2M8DB

Structure of srsf1 rrm2 in complex with the rna 5'-ugaaggac-3'
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Isolated pseudo-RNA-recognition motifs of SR proteins can regulate splicing using a noncanonical mode of RNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*UP*GP*AP*AP*GP*GP*AP*C)-3')
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8dB01
2NZ4A 5CA5A 2OTLS 1U1LA 3HHNB 5LXRA 1M90T 1WHXA 1D8ZA 2M4MA 1NJIT 2KG0A 3G6ES 3NNCA 3FEXB 1ZZFA 1H6KX 4F26A 3G8SA 4F25A 2LMIA 2DISA 2YKAA 1KOOA 3CF5Q 2CQIA 2MZTA 1UFWA 3N9UC 4LIRA 4TU7A 4WKRA 5DDRC 1XN9A 4YB1P 1YJNS 2KRBA 1U1QA 3IRWP 3CCSS 1OIAA 3R1LA 2RRBA 2BZ2A 2N3LA 2MKJA 5EN1A 1X4DA 2XS2A 2XSFA 2G0CA 2HYIB 1U1RA 2UP1A 2KFYA 2CPHA 2G1DA 3I55S 3CCMS 2VOOA 1KC8T 2DNGA 2QA4S 1SJQA 1HL6A 1U6FA 3RW7A 1WWHA 2QFJA 1U2FA 1HD0A 2DNYA 2F9DA 1S72S 4YUDA 2LA4A 3ZZZA 2J76E 3MDFA 1X4HA 2HVZA 5LSOA 2DH9A 5LJ5Y 2EK6A 2AYMA 4ED5A 1WI6A 4UQTA 4CIOA 5CXTA 2I2YA 1IQTA 1FT8A 2JVOA 3Q2SC 1WHYA 4BS2A 1X4BA 2PEHA 1YTYA 1P27B 5GAHU 1FJ7A 3UE2A 3J7ZT 1OPIA 3UCUP 4W92B 4LMZA 1FHTA 2RVJA 2DNMA 2XS7A 1JJ4A 5HO4A 2G4BA 2DGWA 3CC7S 1CVJA 2MY7A 2M8HA 1WTBA 4QU6A 5DDOC 2EVZA 1D9AA 2DNLA 2DITA 1WHVA 4CQ1A 1X5PA 2D9PA 2X1FA 2HGNA 1S79A 1Q81T 3S8SA 3L3CA 2JWNA 2MZQA 2DO4A 2LXUA 1M5VC 1X4GA 2MZJA 4QQBA 2M70A 5MLCV 1KOHA 5LJ3Y 2FY1A 1NO8A 3LQVA 1VQ9S 1L3KA 1K8AT 2MQLA 2GO9A 2GHPA 2RUGA 4J5OA 3VALA 1YJ9S 5CYJA 1UAWA 4M5DB 2AD9A 4A8XA 2VODA 5GVQA 2EK1A 3V4MA 3MUMP 2DNRA 2V94A 3MOJB 1SJFA 2AYGA 2CPYA 3SDEB 2DNKA 3G96A 2RS2A 1VBYA 5LSLA 2DK2A 1WEXA 2RT3A 2RRAA 3BO4A 2Q79A 4F02A 3B4MA 2MJUA 1U1OA 2MHNA 2A3JA 2MSSA 1OWXA 3CCJS 3UWTA 2MQNA 1JJHA 1RK8A 3U1LA 2N3OA 2KRRA 2MPUA 4PR6A 1UW4A 1M5KC 2CQCA 3BEGB 2DHSA 3MI7X 1YI2S 3SMZA 3DXBA 2DNHA 3UCZP 2RU3A 1KD1T 2MKHA 2CPZA 3US5A 3BO2A 2HGMA 1X4CA 3TYTA 2CQ4A 2AYEA 4Z2XA 3R1HA 1YHQS 1U1KA 2CPIA 1H2VZ 4U67Q 1SJRA 1WF1A 5GAEU 5D77A 1U1PA 4YOEA 4W90B 3MUTP 1W2BR 3TO8A 1VQ7S 2CQBA 5D78A 2ADCA 1U1NA 5GAGU 2WBRA 2XB2D 3P5TL 1SJ3P 3P3DA 4LJMA 1VQ6S 2MY8A 3S7RA 3CCUS 2DGUA 1WEZA 4QPTA 1HD1A 1F9FA 4Y00A 4V19X 2E5IA 2YH1A 1VQOS 2CQPA 3CCQS 1VC0A 2RS8A 2MQMA 1FNXH 3UD4P 1VC5A 2DNQA 3MD3A 2M7SA 3VAJA 3CCLS 1QM9A 2U1AA 2CPXA 2ADBA 2M52A 3I56S 3EX7B 5IM0A 1WF0A 2LCWA 3VAIA 2CQDA 2M0GB 1ZH5A 2M88A 3VAKA 5DM7Q 2J0QD 1WI8A 2DNPA 3JB9k 1PGZA 2MKSA 1KQSR 2MB0B 4WFAQ 1JMTA 2OIHA 5HL7Q 4C4WA 1A7GE 1X5SA 2MZSA 2MZ1A 1DBDA 2KI2A 2F3JA 1N8RT 3UD3P 3CC4S 1YWXA 2VONA 3CULA 1H2UX 2D9OA 2ZJQQ 2DNOA 2O3DA 1N52B 2NLWA 5LXYA 2PE8A 2KYXA 2CQ3A 4TLQA 1WELA 2XS5A 2MXYA 2ERRA 4WF9Q 3MD1A 2AYBA 3G8TA 3CCES 2VOPA 3FEYB 2LYVA 5H1SV 3BO3A 1WG4A 2MYFA 5DDPC 4CH1A 3H2VE 1URNA 2KU7A 1X0FA 2JVRA 1ZZNA 4OZ1A 3VF0B 3OW2R 3S6EA 2LEBA 2KH9A 3CMES 4C7QA 2MQOA 2DGVA 2OTJS 2MZRA 3H2UB 1A9NB 1H2TZ 2MGZA 2JX2A 3EGNA 4PKDB 3NS5A 1DZ5A 2D3OR 1WF2A 4WFNQ 2HGLA 1FXLA 1VQ4S 3D2WA 3B4DA 1YITS 1VBZA 2CQHA 2E5GA 2U2FA 1FJCA 2K3KA 2M9KA 1VQKS 2DHXA 3IWNC 2N82B 2RNEA 4OZ0A 2MKIA 1VBXA 1UP1A 4P6QA 3CCVS 4C0OC 2LKZA 1U6BA 2YTCA 3P6YC 1AUDA 2DGQA 4IO9Q 3CC2S 1WG5A 4TU9A 2DH8A 2J8AA 3G71S 2L08A 2E5JA 2X1BA 1RKJA 3CPWR 3UCGA 2KG1A 5DETA 3SDEA 5ITHA 2MJNA 2N7CA 2DGOA 1R8PA 2DGSA 3THTA 2DGXA 2MGZB 3MUVP 1VQMS 2X1AA 1WG1A 3R27A 3LPYA 2FHOB 1WHWA 1K9MT 2MQPA 2MKCA 2KVIA 5GMKa 2DNNA 2LEAA 4Y0FA 3DLLQ 1VQPS 1VQLS 4IUFA 3PIPQ 2KXNB 1X5TA 2XNQA 3G4SS 1SJ4P 3MURP 2JRSA 2MQQA 3BS9A 3VAMA 3VAHA 2FC8A 4EGLA 1SXLA 2CJKA 1X4EA 5IQQA 2B0GA 4WFBQ 4FXWA 5FJ4A 1QVGR 3NS6A 2CPDA 4FXVA 1VQNS 2E5HA 1WEYA 3CXCR 2LQ5A 2DHGA 2CPFA 3K0JA 2F9JA 1R8HA 5DDQC 2DHAA 2LA6A 2YH0A 4TU8A 2MKKA 2CQGA 1N54B 2QEXS 2OSQA 2KM8C 5IFMA 2I38A 2KN4A 2LXIA 3HI9A 2ZJPQ 1HA1A 4UY8T 1PO6A 3MXHP 3CTRA 3S01A 1M1KT 1M5OC 4IOAQ 2CPEA 5BJRA 4WIIA 2HZCA 2KM8B 2KT5A 3CMAS 1OO0B 1NU4A 1X5OA 1YJWS 1FO1A 1X4FA 5IM0B 3U1MA 1JJ2R 2OSRA 1QVFR 2ZJRQ 3P49B 3G9CA 2KHCA 2DB1A 2YWKA 3RW6A 2E44A 4QU7A 1VC6A 3CCRS 2K8GA 2KXHA 1M5PC 2MSTA 1K73T 1G2EA 3TP2A 2SXLA 2CQ2A 1Q7YT 5GADU 3EGZA 3CUNA 2OJ3A 5JVGQ 2BOPA 2CQ0A 1X4AA 2RQCA 5DM6Q 2L9WA 3PIOQ 2MMYA 1BY9A 3NNAA 1N88A 2RQ4A 2FPHX 1U1MA 2DIVA 3NMRA 1B7FA 1DRZA 2CQ1A 3Q2TC 4RU2A 1O0PA 2CPJA 3VAGA 1VQ8S 4ERDA 3ULHA 2DGTA 2DH7A 2X1GA 2LECA 3VAFA 1P1TA 4WCEQ 1DHMA 1YIJS 2XNRA 2DO0A 3NNHA 2KXFA 2J0SD 1Q86T 5JVHQ 4IOCQ 1Q82T 4PRFA 2M2BA 4ZKAA 3ZZYA 3SXLA 1FJEB 3CD6S 4CH0S 3J7YU 2FC9A 2DNZA 1VQ5S 3THPA 2M8DB 2DIUA 2L41A
chains in the Genus database with same CATH superfamily
