1A 1NMEB 1HQ2A 3I9V9 2BE2B 2Z2ZA 3J7YI 1KHVA 5I3UA 2E29A 1QAJA 3QJLA 1F1BB 1WJ9A 2GHPA 2AW0A 1Y00A 1ZM4A 3MAAB 3HP6A 4DR4J 3W2WB 3T5KA 3FDSA 2D9PA 4PWDA 3FEYB 1HBUA 2PEHA 3E51A 4YEAA 5DS7A 4DV1F 2HURA 1VQYA 1YGYA 4K50A 3AJDA 1R0AA 5F8HA 4LVNP 1KONA 3QJPA 4I4BA 4X64J 2HWTA 3DXSX 3OBIA 2VFVA 3RAQA 4GC7A 1AW0A 2XQCA 1FWLA 2HIYA 4N8OA 3IG1A 4QR0A 3BSOA 4I2QA 4JP8A 1TELA 1WF1A 4RWXA 1HFEL 2WW4A 4KHPF 5MLCV 3WHIA 5K8NA 5KOXA 4CLTA 3PVXA 2EWHA 3L9ZA 2KJWA 2V5HG 4WBFA 1UP1A 1JX4A 2CPYA 4WU3A 1L3KA 4CM0A 3S8SA 3N28A 3QLHB 4H4MB 1QE1A 2ABYA 2L48A 2OO4A 3IBWA 2C2RA 4MJKA 1CQNA 4LR7A 3BGRB 1EX8A 3VGVA 4C8LA 1RAHB 2ZJQQ 4AUKA 2YKOA 3PX0A 1ZETA 1RKJA 4ITSA 4LBHA 5H9EJ 1RU1A 5D4PA 3AXMA 2VPXB 5IOLA 2KTQA 4WKRA 4X4UA 1T05B 2KXFA 4K4YA 1N32J 4TY8A 4B3OB 1N6QB 1RTDA 1FESA 2ZITA 1RBOB 2NXNA 3N0VA 2WVBA 2XSJB 4QCLA 4HL9A 4FF3A 3B8HA 2CQDA 4AE5A 2HAIA 2MSSA 1S79A 3CNQP 4QWCA 1X4DA 3W8GA 4PG4A 3LPYA 3A3OB 3IR5B 4LFBF 4BLGA 4DR2F 1KQKA 2ZH7A 2V9WA 2XMVA 3ZZOA 4USIA 2CKWA 3CDWA 2G13A 2DHGA 3NXZA 4PXEA 1HNZJ 2X1BA 2CQ4A 1IBMJ 4A8FA 2XMTA 3D1HA 4OHXA 2AJQA 1FTCA 2BOPA 4IQMA 3LUYA 2KHCA 1S1VA 1REGX 3CJ4A 3GFZA 3A12A 4OLOA 5KFJA 4LFAF 4ZVRB 1Q1KA 3SYZA 1NNDA 5B0BA 1M5PC 4FYWB 2XWYA 4WIQA 1SV5A 1VJQA 1IWAA 3PW5A 2RQCA 3GV8B 3Q8VA 3M8SA 4IFYB 2BA9A 5LL6d 3HSGA 3H20A 1A0OB 4YHHF 5T7LA 2FC9A 2XSJA 2QGFB 2ZBPA 1CJVA 1NJWA 1RI7A 4B3OA 1QAYA 5KG6A 1NXIA 3DOMA 4DPTA 4ZVEA 1MMNA 2HHWA 5LM7E 1HNVB 3TW0A 1KNZA 2HHUA 2BV3A 2ZH1A 3QFHA 4JI1F 1GAOA 3FBEA 4NXMJ 4C98A 2VICA 1IBLF 1PYSB 2XNQA 5E0OA 2ZM6F 4O4GA 4P75A 1HHQA 1TP7A 4X2BA 2NPFA 2XMWA 4QWAA 3LP2A 3MPWA 2D74B 4XO0A 1FJEB 1TUWA 3QGGA 4I2PA 4I56A 3MAHA 3I0SB 3LPEA 2CPDA 2MJNA 4A47A 2CAJA 3NY0A 2NUHA 3MM7A 2LEAA 1UAWA 4DU7A 2PI5A 3R2DJ 1TKZA 1C1BB 1S9GA 3T41A 1VK3A 1RAIB 2RRNA 1WUUA 2F9DA 4CH1A 1PBAA 3UD3P 5AXMA 1MW7A 4K8RA 2HGLA 4USHA 2R7WA 2UXDF 2FJXA 2DITA 3VZIA 3M7VA 2MZRA 1XNRF 4OHYA 2HK2A 1N88A 4I7FA 3HHDA 5LMNJ 3C15B 3C8YA 1N56A 1HBUB 1T9UA 3ZZZA 3HJVA 2MQMA 3KLEB 1RCXB 3QNWB 2MHEA 3R97A 5RUBA 2MGZB 3M1VB 4A8XA 3IN5A 4LF4J 1TL3B 3HFKA 5EGYA 4C8KA 3PM9A 2F65A 3A4TA 4OV1A 2EFGA 1R0BG 1T9YA 5DETA 4J9PA 3MFHA 4MKVA 1YZ7A 3RBXA 1N8RT 1SJ3P 1NDCA 4HH1A 4KGVB 2MKJA 3ONQA 4G1PA 4NA1A 4BHQA 3K58A 4M5NA 1I51B 4EYHB 3MUVP 2PMHA 2VFRA 4H4KC 4L75A 5A6WA 2B4PA 5KFGA 4QIGA 3G6XA 1EIYB 4AL5A 2GV1A 4L3NA 2GGPA 4CLYA 2GVZA 1F5AA 1CLFA 4TLRA 4MMOA 2R2RA 2VG5B 2DD8S 3PEHA 2XY6A 1S7IA 2CNKB 3LW5C 2BZ2A 4NLGA 3RW6A 4IOAQ 2HVIA 3MECB 1U45A 1UVIA 1FTRA 1WF2A 2NXUA 2NLWA 1D9FA 1TFWA 4JI1J 2RQ4A 5KFDA 3BPDA 5T14A 4IRDA 3DLKB 2L9NA 3CCES 3FBFA 2XC9A 1J5EF 4OZ5A 5C42B 3MOZA 1C0UA 2DHXA 1X4HA 2J9DE 1BQNA 3B78A 3TJAA 1BHNA 4EGLA 5LMUJ 2J0SD 2DGTA 3T6JA 4F3MA 2OI2A 2OD6A 2I5JA 1RT2A 1T9XA 5J2PB 2AJ4A 2CPIA 3S01A 3PYEA 3KDOA 2RKIB 3HT0A 4HACB 3TZYA 2UUCJ 1NPKA 4WK3A 2BVZA 2FVQA 2MQPA 3IGNA 1JLAB 4LRCA 3Q24A 3T5LA 3TWZA 1T8EA 5DM6Q 2QE5A 3MCMA 1LK7A 1FKAF 1G4CA 1FHTA 3EVOA 4CO4A 4PPZA 4P7VA 3CC2S 1WSVA 3QT7A 2UVWA 3GTYX 1VFJA 2Y1IA 1G2EA 2LQ5A 4N56A 3QAUA 3KJFB 4LSZB 4OHWA 1QDUB 1ZS6A 2CQHA 3GB0A 4P73A 4P74A 3R3TA 4WP9A 1YRXA 1UMJA 5KFVA 3ILOA 2W4DA 3DLGA 1JKHB 3MEEA 3MCOA 3O2IA 3F44A 3R1HA 2B5JA 2FHKA 3SZ2A 4CH7A 5GAGU 2L3MA 4IDKA 1Q8KA 4KO0A 1N0VC 2A6OA 1M90T 2OMOA 4X84A 4A8KA 3PO5A 3CD6S 2D69A 3UQSA 4LREA 5GMEA 1O6XA 2G1DA 1O51A 4QU7A 3QZ7A 1TL1A 4JI8F 4QW8A 1PG5B 2Y3YA 4WE1A 4ZPTR 1ZPVA 4OX7A 4F67A 1J5OA 4U67Q 2BJ7A 2CADA 4X64F 2Y1JA 3KNAA 2YKMB 3SQGA 2BX6A 2XM3A 2JC1A 4ZOSA 4ANDA 1HPZB 3KG1A 1FJGF 1Y3JA 3B4DA 5KFZA 3VVTA 4FXDA 2BJEA 4ECUA 1KVIA 3PW7A 4DR4F 3I9ZA 2DGUA 1SIWB 3MM8B 2E7WA 1S5ZA 3HDSA 3MAQA 2HHHJ 5KFHA 2CDRB 3OLBA 4OYIA 3S7RA 3KK3B 4NXNF 2YH1A 3KKFA 1RCOB 1NJIT 1S76D 1R43A 2HFSA 4NXNJ 3EZOA 1WHVA 4UUXA 3M8PB 3N79A 1S1WB 4IDKB 4KO0B 1CG2A 3V4MA 5IC4B 1WC1A 2ALZA 4DBQA 4DV2F 3JQKA 5B0DA 1H2UX 1TK8A 4DR3F 5C7PA 4B9LA 2C2NA 1NSAA 4DFKA 4Q8FA 3MPYA 2DEJA 3NGSA 2GMHA 2KJVA 2BQ3A 1H72C 2QLWA 3BEGB 2IY5B 3FK4A 3R5GA 1X0PA 3FCVA 1NAQA 3GU0A 3DOLB 5KFCA 4RL1A 2ZH4A 4YY3J 2E1AA 2M9KA 4CLPA 2AYEA 3QBCA 2XCPA 4P52A 1CJKB 3EDQB 4ZVUB 4YR0A 1R31A 1G3OA 4YFUA 4YDXA 5CH7B 2YH0A 2XULA 4OYOA 4YR2A 3I87A 1RHRB 1BMQB 1GXTA 2MQNA 3MEGB 4GMKA 4NLVA 4RW6B 4RW8A 5SUHA 4Z7CA 1IBLJ 4LFCJ 3RR7A 2KFNA 4UQTA 1OO0B 4ELTA 4ZJLA 4Y65A 2R2TA 2W9BB 3DOLA 3LAKA 1H38A 3R5JB 3K5NA 1BC6A 2VHGA 3THPA 1WKJA 1PJ6A 3I4PA 2LKZA 2R7XA 5C42A 2CG8A 2VPZB 2ADCA 1VQ6S 4C8ZA 1PKUA 1QAIA 1RWMB 1UVJA 1IR2A 2YQ1A 4WWSA 1IUJA 3GR0A 3KXDA 2YWWA 4WIIA 2PE8A 1I94J 4ZP8A 3RRGA 1I1GA 1D1UA 4FXWA 1QTNB 2N3LA 1IM6A 4WTOB 4X4OA 3BSNA 2PMWA 3AA9A 1JK9B 1FDDA 3CDAA 4ZVPB 3RYLA 4YMEA 5H9EK 3AODA 3QFWA 1X4FA 4IG0B 1VQ4S 2DCUB 2V4RA 1P1LA 3FRYA 1S6PB 5DG8A 2GIRA 3IGVA 1B64A 1UWBA 1NLKL 1YJRA 4I68A 1EJ7L 4J90A 4UQGA 4K4VA 1WHYA 1R8CA 1RHJB 3AOCA 5AJ3J 3ZO7A 2RILA 6FD1A 1LWCA 3MMBB 1RT7B 2XLJA 4OYAA 4J9KA 5IQQA 5SZTA 1W2BR 1BUXA 4JBCA 2M0GB 4USUA 3L7PA 2J8AA 2K7KA 2WSFC 3K8VA 4AL7A 2HBYB 1JXVA 2AP6A 2UUTA 3BR8A 3DM2A 4ES2A 2MDAA 2P2CB 4LJMA 5AXNA 2XBPA 1X9WA 2FJEB 5CQGA 4EBCA 2W2NP 1NBEB 4GRSA 3LALA 1AT1B 1SKWA 3OFGA 2D41A 3DFEA 4PYAA 4L72B 2HNYA 2P9CA 3BGFA 1WTBA 4ES1A 3OTOJ 4ECZA 2KXNB 2ILZA 3DLGB 4ZIVA 3M8QB 4P72A 1YDLA 4PXBA 3FSXA 3HVWA 3R5DA 3J80U 2VFSA 1L3TA 4O3RA 3HJFA 2R8GA 3IBCB 2V8GA 4RW7A 4ZLLA 1LWCB 5H1SV 2KDOA 5LJ3Y 2G2OA 1KHWA 4UT4A 1NCLA 1Z4UA 4KE5A 3ZNUA 1YTYA 1LEOA 1R8BA 4KKOA 2W7OA 2OPPA 3N6MA 3SCLE 1RT6B 5K20B 1VRQC 4Y0FA 2F7VA 4X62J 2CJXB 2IRUA 1WF0A 1ZM3A 4I6WA 1F5BA 1RT2B 1I3OB 5KFOA 5J2PA 2XZTB 2Z4PA 2VF3A 5E3PA 1JLGA 2AQ4A 5A8RB 3LGNA 4FZVA 4B3RJ 3HMJG 4QPXA 2XMMA 3FGVA 3Q22A 1HD1A 1WORA 2EW9A 1ZOTA 1PSDA 1GT8A 1B0VA 4RUHA 2E1CA 2APOA 4IH7A 4OFZA 2KT5A 2OGUA 5M2UA 3QGIA 5A6PA 1N48A 4NYOA 4KPCA 1S1TA 3GONA 2OIHA 4ERDA 2W9CA 1AROP 4KAIA 1CC7A 1CJVB 1YVFA 3GJRB 3EPIA 3TARA 1I6JA 4J9RA 1S1XB 3ILJA 1P27B 2GCFA 5DDOC 3NG8A 3FNNA 4FS1A 2ZOFA 5HJXA 5DQHA 3W2VA 4DQIA 3VGTA 4GO7X 4YB7A 1SJFA 1FERA 2VBXA 3AOAA 3AB2B 4M1KA 3TYTA 4BC9A 4DX5A 5KFMA 1T94A 3TI0A 1FE4A 3DLLQ 1RT6A 1XNQJ 4KYZA 2FD2A 3C19A 4O44A 4Z2XA 2CJKA 5KT2A 2QSWA 1TQLA 2IM3A 4RW9A 1JLFA 4DR1F 5KAKA 1FI4A 3Q86A 2V4JA 1MSWD 1ZBTA 2WONA 3N01A 1TAQA 2I38A 3M1VA 1A6LA 3FSIA 1HQEB 1RTHA 4NLXA 3SI8A 2MKCA 2SXLA 2JC0A 4CDIA 2QSFA 1RE1B 2FZKB 5A2QY 3K7RA 4WFYA 4OZ2A 2ZH6A 2UUCF 3SCKE 2WCXA 5DJBA 