5F9LA 3KK2B 3IO1A 4FF3A 5CA5A 4G1QA 1WKLA 3HVWA 4ZVSB 4DSKA 2LDYA 1HQEA 3KLEB 1WHXA 3OHBA 2BEFA 4EMDA 5IC4B 2HK3A 4ZP6A 2M4MA 4ECTA 4OZ3A 1NJIT 4F4KA 2HVEA 3G6ES 1D8YA 4DPXA 2ZH3A 3OHAA 2K2PA 3GFYA 2QL7B 3PTWA 3SEOA 3R2DJ 1MWZA 3DLKB 3Q8VA 4F25A 1Z1ZA 2DISA 2V4JA 1U25A 3K57A 1RAJA 3TUJC 2YKAA 4DV2J 3KJFB 3I32A 2HQCA 4UY85 1X9MA 3GR0A 4ICLB 3F73A 4QCLA 2C2ZB 3N9UC 4RW8B 3ZTQA 1S1TB 4CLTA 2MHEA 4NZ6A 3J81Y 4HT7A 3ZTPA 1AYEA 1XN9A 4QIWD 5THWA 4YB1P 2Q43A 1R0AB 4OHWA 3M8ZA 4M5MA 4ALZA 4GKJJ 4CNZA 3ET6B 2KRBA 3M05A 1N5QA 4A4JA 1N0VC 4IQXA 1KDNA 3R1LA 4ZPWR 4RW4A 3L09A 3QGGA 2J5AA 2NXNA 2I5JB 4HI2A 4UF4A 2A6MA 3IC1A 3PG9A 4AE5A 4KRWA 1JXLA 5F3ZA 2XSFA 4DFMA 1NLKL 2HBQB 2G0CA 4JYAJ 2HHSA 2Y1IA 2HYIB 5IT4A 2B51A 1U1RA 3KHRA 2G1DA 3CCMS 2HWHA 4ZVGA 4O0NA 1TV6A 3FBCA 5CHCB 4PQUB 3UR3C 4XPCA 1U26A 2XI3A 2OGUA 3RW7A 4B3RF 1E6YA 2QYGA 5BYQA 3N0VA 1S9EA 3H7HB 1N36F 3UDCA 1HD0A 2W2MP 2NPFA 1S9GB 4DR4J 3N6LA 1OJ4A 1TKZB 2F9DA 1AB8A 2N4DA 3FQKA 4YUDA 1S72S 2AQ4A 1C1CB 2H54B 4USJC 3J81j 2ABYA 1VRUA 2GIRA 3ILLA 5B7WA 3BPDA 1FNOA 3DOMA 3M1VB 4XDDA 1LFPA 4KH0B 4DV4J 2VFSA 1TFWA 2HBYB 4RWWA 3BYRA 5K14B 2NPIA 3AY0A 2W9BA 2AYMA 2J7WA 1WI6A 3ETOA 5ETSA 4UQTA 4CIOA 3KK3A 4QWCA 2JL9A 4LVNP 4MFBA 1Q1KA 4FN5A 2IVFB 1GFWB 1KR4A 2CAJA 4RUAA 3DNCA 4BS2A 3V6DB 5KTQA 1ELOA 4PUOA 2PN6A 1RT1B 3MTJA 3HM9A 1RLDA 4OYBA 3AD9C 1I6JA 3J7ZT 2W7AA 1OPIA 1EP4B 1FERA 1SC3B 4R8UA 1UWBA 1OSCA 2D3ZA 3ZZOA 3GIMA 1N34F 2Z30B 2E66A 2J7KA 2RVJA 2LP4A 1EB0A 4B02A 4JV1A 2HHUA 1JJ4A 1N0UA 3MCOA 4KY3A 4CLPA 1QJHA 3N01A 2DGWA 2XQCA 4J91A 4X66J 3UR0A 4C8LA 1Y10A 2MY7A 3UN5A 2M8HA 1RKIA 1RT7B 1FDAA 2ASYA 1CULB 4WFXA 1KTQA 4JI8J 2JHEA 3WX8A 5IWAF 4CQ1A 2XM3A 3QJJA 4I56A 1S79A 3PX0A 1U2CA 4ED0A 2QLXA 2BMBA 1TK5A 3CCZA 5KG6A 1FRIA 2GQQA 1JB0C 2HLTA 2YVSA 3HX9A 4MYUA 3L3CA 4DV4F 2LXUA 4ED4A 5KFNA 4KTQA 1SH2A 1M5VC 4X4QA 3EWGA 2HQFA 4QQBA 3POTA 2V4JB 4F50A 3CDAA 1NO8A 3M7VA 3IWLA 3WC2A 3LQVA 1VQ9S 4DDFA 5GAHI 3T3FA 3BGUA 4ZLLA 1IN0A 1SQEA 1NJYA 1FRXA 2XBPA 1K8AT 2YQ1A 1S76D 4U7UD 2GHPA 2UUTA 3HZGA 2F4VF 4X4NA 2QT7A 5J2NA 4F04B 1UAWA 3PO5A 3NWGA 1S7HA 2OPSB 2CWKA 4JP8A 4C11B 4X4PA 5CYMA 3HHLC 2EK1A 5GVQA 3Q8RB 5A6PA 3MECB 3MOJB 1SJFA 2G2YA 1ZTTA 4I7FA 2EEYA 2H51B 4FYWB 2RDJA 2OLWA 3DI6B 1KS2A 4M5IA 5FLXY 3MPDA 4RPFA 4QYRA 4ZLJA 1GMWD 1RLCL 2KB2A 2A10A 3M2UA 5LSLA 2W7OA 1HWKA 5A6WA 4IFVB 5GADI 2Y1JA 4OYWA 3KK2A 1EQ0A 4U7UK 2Q79A 4F02A 4ECRA 1B0TA 2FQQB 3B4MA 4FVCA 3IG1A 1NHKL 1S6QB 1Q53A 2MHNA 1LWFA 3AJ1A 3CD7A 3TEHB 2V5HG 1OWXA 1LOUA 4L6V3 2F40A 4CO3A 3O3LA 3UWTA 3IBCB 3BSOA 4GRSA 1T95A 2O5DA 1WC5A 4X4UA 1O8BA 3MMBA 2W4CA 4KIAA 4IR1A 1LW0B 1HR0F 4CM2A 3TI0A 2CQCA 1S9FA 2OFGX 5DLGA 1UZHA 4NLDA 1U8SA 1PC4A 5CAAA 1YI2S 1T3NA 4FXDA 3OTDA 2DCUB 4IG0A 3FSYA 1VOMA 3OXGA 4NA2A 2MKHA 2CPZA 5A8WA 2HBZB 3UCZP 4M94A 2HGMA 1HI8A 1X4CA 2YWFA 4XK8C 2AYEA 4GMKA 4Z2XA 2PFDA 3MEKA 3MR7A 4K4VA 2ZUGA 3H98A 1YHQS 1R0AA 1EARA 3M6XA 2IRYA 2ZDOA 3E01A 1T7PA 3PJ9A 1RT5A 2ILZA 5GAEU 5D77A 4DV5J 3LWLA 4ZLNA 2XLJA 5K5MA 4PCQA 3Q24A 4DQIA 3KG0A 3I0RA 3I5CA 4N8NA 4WFYA 2ALYB 5I4MA 1RU1A 2HHHJ 3I82A 2BJ7A 1JXVA 4Q5VA 2ADCA 4B9SA 3S1TA 1RWPB 1EJ7L 1EKSA 3P5TL 1IKWA 2Z2ZA 3DLGB 4I2QA 2VJVA 4PPZA 1ZPWX 1VQSA 2DHHA 4ZCIA 2MY8A 4DN9A 5EGYA 4DR1F 4ZN1A 3J7YI 3CCUS 4OZ5A 2DRDA 2PGCA 4KFBB 1NUEA 1JIHA 1HR0J 1VMBA 1HBUB 1VIOA 4V19X 4USWA 2QIFA 2YH1A 1UPMB 3QWPA 4DQQA 1RTJB 4C48A 4F8RA 4OLOA 3EGWB 2BXJA 1D09B 2GX8A 2VG5B 4AXIA 5B0DA 3KK1A 4ITSA 5IWAJ 2LU1A 3ZZUA 4I4BA 4CH7A 3CCLS 3VAJA 3DN9A 3GU0A 3IBFB 1H3DA 2NXEA 1HNXJ 4OYIA 2W9BB 1Q0NA 1REVA 1UZDA 3CE8A 4Y2CA 2EFPA 3DGVA 2B8PA 4EBCA 1YBTA 2M52A 3CO0P 3FBEA 1U0HA 2ZM6F 4JI0J 1SC6A 5KG1A 2B56A 1WF0A 2DXFA 2M0GB 2ZWPA 4DV6F 4K8RA 3J7Z5 3QJPA 4LSLB 1C0UB 4CYUA 4DU8A 1C2PA 3FVYA 2AGPA 2NXUA 1WJ9A 5KFGA 1IBCB 1WI8A 2OPSA 4OI3A 1IBMF 2XSJB 3Q89A 5DDOC 1KQSR 1FNMA 3VGUA 4F4YA 4DR5J 4ZPCA 3FCVA 1JMTA 3NBPB 4QR1A 4FNHA 5HL7Q 2XMJA 1F5AA 1TUWA 1U2RA 5ETQA 2VF3A 4C4WA 3N4WA 4DV7F 2YNHA 2WHOA 2MZ1A 2FZKB 4AL6A 4DV3J 2F3JA 3NAHA 1N8RT 1HWLA 4ECXA 1IKWB 3UD3P 5KT7A 5C5JA 4J9LA 3CC4S 4B3TF 3LP1A 3MZIA 5H9EK 4AFFA 2W9AA 3M2RA 2CA9A 2ZC4A 1VCTA 4FBUA 2HNYA 2D9OA 1RTHA 1RP5A 3G86A 4ANDA 7FDRA 3MR2A 3QT5A 3IN5A 1CQNA 1RADB 4NMLA 2W9CA 3W63A 2OD6A 3TAMA 4D3GA 2PE8A 3NCPA 2CQ3A 2F7VA 1S6PB 5KFQA 2GO8A 5T7LA 1YLXA 2HNZB 3J80U 2VG5A 5HMWA 1S99A 2JDJA 3KK1B 4WF9Q 1C0TA 1FESA 2B9XA 1GAOA 2OHDA 3R97A 2Y0SD 4YP3A 2BW7A 2AU0A 1N5YA 2AEMA 2YXLA 5EX3A 4ZVOB 2AV5A 4ZVQB 3L95X 1QSSA 4CZCA 3EMTA 2VKRA 2MYFA 5DDPC 4JI7F 1IKYA 1T9XA 1TL1A 1O5JA 2FD2A 1X0FA 2JVRA 2DJWA 2G0IA 1RT1A 4HL9A 3S6EA 3VF0B 1LWEA 4F36A 3OW2R 4NCAA 5F3TA 2MKYA 1UL3A 3KLVA 3D28A 1SKSA 3T5JA 2AT1B 2AX0A 2L3MA 3BGRA 5ETOA 4PQAA 5AE2A 3QO9B 2C2EA 2PFFB 2K3IA 2W2NP 3QJLA 4PKDB 3NS5A 3CD5A 1RJJA 2BJ3A 4WFNQ 4IH5A 1BQXA 2P9EA 3W8GA 5A0YB 1FKPB 3D2WA 3LP0A 3PJWA 1Y4ZB 1RWWB 2PC6A 1P6TA 1PG5B 1ULRA 4P10A 4E8UA 2QL9B 5BYRA 3BKFA 2R2UA 2CQHA 5LMUJ 1VBZA 3I9V9 4L72B 5F0UA 3U1NA 1N5TA 3Q8UA 3QSIA 2FJDB 1YK9A 2OUGA 4MH8A 3BDPA 3IWNC 1Q8IA 1FWKA 1U8WA 2RIJA 4NYPA 1N36J 4OZ0A 1XQIA 1Y00A 4GVBB 2YNIA 4P2SA 3WC0A 3KLFA 2IDLA 1VBXA 3D6HB 1LQ9A 2YNGB 3KUHA 3M30B 1EETA 3DFEA 3EXCX 1F2GA 1N5SA 4CT8A 1PAEX 1FTCA 2EXUA 3ZXWA 2VQEJ 4MK9A 2BJ9A 4UUXA 1LWCA 4DHVA 1JLFB 1RAHB 2RKIA 5KFWA 4P73A 4PWDB 4OYOA 3V6KA 2VG7B 4NEZA 1QAXA 1R8AA 3DMJB 5DG9A 1R89A 3LPEA 2O1PA 4P71A 2GMLA 2VUGA 3LANA 1KFDA 4NPOA 4JI0F 3TJ9A 3W2WA 1RKJA 1SC1B 2KG1A 1AROP 4CT9A 1XMOJ 2N7CA 2DGOA 4DMZA 4I2PB 2ZKTA 5C2CA 1OS5A 3M8PA 1GXUA 3GIIA 2DYAA 3QPIA 3H25A 3Q22A 2QLWA 1HWUA 2JSXA 4NLOA 2VPXB 4RW6B 4X62J 3Q0AA 1DTQB 3QIPB 5J1EA 1HMVA 2QTWA 3HFVA 1BD6A 1VQMS 3LF0A 1W26A 