3MPUB 4U8VA 1JXLA 2J6UA 4N41A 3KK1A 1FX2A 1K0TA 2DR8A 1HPZA 4ED6A 4RBVA 4WU2A 1YBAA 3BPSP 4YY3F 2JRSA 3UDLA 2DRAA 2CJQA 1AYEA 4B9VA 2ZWOA 4LSNB 3SQGB 3TEGA 4EMDA 1KBRA 5K5MA 4RNNA 4J9MA 4A8WA 4OLPA 3G8QA 2HW3A 3RB3A 3MMBA 4IG0A 1ZZFA 4QBUA 2QRRA 4HKQA 1KKHA 2FLOA 1HIYA 4I2PB 2NZ4A 2PA8D 2A2CA 4B3MJ 1UFLA 3KG4A 3ILLA 2AZ1A 2BJ8A 2LFVA 2PN6A 2IRXA 2R42A 2VC1A 4Y3CA 3CE8A 3VQSA 4UZBA 3PDNA 4IQXA 4FNIA 2DB1A 3D0GE 2L9DA 2ROPA 3I4HX 3QQCD 4KH0B 4TU8A 3BO3A 3PFEA 4RR5A 2H5EA 1SC3B 2QC3A 3IMQJ 4M5KA 4M5DA 2CVIA 3EUNA 4USVA 3HHLA 5ETSA 1FF2A 3RAMA 1Q7LB 4IG3A 2UP1A 1JIHA 1RAGB 2B6AB 2YNHB 2JLEA 1VLYA 2CJBA 1S10A 1BLUA 1RWKB 3MAAA 3ICLA 2OHDA 2G0CA 2NS1B 3ISNC 3O44A 2OPQB 3R6GB 4IFYA 2IHR1 4RUBA 1F60B 3M2VB 2L08A 4L74A 1DQAA 4KGMA 3DHWC 1WI6A 5HBMA 5CD4A 2W24A 3RRKA 2KL8A 4CM2A 5KFBA 2POKA 3NKYA 2AGOA 2KZMA 2Q3PA 3SFUA 2O1PA 2QMUB 2W4CA 4XK8C 3W65A 4DN0A 2ZC4A 3M8WA 4GKJF 2LQBA 1S9FA 3MEGA 4USWA 2WRMA 1SIZA 5J1EA 2C3OA 3NOGA 5BXIA 1FD2A 3T1YF 2JSXA 1UPMB 2YX1A 4DL3A 1ZA2B 3VR1A 2F4VF 4JOUA 1R6YA 4H4OA 4LF9F 2C2EA 5EHHA 4P2FA 2EBEA 4V19J 2V63A 4DUZF 1N5YA 3H5YA 5CCMA 3G9CA 3KUEA 1NK5A 3H8YA 2DJWA 3HD1A 1U25A 4XDCA 3V6DA 2RNEA 1GEHA 4O3QA 3ULHA 1KLNA 1X7VA 1X5TA 3DGVA 1IXKA 1RADB 1JQGA 2B56A 2U1AA 4M5LA 5F3TA 4AD6A 2DRBA 3M6XA 4M5JA 3BKTA 5BYRA 2VG5A 1P8GA 1IKXA 1U48A 4RX6A 2DNNA 2PD1A 4KC5A 3CJ0A 3CCJS 1IBMF 3KOAA 1FJCA 2CJ9A 4HTJA 4DF8A 3U27A 4DR2J 1IKYB 4F8RA 3NMRA 1ZAWA 1SCJB 1LWFB 2HBRB 5K8PA 3HHKA 1KR4A 1FKOA 1IKWB 1OS5A 1S59A 1RLDA 2C2KB 1JLQA 1WDTA 2MKYA 2Q6BA 1UZDA 1YKWA 2DNKA 4C48A 3OHAA 3X1LB 4YHHJ 3TX0A 3CDBA 1J5OB 4KH1B 5A8KB 5BR8F 1FDBA 5KG7A 2Z58B 4NLQA 5C2GA 3THVA 1TL1B 4LRFA 2ADBA 3MMJA 3SFGA 5HL7Q 4ZP7A 5FLXU 2ASDA 5L8RC 2X3GA 3GJQB 2C3UA 2VFUA 1HNZF 3A8KA 5EDWA 1T9VA 1JWWA 1TV6B 4HYKA 1F5CA 3UCUP 2D3OR 3MR5A 3CCSS 3Q8SB 4NOHA 2ZKTA 4OX8A 4UZCA 4U95A 4NLOA 2NXJA 2XMKA 3A8JA 2FLPA 3BS9A 4DV2J 5AE2A 3OL6A 2E1RA 4RUAA 4ZPCA 4RWWA 3CO0P 1R7IA 5F9NA 3VZHA 3HHLD 1NSQA 2MXYA 3UD5A 6FDRA 2FJAB 3IAM9 3GV5B 2DPIA 4P9SA 4USTA 4WTYA 3CJKA 5J2QB 2BKNA 5F0WA 1EP4A 1PYTA 1Y9OA 3LANA 1Y10A 1NK8A 1XR7A 4DSIA 1X4AA 2HMIA 2O5DA 5KFFA 4ES3A 1Q5YA 1DQ8A 2A2DA 4HACA 1TTHB 2XO6A 2EI5A 1SL1A 3SCIE 1YX2A 5ETMA 4B3SF 4K4XA 4QWDA 1OMSA 2P6SA 3ELHA 4EZ9A 1HBOA 1WOPA 2QX0A 3R27A 4NEZA 3RU0A 3ZTQA 5LSRA 3BQ2A 1UW9A 2LCWA 4PAAA 1IBKJ 1L3VA 2KRBA 2HHVA 4ID5B 1N54B 2V0NA 5D0GA 5D3GA 2EK6A 1VQ9S 3N6NA 3W64A 4OMFG 1DTQB 2EPIA 3TVYA 5JVGQ 2HHHF 1VYAA 3FFIA 3PW4A 3PY8A 4PKDB 2JEGA 5G4DA 2GVZB 5L46A 4P10A 1YIJS 2C2OB 2IM0A 3M9OB 4DL5A 3PX4A 4I6YA 3MECA 2HBZB 1SKRA 2ZBRA 2DNGA 3GE9A 3MURP 3OT9A 3PYGA 3MUMP 4IR1A 1GH8A 5DG7A 2A0FB 3CD7A 1MN7A 5CHCB 1JLCA 1J2VA 3KMQA 2UUWA 4FN5A 1VQMS 5ETNA 3VTIA 4N7TA 1WHWA 1H98A 1Q79A 1UZHA 3JSRA 1YWXA 3MMAA 4Q2MA 3ZTSA 3W7BA 5HBMB 5BR8J 2YWHA 4F4ZA 3BO4A 2MJUA 4ZLNA 2XHWA 5L1LA 4JI5J 3TANA 1QVFR 1VJWA 2OFGX 2WOMB 2G0IA 1NPPA 3UN2A 2R8IA 2CWXA 4BBYA 4OJGA 4OI2A 1ZM9A 3BKFA 2LXUA 4RU2A 4N76A 3TJ8A 4ZCMA 1RT5B 4RNFA 4WP8A 3CJ5A 3PO4A 3ENVA 2B4OA 4RNMA 2VZ9A 2V68A 3D28A 3EGZA 1IVZA 2K3IA 1DBDA 2XI2A 3OTOF 5FDLB 2HPUA 3C15A 2CNLB 2L41A 2PDAA 4Q2LA 4ZP6A 4HVZA 2P9EA 5JUMA 2MKIA 2KFYA 5BYSA 3GYNA 2KH9A 4EBDA 1RWWB 2MZ1A 3MD3A 3DDKA 4O3PA 4B02A 4X65J 1VC6A 3TP2A 4UOGA 2H1YA 5F8GA 1TKDA 4B17A 3HT3A 4C3KA 3I0SA 2DXDA 5D0RA 3V2UC 1CULB 4RLEA 3JB9k 4DR7J 1RXOB 4EFAC 2DNRA 3AJ1A 3LP2B 4B9SA 3Q8UA 2CG4A 2D9OA 5B08A 5HQ8A 1UTAA 2BM0A 1LFWA 4DV4F 4FYDA 1QM9A 3DI6B 1K47A 5A2QU 4MIAA 3K0JA 5GAEU 3PKYA 3D4JA 3GMGA 3RBZA 3TR5A 5A76A 2HSEB 5IV4A 2W9AA 3G6VA 3KNGA 2GIQA 1TK5A 4ED4A 3MZIA 1RT3A 3S1TA 3CC4S 3CDUA 1HBNA 3BSCA 2M3DA 2DK2A 2KG0A 4U9RA 1S9EB 5AXLA 3D2WA 3GR1A 3DLJA 1U6FA 2QYCA 3PHEA 1AUDA 2C3MA 4G65A 1WD6A 4TLQA 2XMJA 3DOKB 1JLFB 4Q0BB 4RW9B 2FHOB 2WOMA 3G6YA 3FEZA 3V4IA 1FEEA 4QJVA 1D0EA 2FLNA 3CCWA 3AQPA 3HULA 1SJ1A 3J7AN 1DJ0A 2KU7A 3R7BB 4IYQA 3NP5A 4OI4A 3SSQA 4QW9A 3GIJA 1XNRJ 1U2FA 1UL3A 4KFBB 4PXDA 2PGCA 2EG1A 4J9NA 4DL7A 1CPZA 4Q5VA 4ETXA 4OZLA 1WG4A 4FS2A 3TOQA 1FNMA 3ITHB 4W92B 4AFFA 4OZ3A 2D3ZA 4PXCA 5D3GB 2QT7A 1MG7A 1RACB 1SQGA 2GC8A 4ID5A 4F4WA 1PILA 1S6QB 3LO3A 1T9WA 3ENQA 3HFVA 1U26A 1LXJA 4KB7A 1V5IB 2B51A 3VCDA 2HHXA 3RB6A 2FTRA 2VU5A 2QYGA 2ROEA 2R7QA 2DO0A 3F56A 4EZ6A 3BH6B 3KG0A 2EG2A 5HVFA 4CLSA 5B0CA 1CBKA 2XY5A 2HMIB 5KFTA 4IKAA 2RJZA 1RQ0A 3DMJB 1K1SA 5J2QA 2QG9B 4F02A 1VQKS 2GAGC 2H65B 2I1RA 4BWJA 1M1GA 2LEPA 2FHJA 1UEKA 1SQEA 2OPPB 1VCTA 2EKYA 4KKOB 2CRLA 1HA1A 3C14B 4O4RA 4ED3A 1L3SA 4C9DA 3MMCB 3ZZUA 2VOOA 2J9CA 3U1NA 2RSQA 5KG4A 2ZM6J 1VQ5S 2B8PA 3MGJA 2K06A 1EARA 2CQCA 1WSRA 2VG7B 2VASA 3L3CA 3OSPA 4JI3F 3JTOA 1VOMA 2ZC3A 3NWGA 4UOCA 4LFAJ 3R9LA 3J7YU 2KKHA 4DL4A 5E33A 1RT4A 4O3OA 2ZHOA 5KFQA 3UWTA 5E3QA 4CQ1A 4K4SA 4ENOA 4C11A 3NS5A 3TZWA 3VAKA 4CO1A 2VQEJ 1O8BA 2X3DA 3QT8A 4ZIWA 3GV7B 2IA0A 5ETRA 1UEVA 3MEEB 4K4WA 2GMJA 2U2FA 5DGAA 2LXIA 3P3DA 1IJEB 1SBRA 2R7OA 1NRKA 3W2WA 1JLBA 3TAMB 4ECQA 1Y11A 3W3SA 2YWGA 3JXOA 3DKDA 4KHRA 4U7UD 4ZVSB 1IBCB 3KJQB 2O3DA 3C14A 1UETA 4DWIA 4NLPA 4B3SJ 4LQ9A 3HHNB 4FBTA 4MKAA 4F3OA 1WG1A 4HTIA 1B4SA 2I0XA 1SPBP 2B9EA 2CPXA 3KJNB 2HLTA 4UOHA 1Q86T 1EQ0A 2F8MA 3AB4B 1YQHA 3DRRB 1WKLA 3PFOA 2HFUA 4ANEA 2B43A 2BW2A 2LQ9A 1P6TA 2H3EB 3Q83A 4I0WA 1IKXB 5U47A 2QFJA 3FFIB 4E98A 3ZZPA 3IA0A 1U1LA 2QL9B 3T5JA 2AJFE 4JI8J 4LVOP 2F4FA 4AXIA 5J2NB 3HKZD 5GADU 1KS2A 1H7WA 1HBOB 3OFEA 3KYLA 2X51A 4U96A 2B7BB 3V6DB 1X4EA 3BGUA 2LU2A 4CLZA 1U02A 4NCBA 2YX4A 3OPKA 1QVGR 2CFXA 1BY9A 3CTRA 1H3DA 3IRXB 4K4UA 4H4OB 3OUYB 1AXQA 4IO1A 1FRKA 3AOBA 1KEKA 3NGDA 1T0TV 1VQNS 4MH8A 4DSKA 1RWXB 1VS3A 3JQJA 3M32B 4HI1A 4M5GA 4ZPWR 3TJ9A 3D7SB 2GAHC 2OAUA 4KR0B 3AJ2A 3V4IB 3FUYA 2OPQA 3H2UB 4ED2A 3VAIA 4DF4A 2G9OA 3DOKA 3QWPA 4DV6F 2BEFA 3VHQA 1NJZA 3TQ1A 1PIEA 3EZUA 3U7JA 3AD7C 2B6AA 3AAWB 3QIDA 2R2SA 1JB0C 1VQOS 1MMLA 2RQKA 2MGZA 2OEJA 2JJ4D 1FK9B 2VODA 2YKQA 1WG5A 4J91A 2N7YA 1TUGB 5DM7Q 2BRKA 2LMIA 2YNHA 4CLFA 3M30A 1HBMB 3MEKA 2XWXA 2YX7A 3RAXA 3VAHA 5LT5A 3EMTA 2EEYA 3A3NB 3EGNA 2CJAA 2B7CB 3DC2A 3BR9A 3UW1A 5CYMA 5CA5A 1YJWS 1ZYQA 5A8KA 1KP6A 4WXOA 1WC3A 2LU1A 3PRVA 3UO0A 2VV5A 3MMCA 3BQ0A 1Q5VA 4OHZA 2IFXA 3GPAA 2DXEA 1HMVA 1W2IA 3J81j 5CYQB 1K44A 5F41A 3H0PA 5ETVA 4PR6A 2KYXA 3Q8YA 1VRUB 3KLIB 3CDEA 4J9VA 2ACMA 4WKYA 4DR5F 1U09A 3PW0A 4M94A 1N32F 1FE0A 2DNHA 4W4MA 2IRYA 