2ZZMA 2JNJA 3OFEA 4U96A 4ZK7M 4ZLPA 1K9MT 3LP1B 5CCMA 5HN0A 3VGTA 1V5IB 4QU6A 2BRLA 1X60A 2H5JB 1TL7B 3FFIB 4HHJA 1UKUA 5AXKA 3G87A 1VQPS 2R7SA 1JJCB 1SKRA 2C2OB 3GYXB 5D0RA 1RWOB 3H20A 4FS2A 2WVFA 2KFNA 4ZP9A 4ED8A 1G6BA 1NSAA 4LF9F 1UVLA 3BS9A 2K7JA 3V4IB 1X9SA 5B0CA 2E9TA 2IBKA 4C2MA 2CJKA 4HEA9 3BDEA 4TQRA 1CJVB 1N5YB 4ILRA 2I1RA 1RWUA 2IJRA 5FJ4A 1RWMB 1TMJA 3NS6A 2CPDA 1C0UA 2VASA 3G2XA 4F2RA 4DEZA 1UVNA 3CXCR 4RJVA 2FLNA 2UUCJ 3GSDA 1U4BA 2B9EA 2CPFA 3CT9A 3JS9A 4USMA 3T19A 1XNRF 4K0KF 2NXJA 4KB7A 5C24B 1WOPA 5HMYA 5GAGI 2FVRA 2J9CA 4W4MA 2ZNZA 2IFXA 2ZKUA 4ZCMA 1MMLA 2YH0A 3K5LA 5HVHA 1FD2A 2CZ4A 4L75A 4DU7A 3R2CJ 3AOAA 4ZCKA 4M8LA 1H38A 2QEXS 5G0RA 1BQNA 4IKAA 4L76A 4HH0A 1UVIA 4WFZA 2I38A 3HI9A 3MHYA 1Z2LA 4GVLA 4H4KA 1R0BG 4ANCA 5M2PA 4DUZF 4LFAF 4UY8T 2FGOA 2WOMA 1RHMB 1G3OA 3PJXA 2Q66A 4KV8B 3RZAA 1N6QA 3K5NA 4IOAQ 4R5PA 4QYZJ 1UVKA 3KKFA 5J1NA 1QY7A 1S6PA 4Q2MA 4KBIA 4ECSA 2HNZA 2YX1A 3R6GB 3A12A 3M8YA 4EU0A 5SZTA 3CMAS 3PFOA 1N33J 2QO3A 3H5SA 3SI8A 3GIKA 1NU4A 4X84A 1I94F 1UCNA 1U0HB 1VLOA 2BDPA 1X4FA 2WK4A 5IM0B 3U1MA 2GV1A 2ZH8A 1JJ2R 2EPIA 1D0EA 2HSEB 2KHCA 2DB1A 1FTRA 2YWKA 2KJWA 2RKIB 1ZBTA 3KLHB 2E44A 4QU7A 1CJVA 1VC6A 1TKTA 1NZAA 3SCJE 1PBAA 1HBNA 2VH7A 2OEMA 5ETTA 3K5OA 5M2RA 1G2EA 3BKUA 2IYIA 2UUWA 3TP2A 2OPQB 2SXLA 2LLZA 1ZYQA 2UUAJ 1K0VA 3AAWB 5EHHA 1UJ6A 2GMJA 1B70B 2DXEA 4ZJLA 5A2QU 1XNQF 4RNHA 1UWBB 5ETKA 1Q95G 4ZA1A 9RUBA 2MLYA 1T11A 3MPUB 4FKYA 2RQCA 4EWTA 4O23A 4UTGA 4MIWA 1JKHB 2HZAA 5KT5A 3R7SB 2L9DA 3FCWA 1HNVA 4I1TA 3AA8A 1HMVB 4K4XA 3QAUA 2GNKA 5E33A 1NEEA 2AJ0A 1S9GA 2CADA 1BXNA 3LP2A 2CQ1A 4PG4A 5D6GA 3Q2TC 4ID5B 3VAGA 3NAIA 2E1PA 4EBDA 4TYAA 1VQ8S 2WOMB 2WW4A 4DN0A 2HW3A 1HBOB 1PIEA 3ULHA 5ETMA 2UXDF 5F8JA 1QSYA 2VHGA 1KHWA 4DR3F 2C28A 4JI4J 1SB6A 3CD0A 1FK9B 1NRKA 4RW8A 1MSWD 4CLZA 4QW9A 1P1TA 1JLFA 4WCEQ 2AW0A 2XNRA 1NM2A 8AT1B 1HNXF 4MFBB 2CNLB 2C2RA 2RSQA 4KQZA 3D66A 4ECYA 2J0SD 2HS4A 1FX4A 3V6DA 3EZ5A 1FDBA 2DT9A 5JVHQ 4DR7F 1Q82T 2V0NA 2M2BA 4ZKAA 2HG4A 2I5JA 1FJEB 1Y5NB 3A3PB 4DPOA 2HQ3A 3R7BB 4NOHA 1FRKA 5FIIA 1M5SA 4YS2A 1GT8A 6FD1A 5C42B 4EYIB 4DUTA 1I3OB 2AJQA 4DZDA 1ZAXA 3NWRA 3ADAC 3MEGB 2ZD1B 3QT6A 3QRRA 2GVDB 4J9NA 2CVEA 2XMMA 3LP0B 2EFQA 3K5MA 4F4XA 3MOZA 3WBZA 4OJ3A 5DGBA 1AZSA 3GCWP 2FJEB 4GO5X 5F9NA 5LXRA 1U1LA 4HYKA 5C25A 1M90T 5DQGA 1TELA 1IKXA 2R2SA 3Q23A 1X7VA 3CW2C 4PABA 3TJ8A 2ZH7A 3X3UA 3FQLA 2KG0A 2ATLA 2AF6A 1KBRA 4K4TA 3IR6B 3LGHA 2R3VA 2W2QP 4DFKA 3MMJA 4U8VA 1F5CA 1WSRA 1EETB 1ZZFA 2VDHA 3G8SA 3VVTA 1UVJA 1V3RA 1RTJA 2AJ2A 3NS7B 4FYXB 1RAGB 3POTB 5HSPA 4CCHA 1AFIA 2EG2A 1RACB 3HT0A 3SSSA 2DY9A 3WIUA 4WK3A 1KOOA 3CF5Q 2D41A 2Q6CA 2MZTA 3NG8A 3D3BJ 5KFLA 5KFHA 1V6HA 2V9KA 1KQFB 4GC6A 1ZTWA 3EDRB 4I69A 1XNRJ 4RBVA 4DR7J 4LIRA 3WZ0A 3M8QB 4WKRA 3VQTA 1CQMA 2UVRA 3H90A 3M8SA 2P2CB 3DRRA 1NAQA 1Q16B 3OR1A 3HJFA 3TUPA 5KOWA 2ACYA 2HKEA 1KONA 1WOOA 3CDBA 3CB4A 2DCLA 2HPUA 1RAOA 4LSLA 4CYUB 2H9ZA 3CCSS 1ZZNA 1U1QA 1JLQB 1T0TV 1OIAA 4LRBA 1KFSA 2A2CA 3LO3A 2HZVA 1GMWA 2XWYA 4ZJOA 2FZGB 2BZ2A 3J7A1 2MKJA 1H73A 1X4DA 3IRXB 2YWWA 2ZJQQ 3H59A 3BSCA 1HNIA 2DEIA 2HFOA 3C8YA 4M5KA 4TY8A 4ECQA 4DSLA 5DQIA 3SZ2A 4Z7YA 2XGQA 3F0NA 3T41A 1VFJA 3UPFA 2VBWA 3NGTA 3I55S 1UFLA 4DS4A 1WUUA 4RR5A 2YBVA 2R42A 1HL6A 2ZH5A 2DPJA 5L1KA 1HQ2A 3WIVA 3BQ1A 4F4ZA 2Y8WA 7FD1A 1RWVB 2EBGA 2XCPA 3V5RA 3DRPB 3T1YJ 2QZ8A 5IV4A 2B9WA 1HHSA 4LF2A 4DSEA 1VJQA 4LF9J 3ZZTA 3GWCA 1KQGB 5I3PA 3MDFA 4URQU 4DR6F 5LJ5Y 2DH9A 2W8KA 5LOQA 2AJFE 3FDSA 3QAEA 3RG6A 4Q0BB 3KWMA 4ZITA 4ED5A 3GONA 5E3PA 2XMAA 4Y2IA 3C16A 1Q7LB 5L9XA 1XJWB 2I2YA 2B5JB 1FT8A 3LW5C 3Q2SC 3IAS9 2ROEA 1I1GA 3DLBA 1EAYC 2VPZB 1RT5B 4L3NA 3MECA 4QIGA 4WE1B 4XAKA 2PEBA 1FRJA 1P27B 1YJTA 3ZC4A 4CM0A 1YTYA 4K2JA 3SCIE 2UVWA 3MM5A 3IGVA 4M5HA 2RHSB 3UE2A 5LMNJ 3C19A 5FLXU 1FKAF 1UEKA 3EJMA 4YDXA 4W92B 5J2NB 3MM8B 2GVZB 4AYBD 8ATCB 1M1HA 5LT5A 4B3SJ 3X1LB 3MAAA 1L3SA 2XS7A 3L4BC 3ZZ0A 2G4BA 4X4VA 3IRXA 2PA8D 3DLGA 5C7PA 1NK4A 1R43A 1WC6A 1DJ0A 5EWFA 1FWLA 3PKYA 4GKKF 2QL5B 1PYTA 1ZAWA 1X0PA 1YRXA 1RT4A 4MK8A 3PR5B 2OP5A 4BC9A 3OFHA 4B3SF 2IHR1 4P52A 3SSRA 3BB5A 4DPUA 1Q81T 4HHUA 3M32A 1F5BA 2J0XA 4ZVUB 2YWEA 4ZS6A 1LK5A 3TRGA 2JC1A 2JWNA 3C6UB 3HFKA 1IBMJ 2JH3A 2DO4A 3HULA 3DRPA 4HH1A 1TKZA 5KFUA 2JEGA 2IM2A 4B9VA 2MZJA 1CJKB 2BANB 2Y1LB 5HLFA 4FF4A 1CPZA 1MU2B 2FY1A 3SFUA 3Q8SB 3WHIA 1K1QA 2VFVA 4YEAA 5F8MA 4F2SA 1TAUA 1G7CB 1DY3A 1NSKL 4I68A 4OX7A 5CD4H 2MQLA 3IR7B 2IAJA 4RO0A 1I51B 2RUGA 2ZE2A 3VALA 4PWDA 2Q6BA 1HW8A 3CCTA 4PEOA 3FSIA 4A8FA 3T9NA 4B3TJ 2AD9A 1QUVA 2V63A 2WB4A 4HTJA 4A47A 2XSJA 4A8XA 4LF5F 1PILA 1D9DA 1WKJA 3QATA 2V2VA 3HMJG 2CJ9A 5C2GA 4DJBA 3JSYA 1WC1A 3M6WA 3U7JA 4M5NA 4CO1A 5MAOA 1NJZA 3RAQA 4M5JA 3G96A 1VBYA 1A0OB 1HI1A 1U7LA 4IH6A 2D69A 2BBEA 2DR6A 2IJFA 3M6UA 5K8PA 3CWJA 3MPVA 4ELUA 2LQJA 5KFRA 5ETPA 2VB6A 1YJVA 1CS4B 4DV0J 1RYSA 4WP9A 1FEHA 4JI7J 1UVMA 3HF5A 3MR6A 3CCJS 2JEIA 3V81A 4YR3A 1JJHA 2AGQA 2N3OA 3P5BP 5DS7A 3J81U 2KRRA 2MPUA 4YR2A 2E9ZA 4PR6A 5J2QA 1OYEA 4XDCA 1C1CA 2E9RX 3DLKA 1O6XA 3BEGB 1VYAA 3BBFA 