3DHXA 2ROGA 1REVB 1BQXA 3HVAA 3K5PA 2FQQB 5JMNA 2I2YA 3A8EA 4O3SA 3DMJA 4PG5A 2WVDA 4DCPB 1SUQA 2RQMA 4NLSA 3KHRA 5LSOA 4OZJA 4UY8T 1EHWA 5F8IA 5HK4A 4DQSA 1WACA 3NGTA 4JV5F 4J9SA 3KUGA 4QZVB 1VDHA 4WFBQ 2JVRA 2V4QA 3NMAA 3HVTA 3HSZA 2CZVC 1NKBA 4LIRA 4P2SA 1WHXA 4WZQA 1XQIA 1TMMA 5IT0A 4DPYA 3M8RA 4DV5F 2DBBA 3O8WA 1Q95G 4WFNQ 4AQYJ 5IFMA 2RDJA 2IDEA 3IP0A 4C7QA 2AZ3A 3PJWA 1CJUA 4PQAA 3DYAA 1NHKL 4WFZA 4ZITA 2OTJS 3OVAA 4K2XA 1R6VA 3MM9B 2VJUA 4FP9A 2XNRA 3QPIA 2CQPA 1VQLS 3JAMU 3Q2SC 3OR1B 1KTVA 1XERA 4DUTA 3JTPA 4J5OA 5GAHI 1CJTA 3RW7A 1HR0J 2ZWPA 3HI9A 5H9FJ 2IM1A 3CD0A 3N6LA 1FFWB 4MK7A 1FRJA 3TQEA 1KSPA 5FJ4A 1TUVA 2MTLA 5IZHA 3ZTPA 1RAAB 3H7HB 5KFXA 4ZVHA 3DCAA 2FVSA 3FCHA 5ETQA 3G82A 4K7QA 3DN9A 2V8PA 3KLFB 5HROA 3KTQA 2F9JA 5D77A 4OJ1A 1VQSA 3HHLB 3UN3A 1TKXB 2GIFA 4U7UK 5CYJA 4TU7A 4OQJA 3OL7A 3V81A 1KQGB 5B0EA 2AD9A 3CMQA 3TO8A 4DEZA 4Q43A 2EKNA 3ET6B 2HNDB 1B3TA 2NPIA 1F6TA 4DR5J 3EVMA 3MPDA 1FD8A 4J7CA 4A8QA 1RUSA 3CCRS 4JI5F 1CULA 3TA0A 1K9MT 1RB0A 1VQPS 1TL7B 3PG9A 2IBKA 2Q79A 4GC6A 5GADI 4F4XA 4QQBA 2V50A 3HZEA 3VGUA 1B0PA 3KLVA 4NL5A 4B3TJ 4KV8A 2C2DA 2HVHA 3FVYA 2HFOA 3UDCA 1HLWA 5FDLA 4X4SA 4ATNA 3WC0A 2UU9F 1MU2B 4QWEA 1R0AB 2PFDA 3GJSB 3PCOB 1NPRA 4HT5A 1XTZA 2CNOB 3E01A 1KFSA 1E6VB 4AYBD 2D7SA 8RUCA 3BREA 1V3SA 2CZ9A 2HNYB 3P6YC 4I7FB 2M70A 3EXCX 2EC2A 2B0GA 1LW2A 5AT1B 2RF2A 3TX8A 1XK8A 2MMYA 2HQIA 2DVIA 4A8SA 4ZHRB 4KRWA 4ZPVR 3RZAA 4TQRA 1HHTP 2V2ZA 4ELVA 1TKZB 3FZBA 3O5TB 4FPIA 4X66J 4A48A 2WB1D 5L38A 3SV3A 1LWFA 2HHTA 9RUBA 4DUZJ 2M8DB 3OR2B 2H9ZA 2FJWA 3UPFA 1GTHA 1ZTTA 3PX6A 1PCAA 1ROFA 2HRYA 2IVMA 3N9UC 4XIUA 2C22A 4FKYA 1HWUA 2B8QA 3DLEA 4PG6A 4WCEQ 2OPRA 3HFZB 2KI2A 2ZNZA 3NBPA 3TVKA 2ZBCA 1PO6A 1RWVB 3H59A 4JI0J 2RU9A 3MTJA 4ZKAA 1EAYC 3DRSA 1FNOA 4PQUB 4F36A 2W9CB 2QA4S 2JEJA 1S1TB 1IKVB 4R8UB 2XG8A 7FD1A 3OVSA 1KLMA 4EO8A 4A8OA 3GQCA 3QIPA 5T7LB 2GW8A 3OLAA 1Y5IB 2GVDA 2K1RA 2BUNA 3H4DA 4ECTA 2YWKA 4UUWA 3D5MA 3GIKA 2XCAA 2H4YB 1UVKA 2MPUA 2IAJA 2YWFA 3CSKA 4DR3J 1FEHA 3DRYA 3P5BP 1YJUA 4TQSA 4U8YA 5ADZA 2V2VA 2E9RX 1S1VB 1GTEA 3K17A 4LR9A 4MK9A 3I55S 3L95X 3MM9A 4G1IA 2OSQA 1RHUB 2VPYB 4WPAA 2YWEA 2RDDA 2CQ2A 2FJDB 2C42A 3OTEA 2ILYA 3R6LB 2HIQA 2QL5B 1WC6A 1YRTA 2E7VA 3W9IA 3EPGA 1Z2ZA 1EKSA 3CJ3A 2E66A 3M2RA 4DV1J 5HI7A 3HK2A 3EWGA 1ELOA 1QSYA 3OTBA 4GVLA 2XSFA 3O6QA 4ZVGA 4FNHA 2HNZA 2DIUA 5GMKa 3IO1A 2FYXA 2IM2A 5C25B 1RYSA 2I6WA 1V9OA 2J0XA 3QSIA 1W26A 2LECA 3OW2R 5F8LA 1PAUB 2J76E 3M6VA 3FCWA 1S1WA 3PHTA 4H4KA 1NB7A 3MM8A 1AZSA 1GX6A 3ZC4A 3R1LA 3M2RB 5E3AA 4N8NA 1FRHA 2FGOA 4L3KA 1Q0NA 3OXGA 2PMZD 3W9HA 1K0VA 7FDRA 4KSEB 4PG8A 1IKWA 3GIIA 1QE1B 5DG9A 4USMA 1BE4A 3TZXA 1H2VZ 1G7CB 1P1TA 1REVA 1X9MA 3MTKA 5JJBA 4X4VA 2LDYA 1KVKA 3CF5Q 1NB2A 4RBTA 3RBDA 4DFPA 2FY1A 2JL9A 4DL6A 4NMLA 2EFOA 1VHFA 1D9AA 3BZQA 4MT1A 5IS2A 4UY85 4GKKJ 3H42A 1SC4B 3KK2B 3BYPA 1FFGB 5KFNA 1M1KT 4WE1B 1QY7A 2VL1A 3LWLA 2IPOB 2HQ3A 4KGZB 4N77A 1VRTA 3T3FA 3OXFA 3KLGB 2YPYA 1SKSA 3P45B 5B0GA 4ECYA 4DFMA 3UCZP 3N5BA 4IRCA 5J2MA 4B9NA 1F2GA 2YTCA 3EDRB 2HNZB 2WK4A 3FC9A 3HF5A 4NA2A 3US5A 4EU0A 2DHHA 2DTJA 1WC4A 3QT6A 2WB4A 2HZAA 5KG2A 2JHEA 