4WP8A 5D0HA 2HAIA 4ZVFA 3DXBA 3SMZA 2BV3A 5KAKA 2UXBF 3RJMB 2C3MA 3P45B 1KN6A 1CJKA 2BANA 1TZ0A 5HLFB 4OHYA 3TYTA 1UFKA 4EZ9A 1BHNA 2CQ4A 3HD1A 4I67A 2F1FA 3R1HA 3N6NA 1GTHA 2XYHB 3C16B 3MCSA 1PYOB 3RBXA 2W4PA 2D7SA 4DI6A 4DX5A 2PMWA 3D5MA 3LA0A 1F3FA 3OUYA 2FLLA 1SJRA 3OXFA 1WF1A 3BV8A 3SYZA 4IRCA 3D3CJ 4CP5A 1V3SA 1FD8A 5CH7B 2EI5A 3OV7A 3KYLA 3LTOA 3TEGA 2W24A 3W2WB 2ZHAA 3DXSX 4OX8A 4LSNA 3TO8A 4DV3F 4WJBA 1RBLA 3MM7A 4NLXA 1ICEB 3SV3A 1SVDA 4EFAC 3G82B 3A1YG 1U1NA 2YKMA 3K2YA 2WBRA 1V9OA 1E6VB 1SJ3P 1VGYA 3P3DA 4LJMA 2I9SA 2NSBA 3JYTB 1VQ6S 4F0HA 1EX8A 3R5DA 3IGNA 2O66A 4QR0A 3S7RA 5G0RB 2DGUA 3M6VA 4K4YA 3DOLB 4KKOB 4CDIA 3F41A 4TYBA 2W4DA 1OQ6A 4Y00A 1J27A 3EXYA 1TL7A 2CQPA 3FFIA 2XO7A 2WTFA 3ZFVA 3W1YC 4QWDA 3K59A 4A8MP 1VC0A 2RS8A 1C0TB 2MQMA 3QWUA 4WZQA 1KWMA 2HFZA 3EZUA 3MD3A 1SUQA 2IYGA 3TUZC 4DSFA 4FYYB 5HBMA 1QM9A 1MU2A 2U1AA 3D67A 2CPXA 3DRYA 3QYYA 5AXNA 4KHPJ 2XMVA 3PNIA 1RI7A 4Q45A 3I56S 3EX7B 3VAIA 4OL8A 1ZH5A 3FBFA 2HFNA 4EYHB 5KFSA 1YBUA 3Q8PB 1TFYA 2L9NA 3AD7C 4LUBA 5L39A 3MM6A 3NOCA 5L1LA 2R8HA 3OUYB 2OEKA 3JB9k 5CYMB 5HROB 2MKSA 3OBIA 4P2MA 4DL5A 2MB0B 1UPPA 3VHQA 4WFAQ 2G2OA 1NKCA 4IRDA 4I7FB 3M9OB 1RCOB 3PR4A 1Y5LB 1DQ9A 2VFTA 3OLBA 1FEEA 1VLYA 3HPOA 2V8GA 4Q7AA 4YB5A 4RW6A 3ZTRA 5HI7A 1DBDA 3QMQA 2KI2A 1IKVA 4N8OA 2VIHA 1OY8A 2QA1A 2RQMA 1YRUA 4BWJA 3TAQA 1F3VA 2VONA 5AXLA 4HLBA 1XNQJ 3BYPA 4KGKA 5H9FJ 3ENWA 1N52B 1R6VA 3UVJA 2GMHA 3NY0A 3JQJA 5LXYA 1PC5A 4HR2A 1SIZA 2FDNA 1FKOB 4KYZA 4PXBA 1NB7A 1HFEL 3BR8A 1V3ZA 2KYXA 3LP2B 3KJVB 4OI0A 2Y8YA 4TLQA 3HD2A 4PG5A 2ZITA 1HBMA 4QJVA 2VBZA 5F8NA 2VD3A 3MMAA 4ZOSA 3MD1A 2IMOA 3RRHA 1Q4RA 4DR5F 1HHTP 4R0EA 3FC9A 2FZCB 1S6UA 2VOPA 1S1XA 2JLGA 3DMJA 5H1SV 1WG4A 3H2VE 2FHMA 2VG6B 4KE5A 3DOKB 4O44A 4OZ1A 2OPPB 3ZZRA 5A76A 2NR0A 1HBNB 2XMTA 4MJKA 2KH9A 2R7XA 4B3OA 2MQOA 3MM9A 2AX1A 2XC9A 2KYZA 4QWAA 1T03A 5AXMA 2OTJS 2MZRA 4DFPA 3IMQJ 3HVTA 1A9NB 1H2TZ 4JI5J 2UUCF 2B6AA 1PJ6A 1WSVA 3EGNA 4DV0F 1TTHB 5FDLB 3D54A 3R9LA 1RTDB 5CZVA 4LF4J 2ILYA 1WF2A 1S57A 1Q5YA 2XLIA 2GAGC 1FXLA 1ROFA 2C2KB 1LFWA 4LSZB 2GVDA 1VK3A 3LWMA 2HAFA 1SBRA 3TA0A 2V68A 4FKXA 1CJTB 3QIDA 4NI2A 2QA4G 3GJQB 3W5YA 4V19J 3ISZA 2APOA 1CC8A 1JLEB 2V8DA 3TW0A 4XIUA 3OR2B 2ZH6A 2U2FA 5KFEA 3OTOF 2C42A 2YQ3A 2QMWA 4UOFA 2WZ1A 2HHVA 1YKWA 3GFHA 3FRZA 3TQEA 1KLNA 4K5RA 1XEZA 2OAUA 4P6QA 3CJ8A 1HWIA 4LF1A 1FK9A 2LKZA 1G4CA 1TKXA 1U6ZA 1VBKA 2BE2B 3CJ5A 3EM1A 2FVCA 1S59A 3ITHB 3BN4A 3CC2S 3GZ7A 2KDOA 5KG2A 2WRMA 2DR9A 2L08A 2ZBRA 2E5JA 1R0CB 1J5OA 4Z37A 3ENAA 2VG6A 2X1BA 3CPWR 1H0HB 1OQ3A 3VGSA 4H4MB 3SDEA 1VS3A 2F4FA 4LF4F 1FE0A 5AE1A 2DGSA 2ZOGA 3DLEA 1T9UA 1JLQA 1ZOTA 5CYQA 1WNEA 3PV8A 1QUPA 3HSGA 5HK4A 2VV5A 4L74A 4MKBA 4JV5J 1N32F 2UXDJ 2MGZB 4J7CA 2VQFF 4OZNA 4BBYA 1IKVB 2J9EA 2K7KA 2X1AA 3V6HA 2GZOA 2NUHA 1WG1A 2BJ8A 3NCRA 4RNNA 4DF4A 2RD5C 4J9OA 4PG7A 4C0HA 2HLUA 4PQUA 3TUIC 2KVIA 1HBUA 3R3TA 2IDEA 1X31C 1Q5VA 1HKAA 2XEXA 4YB7A 1HNWJ 3DLLQ 4DF8A 1SKUB 2QLBB 2AMCB 9ATCB 2R7RA 1VQLS 4BHQA 1NDPA 3SSQA 1VRTB 3EGVA 3HVAA 2KXNB 2XNQA 3GJRB 3DLHA 4JI2J 1SJ4P 1WC0A 4CRJA 3C6TA 3L7OA 2R7OA 4K5SA 5J2PA 4O3QA 5BYSA 3VAHA 4EGLA 1J5EJ 3WX4A 1WORA 3HLUA 2B0GA 4WFBQ 2UUAF 4FXWA 5L38A 1QVGR 4QOTA 3W7BA 4FXVA 3T5KA 1VQNS 1PKUA 2E5HA 2GHWA 1WEYA 3OQ2A 3W5ZA 4CLYA 1S10A 2YKNB 3KJNB 1T02A 4F0KA 1J5EF 1F9HA 2CRLA 2IPOB 3I5BA 4P2FA 2B9YA 1FE4A 2BOAA 4CI0B 4I6WA 5DZ7A 2FIUA 2V34A 4DPTA 4I2QB 4KC5A 1NSPA 2ATCB 3UDVA 2BW2A 4DSIA 2QLFB 1PCAA 4OYMA 3BM7A 4NZ7A 5D0EA 4RUCA 5DG7A 2W2PP 2KM8C 3M9NB 1WTFA 1B0VA 3OVAA 5IFMA 2B7BB 1IKXB 1LNQA 1UEUA 2K1RB 2KN4A 2KT3A 2RU9A 2WONA 2VKZG 1NKEA 1PO6A 4KSEB 3MXHP 1MLAA 4B3MJ 1HBOA 4LVOP 3S01A 4X62F 1M1KT 2CPEA 5BJRA 3QZ7A 4OHVA 5HJXA 3A8IA 4G1PA 4WIIA 2HZCA 2KHDA 4KGXB 2PD1A 3N5FA 2WVCA 3AD8C 3QGHA 5GMEA 3MMAB 3RBZA 2ZFHA 1OO0B 2A0FB 3BR9A 3OL9A 1J2VA 2MQ8A 1YJWS 3PRVA 2R8JA 1QVFR 3QT7A 3LH2S 2ZJRQ 2VICA 1DLOA 1NH7A 3HHLD 3QBCA 3JSMA 2CJYB 1S1TA 4HDHA 4PYDA 3UDEA 4JV2A 3RW6A 3L7UA 3ITHA 1UMJA 1SL0A 3CCRS 4DV7J 4F3QA 2ZEJA 4RUBA 5LL6d 3IS9A 1HNZF 3MM9B 2ZE2B 4CWBA 4OFZA 3D68A 4M63A 4PPDA 3QO9A 1Q7YT 1FVQA 2BE7D 4X66F 2IM1A 2CJBA 1DQAA 4NA1A 4NXNF 1BUXA 5JJBA 2BOPA 4EO6A 2ZVSA 4OJGA 4O3NA 2JLFA 1KNZA 3LAKA 3PCOB 4PG6A 4Y65A 4OZ2A 4NLRA 5DM6Q 1TV6B 3V6JA 4WXWA 2J6UA 1TL4A 3BBCA 3I31A 4RL1A 3G8QA 3UI3A 3D1QA 1N88A 4ZPAA 3O2IA 4NE9C 4UT4A 2OMLA 2V69A 2VZ9A 1RT7A 4CLKA 2W9CB 4NYOA 1NMEB 4AQYJ 1FKOA 1U1MA 4ECZA 3NMRA 1UWAA 1VRQC 1P9YA 1Y11A 3EVMA 3M4XA 3WDOA 4OYXA 4PAAA 4ZJQA 1NXIA 1O0PA 2V8VA 4ZHRA 4RZRA 3NRBA 4FF1A 3CJ3A 4IR9A 4ERDA 3PX6A 2DGTA 2LECA 2X1GA 5KT6A 3VAFA 2HVDA 2CKWA 4QBUA 4DV6J 1IBLJ 4CLUA 5HAOA 3AJ2A 2FB0A 4DOZA 2ZM6J 1QTNB 2AJ1A 2K06A 5KFJA 4USIA 4RNOA 3M9MB 5HP1B 1LWEB 1YQHA 4X2BA 2KXFA 5HJYA 2ZOMA 4JI6J 4B3OB 1A6LA 1JLGB 3FZBA 1AXQA 3PEHA 4RW4B 4PRFA 4NXNJ 1CG2A 3KNGA 3SXLA 4OLPA 2HVIA 1RBAA 2WCXA 3ILOA 5CQGA 1RWKB 3IS9B 1GX6A 2YKNA 2WVBA 1S77D 3N79A 3HO1A 1DARA 3I9ZA 5A8RA 4A8YA 1FJGF 2W25A 2I8EA 3HHLB 4CH0S 2FC9A 2EC2A 3OLAA 3D7SB 1B3TA 4IG3A 4Q2LA 5E3RA 3CJSA 3PYGA 3OL8A 