2Q6CA 3FBCA 4ECVA 1U1MA 4MYUA 1VBYA 2F8EX 4F0KA 4F2SA 3VAFA 2CQBA 4QIEA 4DG1B 5J1EB 4HI2A 2Z30B 4WK1A 3BJYA 2QEXS 2YNGA 4B3RF 1HNWF 1X5OA 1WKKA 4CIOA 3D54A 1KC8T 2XB2D 2M2BA 2W2MP 4JI4F 3NS6A 3GWCA 4PABA 5IC6B 3IRWP 4F7VA 5EN1A 1U1RA 2G2ZA 3OTCA 3GCWP 2BJ3A 1NU4A 3M2VA 4URGA 3SV4A 1OQ6A 1RBAA 2BJ9A 2C3YA 4ZA1A 2C3PA 3P8BB 5HO4A 3OV7A 1U1PA 1NK4A 2ZDOA 1ZAXA 5HMWA 4FXVA 1KLMB 4LBIA 3I32A 4E2FB 4OX9J 5H9FK 4R8UA 1VBZA 4DN9A 1BQNB 5CABA 5M2PA 2DEIA 4OI1A 3FQLA 1AFIA 5I42A 4TNOA 2FVCA 3ETOA 2N3OA 4DS4A 1NJXA 2DR9A 4DV5J 1C1CA 4TVAB 3WDOA 4KT0C 3W5ZA 1BQMA 5D6GA 3QRQA 1RABB 3MR6A 3NBPB 3H2LA 1JLGB 3ISND 5IV3A 1X31C 4P7TA 5IM0A 2JEFA 4B9UA 2UXBF 1XN9A 3ZZ0A 4R5PB 5KT7A 2IVYA 2WSCC 1QD1A 2CIMA 2DNPA 1RTJA 2ZVIA 3FKBA 3M6WA 1MMDA 1UVMA 4HLBA 3C2PA 4Y6IA 3TAQA 3CJRA 1XEZA 1XMOJ 4JV5J 2KG1A 2F40A 3G86A 4LSNA 3WQPA 1X60A 4L76A 2HYIB 1HQUA 4K4ZA 1FWKA 3DDNA 4RKUC 4ZLJA 2GHWA 4DSEA 5D4OA 2RD5C 3KK1B 3EE3A 1C4CA 3VGSA 3OHBA 1RP5A 3BSAA 3M4XA 1C1CB 2MZSA 3M8YA 3KLEA 4DV4J 3CJQA 2HGNA 4QIFA 4CO5A 4C0HA 2AGPA 4ER8A 1G1XA 3K57A 4LIWA 4LF6J 3E01B 2C28A 2QLFB 4G6VB 4OYBA 1W25A 1C4AA 1GFWB 1N52B 2MY8A 1SL0A 1JJCB 3QWUA 4BWMA 5KG3A 1OQ3A 1MU2A 2CVEA 2QIFA 3DDIA 5K14A 2OKQA 4LF1A 3R7SB 2B5JB 3GFYA 2YXLA 3D6FB 2RRAA 3NNAA 2OPSB 1UFWA 4NMXA 2J5AA 2ZVSA 4ZN1A 5F8MA 4NXMF 2IJFA 4RUCA 1FKPB 4PEOA 2UXCJ 4QWBA 4X4PA 2V34A 2XGQA 4D3HA 3IS9B 3AD9C 1TKTB 3B4MA 1XMOF 4LT6A 2J6SA 4PG7A 1J27A 1QTMA 2OH2A 1VBXA 2QMXA 3E8OA 4NCGA 3KJVA 3WIUA 2ZZMA 2H48B 3QO9B 3QMQA 2DRDA 1PGZA 1DHMA 3K59A 4TY9A 3AFGA 1WTFA 2GA7A 1FRLA 3CCZA 3R5BA 3HVRA 4LFCF 2XS7A 4P71A 3GG1A 1WOSA 2AHOB 3CO9A 3C6TB 3LH2S 1SH3A 3NEKA 4GVBB 4RNOA 4OV6A 3GSDA 3GYXB 5J2MB 5HLFA 2VA2A 2OJ3A 5F8NA 3EX7B 4CRJA 1XR6A 5HJYA 3J7Z5 3KLGA 2KT2A 1X4CA 4Y2MA 1UA1A 5EUHA 3VWSA 1ZA1B 2XZWA 3UVJA 1HNVA 2N7CA 1RAOA 2G2YA 3KK2A 4Q8EA 3QT5A 3HLUA 3BDEA 5D78A 2IDLA 4PRFA 2W9BA 3V6KA 4F3QA 4C3LA 2NXEA 1DARA 3ITHA 1R27B 3D0IE 2H51B 2MSTA 4DCJB 1MWZA 4CTAA 5CYQA 5I3PA 3HHLC 3IM9A 5E2QA 2BMBA 4OI6A 1JNZB 3DGPA 1CJKA 3ENWA 3MEDB 4NWBA 4PPDA 1UJ4A 3W2VB 2HFZA 3PNIA 4OYZA 4CLLA 5I3QA 4X65F 2AYBA 1Z1ZA 5GAHU 1U47A 4ZPAA 1Q8BA 4DMZA 3U02A 1VIOA 3TVZA 2WTFA 1MLAA 5KG5A 2NSBA 4NI2A 1TVRB 4BC7A 5BJRA 2CUYA 5ETLA 5C25A 1U7LA 2F5GA 2AMCB 3LF0A 1TL3A 5L1JA 4EO6A 2G0JA 3ADAC 2P5VA 2Z2LA 1MROA 4FBUA 4OIXA 2R7TA 4DSLA 1MWYA 4USKA 2ZDPA 2E1MC 3LP0A 4WJBA 5KFAA 3POTB 5LXRA 1OYEA 1NDKA 2DIVA 4YQWA 3R7NB 3PR5B 2AGQA 1RTDB 3JSMA 1Y0HA 1KFDA 4C0BA 3H2VE 3BGLA 3C66A 3IM8A 3UFCX 1FXRA 5KT5A 1HW8A 3CGIA 2N4CA 2KFZA 2BABA 3A13A 1Y5NB 3I56S 4JV2A 2F4VJ 4O23A 1TR0A 2XHCA 1S0NA 2E9TA 1WDDA 2VIHA 3ILIA 2OELA 4XPCA 4ZMMA 3F0NA 1KRPA 2R8JA 4KBIA 4LF2A 4WYLA 5KFSA 5EWFA 1LQ9A 4TYAA 3QRPA 2AWZA 1S6PA 3I5BA 3IRXA 3SSRA 4DL0C 2QA2A 1S1UB 3QIPB 2ZH5A 2EVZA 1H74A 2YKPA 4YB6A 2JX2A 1IKVA 4YUDA 3L7OA 2H5IB 2J9EA 2DH8A 3NCPA 2VOPA 4Y00A 1APSA 4MFBB 5HQLA 1HR0F 3V6JA 4ZLPA 1NZ8A 5BYQA 2KB2A 3I0RA 3IWLA 5THWA 1S6UA 2CPFA 2FC8A 5ITHA 1NK7A 1NK9A 3BDPA 1NUEA 1PC4A 5HAOA 2Y8YA 2FLLA 5HVGA 1N5SA 2AT1B 4IOBA 1F9HA 4MYTA 4PWDB 3T1HJ 3T1AA 2AJ2A 1UVLA 1J5EJ 2VKRA 3LP1B 1U6BA 2J8SA 2G4BA 1HWIA 2UV8A 4RW8B 3Q2TC 2BACA 2K2PA 4ZCLA 3TUIC 2EFNA 3GP9A 3PZPA 5DDQC 1E6YB 1KQSR 4FF4A 5J1NA 1N0UA 3NAHA 4I6AA 4JYAF 1NHUA 2RE1A 3HSDA 4JI2J 2ZHBA 4ZN3A 1ICEB 3IC1A 1HI8A 2Y0SD 2R7UA 1LW2B 2OUGA 2VBZA 1DRZA 3TAMA 3R2CJ 1YLXA 5DZ6A 3D6MB 2NXCA 3UR0A 3UDVA 2GO8A 1M0SA 1RA7A 1JJHA 5KTQA 4NLYA 5DDRC 3W66A 2J0QD 2IMWP 3ETMA 4ZVOB 4ZK7M 3GSIA 1NK6A 4NX9A 5HVHA 4LQ3A 2RH3A 1N5QA 4JI6J 3NGRA 4C8YA 2P9GA 3MM5A 1M1HA 2HS4A 5G0RB 4Q44A 4CO3A 2HQDA 3BGOP 3I82A 4MFBA 5DLFA 1GQEA 3DRPA 1V6HA 4TY8B 1RT1A 1LKZA 1NEEA 1S4FA 3OJSA 3KHGA 3TUJC 3WZ0A 5FLXY 2DHAA 1FDNA 3NWRA 1YK9A 1LV5A 4B3MF 3BBBA 4JYAJ 2DNMA 2ACYA 2LA4A 1TL7A 1U0SA 4A8MP 3C16A 4IR9A 4DR7F 4ECWA 3ZFVA 4B9MA 2EXUA 2CXEA 3BGRA 4KTQA 2UXCF 2V8HA 1PJ5A 1OIAA 2WHOA 1NJYA 2CA9A 3ZNJ1 2YKMA 4OI3A 1S12A 4O0IA 3BF4A 2HK3A 1RHQB 2MY7A 4P2MA 4JUZA 4J9QA 5C24A 4DHVA 2BXJA 4U6PA 3OJUA 3M05A 3MWBA 5E5NA 2CQ1A 3G8TA 2O66A 4I2QB 2BBEA 3FJ2A 1T02A 4C8NA 1HWKA 1OPZA 4ILRA 3DRPB 3POTA 1RDRA 1Q7YT 2PC6A 1PAEX 3MM5B 2BR0A 1ITPA 1MROB 2VBYA 2XYHB 2JH3A 4P6QA 4DXLA 2FHJD 4URQU 2MHNA 4NZ0A 2AYMA 2Y8WA 2PFFB 3CJSA 2OD4A 2AJ0A 5IWAF 3L09A 1HNXJ 2PI4A 1SXLA 2VG7A 2HVEA 3KDNA 5IWAJ 1SJRA 2KO1A 2YNFA 5DRKA 3SDEA 1FT8A 2E5JA 1CQMA 1FJ7A 4F25A 2P6TA 3FMWA 3MCNA 3PW2A 2YKNB 3MM7B 4C8OA 1SI9A 3QAEA 2PIIA 4OZ1A 1UWAA 2C2ZB 2F1FA 2CQIA 3RGIA 4RNHA 4F26A 2LXFA 2RIJA 2K8GA 3FSYA 3JS9A 3P96A 4FYYB 5CAAA 3C6UB 2QLBB 2HQCA 5EX0A 4J9OA 2XS2A 2BKPA 5GAEI 4LF8F 1H6KX 3IAS9 3KLHA 2LDIA 1YITS 2ALYB 3DU6A 1HI1A 2X1FA
chains in the Genus database with same CATH topology
3R5AA 4I64A 4RW4A 3LQVA 2E5LF 5KFKA 5KFRA 1URRA 1FO1A 3OFHA 3HX9A 3FQKA 3AQOA 4DL2A 4DJBA 2BANA 4OZ0A 4NLTA 2DGQA 3H5SA 3PRBA 4WFAQ 3CULA 2JVOA 4E0DA 1S6OA 2XLKA 4YR3A 1U49A 3DI6A 2AX0A 1EETA 1NZAA 2E5HA 3OL9A 2JOQA 3T6BA 2KT3A 1S77D 3SDEB 5CCLA 4C0OC 2YNFB 2CPEA 3H40A 1V3ZA 4G1QA 5KFWA 2DNLA 2DGXA 1FRIA 1RJJA 1WI8A 4IH5A 4M95A 2B9YA 3P5TL 3HXMA 3I5AA 3O1LA 3O3LA 1RGVA 4LSLB 3LP0B 3BN4A 4JI2F 1JNRB 3C3LA 2ZOGA 4JI0F 1FK9A 4B3TF 2RDIA 3P49B 3MXHP 1RT3B 2GX8A 4QYZJ 2UVUA 3DU5A 3IR6B 1TVRA 2W8KA 2UUAF 4QIVA 4UW2A 4DOZA 1NHVA 2YNIA 2HHPA 1S7HA 1U24A 2DT9A 4ETZA 1S9GB 2GQQA 3MMAB 4H4MA 3WC2A 4OX6A 2JEIA 2KYZA 4TN2A 2IBOA 4E8UA 3T9ZA 2CPZA 1JLCB 2EC0A 2R8KA 2ZNYA 1SC6A 1SJQA 2UZAA 3GG0A 1RKIA 4FPRA 2GQ2A 4NZ7A 5L39A 4DQPA 2DO4A 4DV0F 4HEA9 3KHHA 1R8PA 2EFPA 3IG1B 4O4GB 5GVQA 3BO2A 1Q8IA 4C97A 2DNOA 5IM0B 1XC9A 4I67A 4QYRA 1BQMB 5LJ5Y 3IFEA 2F8HA 3CWJA 3SCJE 2ZJRQ 1IJFB 4NLUA 1N4LA 3NCQA 5FD1A 4QPXA 5E3CA 2EFVA 2EK1A 3CIMA 3TA2A 1Y7PA 2FIUA 1S97A 1MNEA 2VG6B 3MDFA 4R25A 2ZD1A 2ZH8A 4N47A 3C6UA 4AQYF 3C6TA 1QUVA 4LMZA 1JLEA 4OJ3A 1X4BA 2M5YA 4OHVA 5CZXA 1I94F 1IR0A 5DO2A 3CJKB 5L1KA 2HS3A 5EX3A 1LOUA 4X4RA 1YJ9S 2MKSA 4WF9Q 2XS5A 3QYYA 3PKMA 4A46A 1JLBB 2E5GA 4F2RA 2YKNA 4JI6F 2XLIA 2XY7A 1N33F 3T19A 4ICLA 3I31A 1K8AT 2VPWB 4WZMA 4A8YA 2N4DA 4OJHA 2B4UA 3AA8A 4ED0A 4WFXA 5B0AA 3S6EA 4C11B 3DLHA 1Y4ZB 1RT4B 2FVPA 4LF4F 4ECSA 1N36F 1DAXA 1LXNA 1M5HA 1ZAVA 1VRTB 2WSEC 3CEDA 3FRZA 2KM8B 5JVHQ 2QV6A 1FCAA 5C24B 1Q81T 3AH6A 4IO9Q 1N5VA 2COLA 2D1CA 2GO9A 2JFKA 4MTPA 3PXGa 5I4MA 5DGBA 1SB6A 5MAOA 1JLQB 1P9QC 