1Y7PA 2DIUA 3DDNA 3GIRA 1VJWA 3RRGA 4DG1A 4HVZA 2XHWA 2B7CB 5KFMA 1RA6A 2LQ9A 2RRNA 3PHEA 3GV7B 1TAQA 1HNVB 4RNFA 3DRXA 1FWPA 4DBQA 4U95A 1D8ZA 1MROA 3AT1B 2RMLA 1NPKA 1XR5A 3HXMA 3GCXP 2P9CA 4DUYF 3NNCA 4KKOA 5F8GA 1AW0A 4ZVEA 3FEXB 3I87A 4CNYA 1H6KX 4MYTA 1IM4A 1FFSB 2HRTA 2X3GA 3KLIA 5E3QA 5J2QB 4LF6F 3KLGB 3MWBA 3ISNC 4OYAA 4L73A 3NP5A 2R8IA 4W98A 3RTVA 1P1LA 1TQLA 5B0AA 2AGOA 2C3OA 1D9FA 1M5KC 3OFGA 2EFGA 2GFFA 3A8EA 1L3VA 2B5JA 3K5PA 4ECWA 1UFWA 3AQPA 3BF4A 1IJEB 4QW8A 2H65B 4TU7A 3LOUA 3SCLE 2JJ4D 4L3KA 1OY9A 2EG1A 2VC0A 4USVA 2JEFA 4LREA 1YJNS 4OJ1A 4RUHA 4OI2A 2W1BA 4N5SA 3IRWP 2V4RA 1D3WA 2B43A 2RRBA 1NSQA 1MWYA 1XC9A 1HNZJ 5D3GA 1WC4A 2N3LA 3RAXA 4OYZA 2XS2A 2YNFB 3IWXA 2ZC3A 2OPRB 2VFRA 3BSNA 1AT1B 5GMDA 2CPHA 1TL3B 2VOOA 2E1CA 4O4GB 1SJQA 3W9IA 5KFFA 2PI4A 3NXZA 2E5LF 4OMFG 3FRYA 3VTIA 2PI5A 3BBBA 4B08A 2DRBA 1WWHA 1TK0A 1QAJA 3V81B 4HHHA 5D15A 2DNYA 4FS1A 4GO7X 4CLLA 4ZHRB 5K8OA 2LA4A 2IVMA 2P6SA 3KHGA 3PZPA 4JI3J 3C3LA 4MIAA 2J76E 3FGVA 1HPZA 1WDDA 2RF2B 3TAMB 2CDRB 3KJVA 1KKHA 1T9YA 2EW9A 5LSOA 3HVRA 4OIXA 2PT0A 2LQ8A 3PKMA 2UV8A 2VA3A 2Z56B 5I3QA 2HMIA 1RZMA 3AA9A 1FA0A 2IRXA 4P7TA 2JVOA 2V2ZA 3PVXA 2IMWP 1EHWA 3TA2A 3RRKA 5IZHA 2PEHA 3E8OA 4LR7A 3F56A 1FJ7A 2OPPA 1PJ5A 1HYSA 1AFJA 4EEYA 5KG0A 2CZ9A 2BKOA 3UCUP 1GK8A 1RT2B 4JI8F 4LMZA 3NLCA 1RE1B 5KFIA 3LUYA 4DFJA 4ED3A 1FHTA 1L3UA 2GJIA 1T9WA 4I6YA 5HO4A 1NKBA 2YNHB 3JTPA 3CC7S 3CDUA 3UN3A 2N4CA 2YNFA 3JYTA 1HNIB 1CS4A 1CVJA 1RA7A 4P9SA 2KVQE 4WXOA 1WTBA 1EQMA 1C4AA 1YG0A 3I6PA 2BA9A 3OT9A 5LM7E 3W61A 2EVZA 1D9AA 2DNLA 2O67A 3JQMA 4G1QB 3D4JA 4TN2A 5U47A 3VVUA 1X5PA 2D9PA 5KT3A 1N34J 2HGNA 2X1FA 4K7QA 1RT6A 3MMCA 1N5VA 1S0MA 2Z58B 1F60B 4ZPTR 1UJ4A 3PFEA 1FFGB 4LQ9A 3JAMY 3QFHA 3TQ1A 2UXCF 5HATA 4DL4A 2M70A 5SUHA 3W66A 2YKOA 1H98A 1REVB 1IWAA 1PYSB 1VRUB 1SQFA 2B4VA 2RF2A 4ZCLA 1U24A 2FJXA 1L3KA 4PYAA 3CJKA 1VHIA 1YZ6A 2XCAA 2RB7A 1S48A 3MF5A 4JB8B 4USHA 4ED1A 2FGCA 2R2TA 2DRAA 3N5BA 2VJUA 5EUHA 3GFXA 2V8HA 1TL1B 2J6SA 2AKWB 3V4MA 4ENOA 3DDIA 3MUMP 2DNRA 3AB4B 1MMDA 3AOBA 3NBPA 2VFUA 2E7XA 3EPIA 1PAUB 2IC3B 2EKNA 5IC6B 2AYGA 3SDEB 2NS1B 5T14A 2HBRB 4DQRA 2MTLA 1TUGB 4G1IA 4H54A 3MR3A 3QLHB 1RT3B 2CNOB 2DK2A 4C8NA 4F4AA 3CJQA 4ZPDA 3B54A 4QPXA 2RT3A 1U45A 1NDKA 3BO4A 2GJ2A 2UV8G 2VQEF 4M95A 4C0BA 2MJUA 1U1OA 1JX4A 2FYXA 1YRTA 1N33F 2A3JA 2NYHA 1NPRA 2MSSA 5EX0A 3A3OB 4DR1J 3PW5A 1OMSA 4XTTA 5IS2A 3SQOP 3H4BA 1MN9A 4EBEA 4DXLA 3H4DA 1M0SA 5KFKA 1R6YA 1VISA 3KLIB 1UW4A 3BH6B 3SQGA 4X4TA 2GQCA 4LIWA 2VPWB 2YNIB 3I0SA 3UQSA 1SL2A 4NYZA 1TR0A 2DNHA 2OMOA 3KUGA 4CLWA 1KD1T 4RBUA 4MKYA 2C3YA 2QSWA 3BO2A 4KH1B 3PW2A 1YGYA 3DHWC 4X4OA 3P96A 2VBXA 3MR5A 2RAQA 4RW7A 4PWUA 2ACMA 5KFVA 4ED7A 3BZQA 1IKYB 2QMUB 3TA1A 4YHHJ 3KK3B 3B82A 3TZWA 2CPIA 2V9WA 3KNAA 5DO2A 3DDKA 1NNDA 4I64A 4QYZK 1O51A 4DV1F 1U1PA 2RILA 3HKZD 5C42A 2CQBA 1QE1A 3GMGA 4O3RA 2ZD1A 2C3PA 4ETZA 2CDQA 2H5EA 5CYQB 4N76A 4GKJF 1FFWB 3OXLA 2V2KA 1KLMB 2AJ4A 3PHTA 1C1BB 3QT8A 2HHXA 5I42B 2H3EB 3BJYA 3QNWB 4DV5F 2FVPA 1T9VA 4K50A 2F65A 1SH3A 1Y3KA 1CJUB 2AZ3A 1H72C 1E6YB 5ETNA 2R8GA 1WEZA 4QPTA 4UUWA 4Q44A 3BQ2A 1HD1A 4LT6A 4BLGA 4URGA 3UN2A 1F9FA 2HQIA 2E5IA 2HFSA 4J37A 1VQOS 4XO0A 5H9FK 2CUYA 2OEJA 2YWGA 2DEJA 3CCQS 3ILIA 4GVBA 5HQ8A 3KLFB 3TAPA 1NJXA 1FNXH 5KT2A 3UD4P 2J6TA 2DNQA 3MMBB 3HK2A 2PDAA 1S1XB 4WKYA 3Q86A 3T6JA 4U8YA 5K14A 2UU9F 3HFZB 2ASLA 1MG7A 3DCAA 3GE9A 5J2MB 4OYPA 2ZBPA 4B9UA 3DM2B 5KG5A 3O44A 2HVHA 2BM0A 5IM0A 3OVSA 2LCWA 3MFIA 3K89A 5DJBA 3T9ZA 3TVYA 5KG3A 3DGPA 3ENVA 1M1GA 1RU2A 3VAKA 4LF8J 5DM7Q 2J0QD 4WZMA 3TNVA 3H5YA 4K4SA 2KL8A 4LRDA 1BWVA 1FXRA 4J9UE 4R8UB 6AT1B 1YBAA 2AZ1A 4DL2A 1DAXA 2BKNA 3AOCA 4BCAA 5F8IA 3M8RA 1UA0A 3MAAB 4NLVA 4Y6IA 4FNIA 3JTOA 4RKUC 1A7GE 1X5SA 3R5JB 4NZ0A 5E2QA 4NWBA 3UO0A 3VGVA 5J1EB 2OD4A 3OTOJ 1S1WA 1N56A 2E7WA 4J9SA 4EI2A 1JLEA 2E1MC 1YWXA 2GJFA 4J90A 3E2EA 4M1KA 3TX8A 3CULA 4OHXA 2DBBA 2X7IA 1S6QA 2JZ5A 3IXQA 1CJUA 1H2UX 5K8NA 2UXCJ 1RT6B 3MMCB 4FP9A 5AJ3J 4FBTA 4IFYA 1B7YB 2FHKA 3AXKA 2FY8A 2E5LJ 1N6QB 4FPIA 4QWEA 4MAKA 4YY3J 2AIRB 4NRTA 3KUEA 2XS5A 2ZBIA 1T9TA 2ERRA 3T5HA 3DHXA 1K44A 1HW9A 1SJ1A 2Q1LA 5KT4A 4JI4F 5KFPA 3G8TA 3CCES 1FRMA 4HACA 1WC3A 1SUQB 2LYVA 1NK9A 4C8OA 2QA2A 4WU3A 2R7WA 4MIBA 3NGDA 4C8MA 2DR8A 2CJQA 4CH1A 4LF8F 4ETXA 5J1PA 1ZPVA 4WYWA 2HS0A 4H4MA 4S0MA 2FLPA 2BVZA 4E2FB 1KVJA 2PSZA 3CMES 3R5GA 2LEPA 1EP4A 4C7QA 2ZZTA 4BC7A 4CTAB 3H2UB 1B64A 3O1LA 4LSNB 2XZWA 4J9KA 3PXGa 2MGZA 5KFZA 2G1HA 2JLEA 3W2VA 1G1XA 1DTQA 2GHVC 3O6QA 2QN6B 3HP6A 2NCKL 2D3OR 2XI2A 1ZAVA 2WSEC 3ZNUA 2J9DE 2F8MA 2DTJA 4OV1A 1C1BA 3JAMU 1VQ4S 1TP7A 1RWNB 1DQ8A 1RISA 2E7VA 3B4DA 1ZM4A 3EZOA 3VV2B 4DG1B 5CD4A 2NZ4A 1CC7A 3HHEA 5K9FA 3W9HA 1KHVA 4G65A 2E5GA 3AHPA 1T3OA 1KP6A 5D4LA 4KO0A 3PRBA 1FJCA 3W64A 2K3KA 1RAAB 1BLUA 1S1VA 1UTAA 2DHXA 2M9KA 3A3NB 3UVJB 1HQUA 4DQSA 2N82B 2RNEA 2MLZA 2Q3PA 3KDOA 2VQFJ 1BGXT 4NLGA 2F63A 3RAMA 4DLEA 2QE5A 3MEDA 1SCJB 2W2OP 4OHZA 4KGMA 2WSFC 3C15B 3U27A 2FTRA 2YTCA 3BKTA 3D6FB 4N41A 2NUUG 2YWHA 5D0GA 4QIVA 1AUDA 3T1HJ 1GEHA 2G2ZA 2RE1A 4CLSA 5BR8J 3KLHA 2ZH2A 4HACB 1WG5A 4IO9Q 2Z8QA 3TX0A 1U09A 4MK7A 4TU9A 4WK1A 2GC8A 1R27B 2LFVA 2QMXA 3G71S 4G3IA 2RQKA 2F5GA 5JMNA 5RUBA 1R7IA 1SV5A 4JUZA 1HHQA 2YPZA 3UCGA 2G13A 5DETA 2OFHX 3KXDA 3OR1B 4P75A 4IDKB 3UW1A 3H5XA 2CG8A 5IQ6A 3TANA 1JLAB 3THTA 1IR0A 1VHFA 3TR5A 3PYEA 5ETVA 1LXJA 4KPYA 2X3DA 4OX9J 4AT1B 5F8HA 4GKKJ 2C2MB 1R3NA 2AEJA 2F8HA 4LRFA 2WW8A 2XMWA 1ZM2A 1S1WB 1JQGA 2WONB 3R5BA 2FVSA 3R27A 2FHOB 3LPYA 1IXKA 4M5GA 3W8PA 3DOLA 4QWBA 4NLPA 1FXDA 4B9NA 2MQPA 2Z2YB 2FLOA 2BKPA 2XYGB 3M2RB 3PW4A 2MKCA 2FVQA 4C8ZA 2IY5B 4YDDB 5GMKa 2R7UA 3KMSA 1MROB 3IBWA 2LEAA 1Y5IB 3JXOA 1NHVA 2ZBQA 1F2HA 2HQGA 3SQGB 4Y0FA 4WU2A 3W60A 2LU2A 4F3OA 4J9QA 4UOHA 4FYDA 5G4DA 3PIPQ 3HZEA 3GQCA 1B4SA 1X5TA 2CYYA 3HSDA 4YN3B 5B0GA 3G4SS 4DL6A 3TJAA 2LDIA 5T7LB 2MQQA 3VAMA 1DLOB 3JSMB 4DX8H 8RUCA 3LALA 5BR8F 3PW0A 1IJFB 5IQQA 2ASJA 4K0KJ 1SC4B 3MEDB 5KFCA 3HCXA 4Y28C 1LEOA 4GC7A 4ATNA 3MGJA 4Q0BA 3TZYA 1ZM3A 1F9EB 4EK2A 1HI0P 3P8BB 4UOCA 2UZAA 5B08A 1EKRA 2LQ5A 2QGFB 4KHRA 3AXMA 3KDNA 3CJTA 4ID8A 3K0JA 2F9JA 1FDDA 4UW2A 3FUYA 1SV5B 2HWTA 3KJQB 4LRCA 5ETRA 5A8RB 1PBUA 5LMNF 1DURA 4LRAA 1EZZB 3DC2A 4IDKA 2PMZD 1RDRA 3QQCD 3VR1A 2CNKB 4Z7CA 2R7VA 2LA6A 1GTEA 4TU8A 3MAQA 1L5UA 5D4PA 2JFKA 1RTDA 2GVZA 1QAYA 2MKKA 3QZ8A 4F4WA 3D6TB 2CQGA 1N54B 2Z4PA 3AODA 1TL3A 4WWSA 4X64F 2CWXA 3DRSB 2KZMA 3QIPA 3ISND 4O4RA 2BRKA 3D0IE 1IBLF 1RHJB 2BM1A 2N7YA 4A46A 3SIPB 1YJUA 3CTRA 4U6PA 1NK5A 4EUVA 1RAEB 2WVEA 4KGVB 4OV6A 3EUNA 2HEKA 3M2VA 2UUBJ 3MEEA 1U48A 5E7OB 2H48B 2KM8B 4J9PA 3EVOA 3KG4A 2KT5A 4H4KC 4NEYA 2NREA 2KO1A 4ELTA 3A8KA 2F4VJ 1X5OA 1GMUA 3FEZA 5L1IA 4TKTA 4TVAB 2IJNA 2OSRA 1TU0B 2XMKA 3P49B 5KG4A 5J2PB 3G9CA 1TKXB 2BE2A 1URRA 2DD8S 2V6AA 2D3O1 1LK7A 1NB2A 1NH8A 1Y0HA 2Z0GA 4TY9A 3HT3A 1RTZA 3AB2B 1JLBA 2KXHA 1UEVA 2MSTA 2QRRA 2ZZNA 1K73T 1B99A 1RHRB 3HVTB 3CUNA 2DVIA 4DR4F 1L3TA 1IVZA 3ETMA 1WD6A 1HYSB 4QZVB 4B3MF 3BGFA 3KOAA 3OVBA 1RT2A 4MKVA 4KAIA 1KQKA 4IH7A 4TY8B 1RWXB 5C24A 1GMVA 2CQ0A 3GILA 2OPRA 2W8LA 1TL5A 2HHHF 3KTQA 4KHPF 3SFGA 1RSCA 2IVYA 4ZN3A 4ZMMA 2ZUAA 1VIXA 5DRKA 3OTEA 4URSA 5C25B 4YQWA 3CO9A 3CVKA 3BSAA 2GS8A 3ICLA 4OX9F 4JYAF 4F3MA 2FPHX 2ROGA 4IFYB 2DIVA 2YPYA 1Q78A 4QIEA 1XMQF 4BDPA 1GNKA 3I5AA 4KHMA 2V67A 3C14A 1TK8A 3M32B 4YY3F 4LR9A 4RU2A 4LFBJ 1RABB 1H7XA 1YZ7A 2BACA 2CZVC 3CGIA 4KV8A 3MFHA 2PO4A 2I6WA 2BR0A 4ZVRB 1VRTA 5KFOA 1C4CA 3NCQA 3AQOA 1OY6A 3CNQP 4C6AA 1X9WA 1RUSA 3GG0A 4JI3F 1MMNA 5HVGA 4YR0A 2DKOB 3DOKA 4O44B 1OYDA 3T5LA 1PJ7A 4WP3A 2DO0A 2QFIA 3NNHA 2P5VA 5F0WA 4ZIWA 4A8KA 3LGMA 1NZ8A 3L7PA 4IOCQ 2QLJB 1D1UA 3B8HA 4PUOB 3CSKA 2KJVA 3ZZYA 2XG8A 2OO4A 5D3GB 3RR8A 4KR0B 3CD6S 3ZTSA 1R8CA 4JBCA 2RHQB 3DLEB 2GGPB 3I4PA 4ZPVR 2EWHA 2RDIA 3LAMA 2A2DA 2QJ3A 3MTKA 4RX6A 4B3RJ 4X4RA 2DNZA 1YVFA 1VQ5S 3THPA 4DL7A 5IOLA 2M8DB 5K8MA 3BGOP 3G82A 3PACA 3GYGA 4WTYA 3LGNA 1RT3A 4AXJA 5ADZA 2BABA 2L41A 4FF2A 1JWWA 2AHOB 2R9LA 1S1UB 4ZPBA 3HKWA 3PO4A 1JKHA 4K2XA 1ZM9A 3Q8QB 2OTLS 3HHNB 2UU9J 1W25A 1H7WA 2IBOA 4I6AA 3GTYX 4ED2A 2IM0A 3CJ4A 4X64J 2CJAA 2LVWA 1NCLA 1S0NA 2ZDPA 2YNGA 3ENQA 1RB0A 2RUSA 2C2NA 3OTCA 4FVMA 3AFGA 3WQPA 4F26A 3C15A 2WVDA 3NGSA 2GW8A 2LMIA 1I5OB 1XIQA 2RJZA 1GQEA 1U0SA 2BE9B 1NBEB 1FJGJ 4NMXA 5DQHA 4I0WA 1XMBA 1IUJA 2CQIA 1GXTA 2V4QA 4LBHA 2IAJB 3VCDA 4LF5J 4FYVB 1W2IA 3D1HA 3HJVA 5KOXA 1NHUA 4K59A 5J2MA 3RB3A 4EZ6A 1N32J 4NLTA 4JV5F 5DDRC 3OSPA 3RBDA 5E5NA 4NCGA 1HARA 3DGPB 1XR6A 4PXCA 5E3AA 1R31A 1S7IA 1YJ7A 2QX0A 1MWQA 4NLWA 2IC3A 5CCLA 3M8PB 1S4EA 2ZHBA 2JFDA 2FUG9 2XY7A 5CABA 4X4SA 1XBWA 1UW9A 4WYLA 5EN1A 5JUMA 3GSIA 3FMWA 4WIQA 1U49A 1IWGA 4ZVHA 2UP1A 2KFYA 1RT4B 4DR2F 1KC8T 4RU9A 2CXEA 2DNGA 2QA4S 2G0JA 3FSXA 4H4OB 4O0IA 4OQJA 4A8SA 4DWIA 2K1RA 1U6FA 4O3PA 3EE3A 1S0VA 4Q8EA 4UOGA 1S1UA 2OH2A 2QFJA 2XZTB 1U2FA 4NA3A 2BQRA 2RH3A 4ZVTB 4LF7J 3HDSA 3I4HX 5KFAA 2R4FA 4DV1J 3PYDA 3ZZZA 1CSJA 4LQ3A 1S97A 4AUKA 3TARA 2HNDA 2ZHOA 3R7NB 2QSFA 2FJAB 1X4HA 4PZVA 4ED6A 2HVZA 2Z2MA 2EK6A 3JSRA 1WACA 3IFEA 3VZHA 4JI1F 3GPAA 5CXTA 3DM2A 3BPSP 1IQTA 4DX7A 3OSNA 2KTQA 1WHYA 3E01B 2FHJA 2WSCC 1X4BA 4DPWA 3DYAB 1H74A 5CZXA 5GAHU 3T1HF 5IXUA 4PXDA 2D3UA 3C66A 4R25A 4YMEA 1T03B 1YDLA 1QSLA 4NXMF 3W62A 1SIWB 2COLA 3R5AA 4CTAA 1KLMA 4ZP8A 1U02A 2DNMA 1RYRA 1E6VA 4A8WA 4ER8A 1RTIA 3FCHA 5DZ6A 4MT1A 4TNOA 1P8GA 2B8QA 1MNEA 1B0PA 2R7QA 2V8PA 1R8BA 3D6MB 4U7CA 1AZSB 3C2PA 1NK0A 2DITA 1NK8A 4NXMJ 1WHVA 2XZDB 3K8WA 1IBKF 2FJBB 3MEEB 4NI2B 4ID5A 4RWXA 3FK4A 3O5TB 3S8SA 2X51A 2P6TA 4B17A 4TLRA 2MZQA 2XTJP 1SI9A 1XMQJ 3FZ2A 5FD1A 2DR5A 2HIYA 1X4GA 4OX6A 1BC6A 3JTNA 5HBMB 5MLCV 1KOHA 1FVSA 3O8WA 5LJ3Y 3KLGA 1TVRB 4F7VA 3EYZA 2VBYA 3JQKA 3M30A 4UZBA 1Y9OA 1JLCB 3AH6A 5KFDA 2GO9A 1LWCB 4J5OA 5L9NA 3OL7A 1YJ9S 4ILLA 1UJ5A 5CYJA 1QD1A 3UNYA 3VQSA 2DY1A 2IRUA 2Y3YA 4M5DB 1N48A 1DFDA 4DS5A 3RGIA 1MW7A 2EFOA 4NLSA 3J80Y 2HHTA 5L1JA 2VODA 2HRUA 2H4WB 4K4UA 1SPBP 2V94A 1RXOB 3CJ0A 3DYAA 4O3SA 2FJVA 2CPYA 1FRHA 3I96A 4YB6A 3GFZA 4DV2F 1U47A 4DCJB 2DPIA 2DNKA 4IG3B 4ES1A 2RS2A 2P8IA 3PYFA 4PXEA 5GAEI 1CBKA 4I2PA 4KT0C 1BE4A 3MCNA 1WEXA 