1CC8A 2DISA 4Y28C 2NYIA 2VONA 4JV0A 4ECRA 3Q8RB 5AJ3F 4DPOA 3VAJA 3MOJB 2OLWA 1IKYA 1XBWA 4AXJA 4WYWA 2JLFA 2ATLA 2HHSA 3JSMB 2HZCA 3MM6B 3K5LA 2DGVA 4IFVA 4NRUA 2HRUA 3UI3A 1T3NA 2VA3A 4K0KF 1FRMA 2DH7A 1A9NB 5LMUF 3MD1A 3J81Y 1S6QA 4GKKF 5I42B 4W90B 4PCQA 3MR3A 2JDJA 3FMBA 1Z2LA 2K7JA 1Y5LB 3CCTA 2HWIA 5C5JA 3WBZA 4M8LA 4ZS6A 4F4YA 3RRHA 5E41A 1T03B 1C0TB 4KFBA 3ISZA 1T3OA 2VKZG 2VC0A 3CCQS 1VC0A 2MZTA 4TXSA 5AE1A 3QGPA 2R2UA 1GXLA 4B9TA 1S0VA 4QPTA 1HWLA 1RT7A 2DGWA 3GILA 2Z0GA 1NKEA 1UWBB 4C3MA 4HDGA 4YDDB 1FRXA 1WEZA 4Y2KA 5CD4H 4LF5F 2M8HA 1URNA 4Z37A 1S0MA 3PIPQ 1HHSA 1LWEB 2VBWA 1O0PA 1K1QA 2VQFF 4ELUA 2MQQA 1M5SA 2NUUG 2FVRA 2V2KA 4MIBA 4BS2A 2W7AA 1ZM2A 1S1UA 3JSYA 5LMNF 3DLEB 1Q8LA 3ZZRA 4URSA 4HH0A 1UA0A 3V6HA 3RB0A 2D3UA 2LEBA 1TKTA 3IS9A 3MR2A 1IM4A 5KG0A 5A0YA 1BGXT 4IOCQ 1FKPA 2GNKA 2I8EA 3RR8A 3KHLA 2V8DA 3NRBA 3T5HA 2KVIA 5M2RA 3NL0A 2IC3B 1DURA 3SSSA 3I5CA 3EZ5A 1TAUA 2YQ3A 1AFJA 2Y1RI 2ASYA 1X4GA 1YSJA 1B7FA 1X5SA 1HYSA 2KZZA 1FXDA 2L9WA 3K5OA 2QO3A 4LF7F 1E6VA 1HWJA 5B0FA 1FNXH 5HMZA 4MIWA 2ZH9A 3OXLA 2ZE2B 4M5DB 3IR7B 1QAXA 2K3KA 4LSLA 5T41A 5A8WA 2WONB 3HPOA 2YVSA 2M4MA 5KT4A 2ZFHA 3VF0B 4KV8B 3K8WA 4XAKA 4PUOB 1D9DA 4CT9A 3MHYA 4ZCKA 1VMBA 4CTAB 2UUBF 4Y2AA 1U1OA 3BB5A 5EWEA 2WBRA 2JLGA 4J37A 2MB0B 3IWNC 2CQ3A 1VQ8S 1LW0A 4K59A 4CO0A 3CMAS 4OI0A 2IYIA 3BN7A 3SXLA 4HDHA 2K1RB 4CO2A 4DS5A 4O3NA 3JYTA 2E9ZA 4YB1P 3D1OA 5HROB 4K4TA 5D8HB 4IUFA 3R5CA 2RUGA 2N82B 2VH7A 3QJJA 3HM9A 5HP1B 3J80Y 4FF2A 2A1BA 2M52A 1WNEA 1JMTA 1G6BA 3CMES 1DQ9A 1FXLA 4ILMA 2O01C 3X3UA 2RS2A 3F73A 1GXUA 1B0TA 4EUVA 1RTIA 1M5KC 4O44B 4C2MA 1IQZA 1HNIA 2KN4A 2DR5A 5GAGI 3M9MB 2OFHX 2WAQD 2AX1A 1IN0A 1LFPA 4DG1A 2R7VA 1DLOB 1NH8A 4NCGB 3KJVB 1N5TA 1DTTA 5EWGA 2M88A 4NYZA 3RTVA 3SEOA 3TRGA 2FJBB 2NQPA 5FIIA 4Y34A 3CPWR 2CZ4A 2BYCA 2RF2B 3IXQA 3JAMY 4RBUA 4F50A 5LSLA 1OSCA 2ZUGA 3CT9A 4DV3F 5KFLA 1WWHA 5B09A 2VG6A 3PACA 2OP5A 3GFXA 4CNZA 3D1QA 3JYTB 4RZRA 4DSJA 2V8VA 4YB5A 1U6ZA 3TAPA 1UVNA 4A4JA 3Q23A 3DM2B 1OPIA 4JV1A 1FKOB 4X66F 1HQUB 2UV8G 4K5SA 4MKBA 3OTDA 1JJ4A 4NLDA 3HKWA 4DX8H 4KJIA 4TU9A 2RVJA 3I96A 3PIOQ 1WELA 4DSFA 4R5PA 4ED7A 3G8SA 4XDDA 2DNQA 2J0WA 3NNHA 1FVSA 3UR3C 4NRTA 1FDAA 3LAMA 1KTQA 2YNIB 1NK0A 2HGMA 5CYMB 5J1PA 2DH9A 4ID8A 3EYZA 2V9KA 4EBEA 2ZE2A 4PUOA 3CCLS 3J7A1 4NLRA 2ERRA 3M30B 3LWMA 2B9XA 5A8WB 3KLFA 2RMLA 2X1GA 5G0RA 4EYIB 1X8DA 1HNXF 1SL2A 1HYSB 2R7RA 2J9DA 5HN0A 2JFDA 3ZZTA 1TL4A 1ZZNA 3M9NB 1IQTA 1LK5A 2FGCA 2IC3A 3GIMA 2W25A 2QMWA 2J7UA 2KXHA 4DQRA 1N34F 1QJHA 3CCUS 2RT3A 1OWXA 2WW8A 3NCRA 5K8OA 3MPVA 4G1QB 3AY0A 4RW6A 2DHSA 2YNGB 4ED5A 5IT9Y 4YOEA 2BQRA 5F8JA 2Z2MA 2J6TA 2IAJB 2IYGA 3NNCA 2RB7A 2MQOA 1EETB 3C46A 5D4LA 2AF6A 2MZQA 2WBMA 1ZH5A 1U1NA 1O5JA 4X4TA 4N5SA 2E5IA 2UVRA 1U1QA 5D4NA 2ASJA 1SJ4P 2AV5A 4DDFA 4IG3B 2IJNA 1LWEA 4CH0S 1H2TZ 1CVJA 3I0RB 3HVTB 5KFEA 3DRXA 3J7ZT 4GO5X 3LOUA 3V5RA 5L9NA 3THTA 1SUQB 2A10A 4ALZA 3OSNA 2DGSA 4RU9A 2RS8A 3NGKA 3G71S 2AU0A 5KT6A 4I69A 3OL8A 1SV5B 1HI0P 4OX9F 4X62F 3M2UB 4DLGA 2R4FA 3IWXA 3CD5A 4K5RA 3VAMA 4CCHA 1RK8A 2YKAA 3DNCA 1NKCA 2ZHAA 5E7OB 2DPJA 1D8ZA 4ZDNA 5IT4A 4ILLA 4FVMA 5KT3A 3SMZA