2BQUA 4RNMA 1KRPA 3ZTOA 2RRAA 1FKPA 1Q8KA 1Q8LA 1IBKJ 5JXSA 2W7PA 1Z2ZA 4FDFA 4JOUA 1FX2A 4HDGA 3GR1A 1T8EA 3G6VA 2MQNA 2CNNB 3U1LA 1RK8A 5D4NA 2KZZA 2HQDA 1XERA 3NEKA 1MN7A 1FI4A 1S6OA 2IA6A 3FJ2A 3K7RA 2WB1D 4ELVA 4ZIVA 1S5ZA 1ZA2B 2DHSA 3ONQA 3MI7X 3PRDA 2IM3A 2D74B 3OD2A 1REGX 1NDLA 4JI2F 2RU3A 2PIIA 3CDWA 4C9DA 3US5A 2J9DA 1T94A 4Y2AA 3ZZPA 4CO4A 5A2QY 1S12A 1TVRA 1JNRB 1LXNA 3NGKA 4DR6J 3CJKB 1U1KA 3MM6B 3DRRB 1JLCA 1H2VZ 4U67Q 4KGZB 2JEJA 2ZH1A 3QFWA 1Y3JA 2NXCA 3IR5B 4OI4A 5E41A 4X65F 4YOEA 3L9ZA 5IT0A 3GP9A 3HHLA 3HHDA 3MUTP 1W2BR 5I3UB 2WBMA 3BREA 1GXLA 4USTA 1VQ7S 3MPYA 2QYCA 5D78A 4DX6A 2BYCA 5L46A 3RR7A 2B3TB 4LBPA 3W2VB 2EKYA 3GJSB 3B78A 3H42A 3SBMA 3IA0A 5GAGU 2M5YA 3DI6A 2PA3A 3N28A 2XB2D 1YX2A 3OJSA 4ZVPB 1BWEA 4DZ6A 2GIFA 3CJRA 1YJRA 1RTIB 3ZO7A 4LF7F 1KVKA 4K4ZA 1JNZB 2VC1A 1HWJA 4IRKA 4OI1A 3RUBL 2BQ3A 2D1CA 2J0WA 2YKQA 3E51A 4MTPA 2VA2A 1S9EB 2IIHA 1TMMA 3DRSA 4PWWA 3AJDA 1RHUB 2VL1A 3VWSA 1S1VB 4DR2J 4J9VA 2YX4A 2ASDA 4USUA 3PW7A 3ZNJ1 4P7VA 1IR2A 1FRLA 2AEFA 2HIQA 4A48A 3N6MA 1IM6A 3W3SA 3G6XA 1JK9B 1Q79A 1VC5A 1SH0A 2EBEA 3MPWA 4UZCA 2M7SA 5KFXA 1LW0A 5B0EA 1KSPA 3FMBA 1APSA 2ADBA 4N47A 4AL7A 1BQMB 5DLFA 2HMIB 2GIQA 2MDAA 3RYLA 1M5HA 4USKA 1ZS6A 1X8DA 2XO6A 2CQDA 4NCBA 4HKQA 1XTZA 2E1RA 2M88A 1Z4UA 1ZA1B 3K17A 1FF2A 2XWXA 4M5LA 4M5DA 2EFVA 2IA0A 2OI2A 2DNPA 1QDUB 2PMHA 4C3MA 4C11A 2B6AB 4ES3A 1PGZA 4JI1J 1YSJA 2Z57B 4RW9A 2OELA 5FDLA 1K47A 2OPQA 3MM8A 4A8OA 4XPEA 2BJDA 3CIZA 3DLJA 2OIHA 5KFBA 1T05B 2C1EB 2B4PA 3SV4A 4Y2MA 2ZH4A 1S0OA 3Q83A 3EPGA 1NJWA 4JI5F 2L48A 2MZSA 2HHQA 3BQ0A 1F0XA 1VDHA 4CO2A 1LV5A 3GLJA 3KMQA 4BWMA 2R2RA 2R7TA 4NX9A 2V2QA 4WPAA 1HNWF 1BQNB 4LBIA 4C3KA 2LQBA 4TQSA 5DG8A 5KFYA 1NK7A 4PG8A 2KFZA 2DNOA 2O3DA 1HQUB 2NLWA 1QAIA 1AUSL 2ZBCA 3T1YF 1KEKA 3PEJA 1SKWA 2HNDB 2P9GA 2ZWOA 3DOMB 3A4TA 3UFCX 1KTVA 4NLUA 1WELA 4OZJA 3OPKA 4ZDNA 2MXYA 3H5UA 4N77A 1UA1A 1RGVA 3NGUA 2XHCA 2KT2A 2AYBA 2BX6A 2MLXA 4IG0B 5A8WB 1RHKB 3HHKA 2HS3A 2VPYB 3FEYB 4G6VB 4DSJA 3BO3A 4RW7B 4E0DA 2YX7A 1URNA 4NRUA 2KU7A 3EVWA 2FHJD 2A1BA 4F67A 3MCMA 3MM5B 5EWEA 2LEBA 4KJIA 3Q8YA 3CJ2A 1JLGA 3IP0A 3RB4A 1XWLA 2DGVA 2I0XA 5HMXA 2DR7A 4AL5A 2HFUA 1F1BB 2HK2A 4NL5A 4QR2A 1HLWA 3T6BA 3PM9A 1WKKA 2WAQD 5HROA 4B9MA 1XK8A 2JX2A 3FKBA 4LFCF 3ELHA 3JSBA 4AQYF 1CLFA 1NPPA 2V50A 4CO0A 1LW2A 3M2UB 1DZ5A 2OKQA 2LXFA 5IT9U 5KFTA 1VR6A 2ZVIA 2HHWA 2HGLA 2YY3A 3MEGA 2AWZA 4MKAA 1CULA 3V2UC 5I42A 3G6YA 3IAM9 3IG1B 3BGLA 2XMUA 5E3CA 3GB0A 1OPZA 2VU5A 1YITS 2AP6A 1S4FA 4LFCJ 1IQZA 1ZETA 4HI1A 3QSYB 4R5PB 3M2VB 2E1AA 1RTHB 3IM9A 4RLEA 3A13A 3C6TB 4V1Ak 4C8KA 2MKIA 3I0SB 1UP1A 3FNNA 3U02A 4JI6F 1ITPA 5EDWA 2M3DA 1FDNA 2C3UA 2H1YA 5ETLA 3GV8B 4C98A 4C0OC 1W7WA 4NLYA 3CCVS 1WDTA 2BJ1A 4KPCA 3K58A 1EIYB 1U6BA 3P6YC 2DGQA 3HSZA 1TKDA 2ZNYA 6FDRA 3EDQB 5HP1A 3E3XA 3FBBA 2ALZA 1TKTB 4HTIA 2DH8A 1LWXA 2J8AA 3RU0A 2W01A 1HIYA 2R8KA 2FJWA 2F8EX 5E0OA 7AT1B 3I0RB 2A18A 5ITHA 1QE1B 5KG7A 4FPRA 2MJNA 2UXBJ 3ET6A 4DPYA 4NCGB 5LSRA 2EC0A 3NL0A 4DUYJ 1GH8A 1R8PA 3CDEA 2DGXA 3QLHA 4IFVA 3TZXA 4DQPA 3UNGC 3CIMA 3PDNA 4OI6A 5HQLA 3PX4A 4WBFA 1SL1A 4IYQA 2O01C 3OFFA 4QIFA 3MAHA 1LW2B 2DXDA 2YQ0A 2JC0A 3A8JA 3GJTB 3QGIA 3MUVP 3BN7A 2XGPA 2GCFA 1WHWA 3GV5B 2BUNA 4MMOA 1QLNA 3NOGA 4RBTA 2CFXA 2XLKA 3GIJA 2HNYB 2POKA 3QRQA 2DNNA 3CCWA 3DU6A 2NSCA 5K20B 4R0JA 4IUFA 1V5VA 4CO5A 2H4YB 1NDCA 1DTTB 2J8SA 2JRSA 2RDDA 3MURP 5B0FA 4DL0C 2Y1RI 1RCXB 2FC8A 4TXSA 2C2DA 1SXLA 1X4EA 5A8KB 2J7UA 3M1VA 3R6LB 2C22A 3BH7B 3GYNA 1JLBB 5AE3A 4N56A 1NK6A 3H0PA 1K1SA 5DGAA 1VK8A 4OZLA 3KHHA 1LKZA 3M8QA 2UVUA 2ROPA 3NKYA 2MEWA 4Y34A 3SCKE 3T1AA 2NQPA 5D8HB 2DHGA 4P2XA 4JV0A 1QTMA 4Q43A 2HWIA 2BJEA 1R8HA 1RQ0A 2GGPA 2ZOFA 3OTBA 5DDQC 3R5CA 5F41A 4B9TA 4W90B 2DHAA 4AD6A 2KKHA 3VZIA 4YHHF 5AT1B 1N4LA 5B09A 1BMQB 2GQ2A 1JXEA 4B9LA 5H9EJ 4ANEA 4NLQA 3R8YA 4IO1A 1CEZA 4P72A 1PSDA 4LFBF 2OSQA 4KFBA 1F6TA 1ACMB 3GG1A 3KG1A 4O4GA 5D4OA 2VDIA 3W9JA 2Y9HA 3H8YA 4H4OA 2LXIA 3C14B 4DR3J 3HSJA 1HA1A 2B4OA 2ZJPQ 4U9RA 3W5XA 4DCOB 5M2UA 4FZVA 4IQMA 4UQGA 2CG4A 2QV6A 4C97A 1M5OC 1VQKS 3CEDA 4ILMA 1SQGA 2GAHC 3RBEA 4ECUA 4IOBA 1FCAA 3TOQA 1HPZB 3C6UA 3CMQA 1BQMA 3D0HE 2E29A 5HQMA 1FO1A 4ECVA 1DTTA 3H40A 3NMAA 3V4IA 5HANA 3D1OA 2QC3A 1UETA 4Y3CA 4K4WA 3D0GE 2K8GA 1M5PC 1VQYA 2Z2LA 4RW9B 4DCPB 1J5OB 3BGRB 3OL6A 2CQ2A 2CJXB 4P74A 3EGZA 5GADU 3THVA 4Q8FA 1T05A 2OJ3A 1P9QC 3B6BA 4O3OA 3TVKA 1OSDA 3IM8A 5EWGA 3KHLA 3RB0A 3J7AN 1TUVA 3ILJA 3QGPA 4LR8A 2HURA 5JVGQ 5HVFA 5BXIA 1IR1A 5LMUF 2XY6A 1X4AA 2XYPB 3D9BA 4N7TA 3DKDA 4C3LA 3UDLA 4F0MA 3PIOQ 2L9WA 1XR7A 5F8LA 1HQEB 4NASA 3KLEA 2EFNA 2MMYA 1BY9A 4J9MA 3F44A 1GX5A 2Y0BB 2YKPA 2RQ4A 1I94J 3NNAA 4HT5A 2NZCA 5T41A 3PY8A 2CVIA 2HFVA 3OR2A 1VI7A 3P4UB 4Y2KA 4KO0B 5HMZA 2B4UA 1DRZA 1XMOF 1B7FA 1LWFB 2HRYA 3C46A 2CPJA 2HHPA 2XULA 1HBMB 4CLFA 2ZH9A 5IV3A 2DH7A 4YFUA 5AJ3F 4OJHA 4D3HA 5B0BA 4LFAJ 5L8RC 4DUZJ 4DL3A 3TWZA 1KVIA 3KFWX 4ICLA 1RBOB 4ES2A 4LF6J 1RAFB 2CIMA 3NGRA 3OJUA 4E98A 2UUBF 5A8KA 2JOQA 1DHMA 1YIJS 1K0TA 3W65A 1WOSA 2VG7A 4X65J 2GA7A 3DU5A 3QRPA 4J9RA 4C8YA 1Q86T 4WE1A 2QG9B 1RAIB 2UVVA 4ZP7A 4EO8A 2A6OA 1AA1B 1RHQB 3EICA 1JLAA 3K8VA 3RB6A 3TVZA 4A8QA 1Q8BA 2XY5A 3H2LA 5IT9Y 3J7YU 1S49A 5I3UA 2NYIA 3MM7B 4WTOB 5A0YA 3TZZA 3UD5A 2G9OA 3M8WA 4DLGA 2YKMB 1CJTA 2H5IB
chains in the Genus database with same CATH topology
5F9LA 3KK2B 3IO1A 4FF3A 5CA5A 4G1QA 4DSKA 3HVWA 2LDYA 1HQEA 3KLEB 1WHXA 3OHBA 4ZP6A 2M4MA 4ECTA 1NJIT 4F4KA 1D8YA 3G6ES 2ZH3A 3OHAA 2K2PA 3GFYA 3SEOA 1MWZA 3DLKB 4F25A 1Z1ZA 2DISA 2V4JA 1U25A 3K57A 1RAJA 3TUJC 2YKAA 3I32A 4UY85 1X9MA 3GR0A 4ICLB 3F73A 4QCLA 3N9UC 4RW8B 1S1TB 2MHEA 4NZ6A 3J81Y 4HT7A 1XN9A 4QIWD 5THWA 4YB1P 2Q43A 1R0AB 4OHWA 4ALZA 4CNZA 2KRBA 3M05A 1N5QA 4A4JA 1N0VC 4IQXA 3R1LA 4ZPWR 4RW4A 3L09A 3QGGA 2J5AA 2I5JB 4HI2A 4AE5A 1JXLA 3IC1A 4KRWA 5F3ZA 2XSFA 4DFMA 2HHSA 2G0CA 2Y1IA 2HYIB 5IT4A 2B51A 1U1RA 3KHRA 2G1DA 3CCMS 2HWHA 4ZVGA 5CHCB 1TV6A 4PQUB 3UR3C 4XPCA 1U26A 2XI3A 3RW7A 4B3RF 1E6YA 5BYQA 3N0VA 1S9EA 1N36F 3UDCA 1HD0A 2NPFA 1S9GB 3N6LA 1TKZB 2F9DA 2N4DA 3FQKA 4YUDA 1S72S 2AQ4A 1C1CB 4USJC 2ABYA 1VRUA 2GIRA 5B7WA 1FNOA 3DOMA 3M1VB 4XDDA 1LFPA 2VFSA 1TFWA 4RWWA 5K14B 2NPIA 3AY0A 2W9BA 2AYMA 2J7WA 1WI6A 3ETOA 4UQTA 4CIOA 3KK3A 4QWCA 2JL9A 4LVNP 4MFBA 1Q1KA 4FN5A 2IVFB 1KR4A 4RUAA 3DNCA 4BS2A 3V6DB 5KTQA 1ELOA 4PUOA 2PN6A 1RT1B 3MTJA 3HM9A 1I6JA 3J7ZT 2W7AA 1OPIA 1EP4B 1FERA 4R8UA 1UWBA 1OSCA 2D3ZA 3ZZOA 3GIMA 1N34F 2E66A 2J7KA 2RVJA 4B02A 4JV1A 2HHUA 1JJ4A 1N0UA 1QJHA 3N01A 2DGWA 3UR0A 2MY7A 2M8HA 1RKIA 1RT7B 1FDAA 2ASYA 4WFXA 1KTQA 2JHEA 3QJJA 5IWAF 4CQ1A 4I56A 1S79A 3PX0A 4ED0A 2QLXA 1TK5A 3CCZA 5KG6A 1FRIA 2GQQA 1JB0C 2HLTA 2YVSA 3HX9A 4MYUA 3L3CA 4DV4F 2LXUA 5KFNA 4KTQA 1SH2A 1M5VC 4X4QA 4QQBA 3POTA 2V4JB 4F50A 3CDAA 1NO8A 3IWLA 3WC2A 3LQVA 1VQ9S 4DDFA 5GAHI 3T3FA 3BGUA 1NJYA 1IN0A 1SQEA 1K8AT 1FRXA 2XBPA 1S76D 2GHPA 2UUTA 3HZGA 2F4VF 2QT7A 1UAWA 3PO5A 3NWGA 1S7HA 2OPSB 4C11B 4X4PA 5CYMA 3HHLC 2EK1A 5GVQA 3Q8RB 5A6PA 3MECB 3MOJB 1SJFA 1ZTTA 4I7FA 2RDJA 2OLWA 3DI6B 1KS2A 5FLXY 4QYRA 2KB2A 2A10A 3M2UA 5LSLA 2W7OA 1HWKA 5A6WA 4IFVB 5GADI 2Y1JA 3KK2A 4U7UK 2Q79A 4F02A 4ECRA 1B0TA 3B4MA 4FVCA 3IG1A 1S6QB 2MHNA 1Q53A 3AJ1A 1LWFA 3CD7A 4CO3A 2UVRA 2V5HG 1OWXA 1LOUA 4L6V3 2F40A 3O3LA 3UWTA 3BSOA 1T95A 2O5DA 4X4UA 1O8BA 3MMBA 2W4CA 4KIAA 4IR1A 1LW0B 1HR0F 3TI0A 2CQCA 1S9FA 2OFGX 5DLGA 4NLDA 1M5KC 1U8SA 1PC4A 4FXDA 1YI2S 1T3NA 3OTDA 2DCUB 4IG0A 3FSYA 1VOMA 3OXGA 4NA2A 2MKHA 2CPZA 5A8WA 3UCZP 4M94A 2HGMA 1HI8A 1X4CA 2YWFA 4XK8C 2AYEA 4GMKA 4Z2XA 3MEKA 4K4VA 2ZUGA 3H98A 1YHQS 1R0AA 3M6XA 2IRYA 2ZDOA 3E01A 1T7PA 1RT5A 2ILZA 5GAEU 5D77A 3LWLA 2XLJA 5K5MA 4PCQA 3Q24A 4DQIA 3KG0A 3I0RA 3I5CA 4N8NA 4WFYA 5I4MA 3I82A 2ADCA 4Q5VA 4B9SA 3S1TA 3P5TL 1IKWA 3DLGB 4I2QA 4PPZA 1ZPWX 1VQSA 4ZCIA 2MY8A 4DN9A 5EGYA 4DR1F 3J7YI 3CCUS 4OZ5A 4KFBB 2PGCA 1JIHA 1VMBA 1HBUB 1VIOA 4V19X 2QIFA 2YH1A 3QWPA 4DQQA 1RTJB 4F8RA 4OLOA 3EGWB 2BXJA 2GX8A 2VG5B 4AXIA 5B0DA 3KK1A 4ITSA 2LU1A 3ZZUA 4I4BA 4CH7A 3CCLS 3VAJA 3DN9A 1H3DA 2W9BB 3CE8A 1REVA 4Y2CA 4EBCA 2EFPA 2M52A 2ZM6F 1SC6A 5KG1A 2B56A 1WF0A 2M0GB 4DV6F 3QJPA 4LSLB 1C0UB 1C2PA 3FVYA 2AGPA 2NXUA 5KFGA 2OPSA 1WI8A 4OI3A 1IBMF 2XSJB 1KQSR 1FNMA 4F4YA 4ZPCA 1JMTA 3NBPB 4QR1A 4FNHA 5HL7Q 2XMJA 1F5AA 1U2RA 4C4WA 3N4WA 4DV7F 2YNHA 2WHOA 2MZ1A 4AL6A 2F3JA 3NAHA 1N8RT 1HWLA 4ECXA 1IKWB 3UD3P 5KT7A 5C5JA 4J9LA 3CC4S 4B3TF 3LP1A 3MZIA 4AFFA 2W9AA 3M2RA 2ZC4A 4FBUA 2HNYA 2D9OA 1RTHA 1RP5A 3G86A 7FDRA 3MR2A 3IN5A 2ZJQQ 2W9CA 1CQNA 4NMLA 2OD6A 3TAMA 4D3GA 2PE8A 3NCPA 2CQ3A 2F7VA 1S6PB 5KFQA 2GO8A 5T7LA 2HNZB 2VG5A 5HMWA 1S99A 2JDJA 3KK1B 4WF9Q 1C0TA 1FESA 2B9XA 1GAOA 4YP3A 2Y0SD 2AU0A 1N5YA 5EX3A 2AV5A 3L95X 1QSSA 4CZCA 2VKRA 2MYFA 5DDPC 4JI7F 1IKYA 1X0FA 1TL1A 1O5JA 2FD2A 2R7XA 2JVRA 2DJWA 4HL9A 1RT1A 3VF0B 3S6EA 3OW2R 1LWEA 1ZZNA 4NCAA 5F3TA 3KLVA 1UL3A 3D28A 3T5JA 2AX0A 2C2EA 2L3MA 3BGRA 4PQAA 5AE2A 3QO9B 2PFFB 2K3IA 3QJLA 4PKDB 3NS5A 3CD5A 1RJJA 4WFNQ 4IH5A 1BQXA 2P9EA 5A0YB 1FKPB 3D2WA 3LP0A 3PJWA 1Y4ZB 2PC6A 1P6TA 1ULRA 4E8UA 5BYRA 1VBZA 2R2UA 2CQHA 3I9V9 4L72B 5F0UA 3U1NA 1N5TA 2FJDB 3BDPA 4MH8A 3IWNC 1Q8IA 2RIJA 4NYPA 4OZ0A 1Y00A 4P2SA 3KLFA 2YNIA 1VBXA 3WC0A 1LQ9A 2YNGB 3M30B 1EETA 3DFEA 3EXCX 1F2GA 1N5SA 4CT8A 1S0MA 1FTCA 4MK9A 4UUXA 1LWCA 4DHVA 1JLFB 5KFWA 2RKIA 4PWDB 3V6KA 2VG7B 1QAXA 1R8AA 3DMJB 5DG9A 1R89A 2O1PA 2GMLA 2VUGA 3LANA 1KFDA 4NPOA 4JI0F 1RKJA 3W2WA 4JV2A 2KG1A 1AROP 4CT9A 2N7CA 2DGOA 4DMZA 4I2PB 2ZKTA 1OS5A 3M8PA 1GXUA 3GIIA 3H25A 3QPIA 3Q22A 2QLWA 1HWUA 2JSXA 4NLOA 2VPXB 4RW6B 3Q0AA 1DTQB 3QIPB 5J1EA 1HMVA 1VQMS 1BD6A 3LF0A 3OFEA 4ZLPA 4ZK7M 1K9MT 3LP1B 5CCMA 5HN0A 2BRLA 4HHJA 3FFIB 1VQPS 1UKUA 5AXKA 2R7SA 1SKRA 3GYXB 3H20A 4FS2A 2KFNA 4ZP9A 4ED8A 1G6BA 4LF9F 1UVLA 3BS9A 2K7JA 3V4IB 1X9SA 5B0CA 2E9TA 4C2MA 2CJKA 4HEA9 3BDEA 4TQRA 1N5YB 4ILRA 2I1RA 1RWUA 5FJ4A 3NS6A 2CPDA 1C0UA 2VASA 4F2RA 4DEZA 1UVNA 3CXCR 2FLNA 3GSDA 1U4BA 2CPFA 3CT9A 3T19A 1XNRF 4K0KF 4KB7A 5C24B 5HMYA 5GAGI 2FVRA 2J9CA 4ZCMA 2ZNZA 2IFXA 2ZKUA 1MMLA 2YH0A 3K5LA 1FD2A 2CZ4A 4ZCKA 4M8LA 1H38A 2QEXS 5G0RA 1BQNA 4IKAA 4HH0A 1UVIA 4WFZA <