2M8GX

Structure, function, and tethering of dna-binding domains in 54 transcriptional activators
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator
publication title Structure, function, and tethering of DNA-binding domains in sigma (54) transcriptional activators.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m8gX00
1JKPC 2E19A 2O9LA 5C3EJ 3BT9A 2M2EA 1MH3A 4JX5A 1GV5A 3GTLJ 1IUFA 1EF4A 2DMNA 2X6OA 5GP9A 5EZGA 3BQZA 5M5WJ 1JTXA 2LY9A 4I6ZA 2H1KA 2E2HJ 2XRLA 1CQTA 5HODA 4A3CJ 3ZQLA 2ID6A 5IOYA 2L7MP 5FKOA 3CDLA 2E1OA 1BA5A 1WCMJ 1E3OC 1X2NA 5F0FA 1POGA 3G1MA 1Y1WJ 2ME0A 2O7OA 1A6IA 1WGXA 1JKOC 3TP3A 3ZQHA 3LNQA 1U78A 3PO2J 1JJ6C 2RAEA 1MNMC 2HOTA 4HNVA 2WB1N 1I3QJ 4IHXA 1FTTA 1XC5A 1GVDA 3IH3A 2GM4A 4D7NA 4IEJA 2DN0A 2HYJA 3C2BA 3HKZN 2HOSA 1RR7A 4IHYA 4ABZA 1T56A 2LK2A 4MIMA 4D7MA 5EYRA 1UHSA 2EZHA 3M3YJ 4IHWA 3G1OA 5FKKA 3JRIA 2JWTA 1U9OA 1ZKGA 2ECBA 2NVXJ 3CQZJ 2OPTA 2GLOA 2LLKA 3HGYA 2DMUA 3FK6A 4C3HJ 4FTHA 5F04A 4UUSA 1DU0A 1AU7A 3BR5A 3BTIA 3HBLA 4AUXA 5K7FA 2XSDC 2JA7J 3GTPJ 3O8HA 1K61A 9ANTA 1FTZA 2EZLA 2L0KA 3PO3J 1QVTA 1H89C 3DEWA 1NK3P 1ETKA 3UKGA 1FIAA 1OCPA 4AC0A 3B6AA 1H88C 1Z77A 3TP0A 2W48A 2XB0X 2MW8A 4XICA 1P7IA 3W6VA 1WH7A 4IHVA 2ID3A 2AO9A 4X1EA 5C4XJ 2R92J 1JUMA 3TW6A 3PM1A 2DA3A 3JRCA 5IOZA 1TWHJ 3NAUA 1VF9A 4JP0A 1IV6A 1SANA 3B6CA 2CJJA 2EQRA 3GTJJ 1QRYA 3M4OJ 4B3AA 1YRNB 3HEFA 1IJWC 4B4CA 4MO7A 1ETOA 3ZQIA 3RZOJ 3BR3A 2Y31A 2PMZN 2KDZA 1PUFB 2XPUA 4MFDA 4BXXJ 1Y1VJ 1D5YA 3OIOA 3Q0WA 5FLVA 1B72A 4B1RA 2R0QC 2TRTA 1WH5A 4QIWN 1WI3A 2Y9ZA 4DYRA 1MSFC 3S2DJ 2XB5A 4V2GA 1P7JA 5F0CA 4M3FA 4A3FJ 2YUSA 5F08A 2CQXA 2XGEA 3FKIJ 3JRHA 2FX0A 1U8BA 1JKRC 2DMPA 4GFBA 3JRFA 2IAIA 2DA5A 3ZQCA 1ZR4A 3GTKJ 2X9DA 1AKHB 4BY1J 2VUMJ 3HGGA 5IP6A 2VI6A 4J19A 3A01B 1APLC 2VKEA 2DA7A 5EGOB 4CYCA 3MVPA 5EG0A 1RKTA 4C3IJ 4XIDA 2O8KA 1X58A 1HDDC 2M34A 1LFBA 1IDZA 5IYDJ 2JA5J 1ETWA 4W1UA 1O4XA 2DJNA 2K9NA 1Q1VA 3GBGA 4JYKA 3H3VK 1LFUP 1W0UA 1NK2P 2HDDA 1LE8B 1MBEA 4M3GA 3MN2A 2JK3A 3FIWA 5C44J 1TWGJ 1GV2A 3I4NJ 1BW5A 2H8RA 3TEDA 1MBFA 3F0CA 1BL0A 2VKVA 5EEAA 4RBOA 3HB9A 5C4JJ 5JLXA 1T33A 1ETQA 1XG1A 5E3NA 3JR9A 2Y30A 4V2FA 5J3LA 5J1RA 1H8AC 5K7HA 1NTCA 1W0TA 1FJLA 2YS9A 1UMQA 3A03A 2R5YB 3OSGA 1B8IB 2EH3A 3GTMJ 2VPRA 4S0HB 3ZQGA 2G0EA 1IRZA 5IPAA 1QPIA 2E2JJ 1HLVA 1I6HJ 2TCTA 2LR8A 2M9HA 1MSEC 1SFOJ 3BG3A 2WAQN 2Y9YA 2LTPA 3BR1A 2MSYA 5E3MA 1B72B 4A3EJ 4MFEA 4JX4A 1ENHA 3O8GA 4FCYA 1GDTA 2L7ZA 1MBKA 2R5ZB 3HOYJ 3IV5A 2NS8A 2MG4A 3D1NI 3WHBA 3BR0A 3ZOBA 3S2HJ 4FE7A 1WPKA 5EDNA 1JUPA 2HOAA 1TC3C 5E3OA 2L9RA 4NDLA 4BKXA 1HF0A 3LSRA 5FKNA 2R93J 4BBRJ 2YU9J 1GUUA 5J1UA 1IG7A 4A93J 3HOUJ 5M3MJ 4M3DA 4A3MJ 1K83J 2LFBA 2NOGA 1ETYA 3HM5A 3TW7A 1HCRA 4C2MJ 1F36A 4M6VA 1JUSA 3HOXJ 2Y0SN 2K9SA 1ETXA 3CCYA 5IYCJ 2DTZA 4XRSG 1OCTC 3K2AA 3S1QJ 2D5VA 3BG5A 4RDUA 2CQQA 2JMWA 5M5XJ 4C3JJ 3CMYA 1MBHA 1GT0C 3LOCA 5M3FJ 4D5FA 5M5YJ 2WV1A 2COBA 3GTGJ 3BTLA 1ZGWA 3L1PA 5DTDA 4DZPA 1ZR2A 3OSFA 3Q0VA 5FKLA 4LOCA 2XGDA 1TWFJ 2Y2ZA 3JRAA 3HOVJ 1JKQC 1FEXA 5J1YA 1VNDA 2HXOA 4W97A 2MGQA 3GTQJ 5K7ZA 5IP7J 4A3DJ 3BR6A 5FKMA 3BTCA 5GPAA 2JJ7A 4XRSA 3JRBA 3S14J 5JLWA 2LD5A 1RPWA 3Q0UA 3S15J 1IGNA 4UUSB 3JRDA 2DA6A 2I10A 2GBYA 2CRGA 2HQ5A 2M0CA 3HOWJ 4A3IJ 3JRGA 3GTOJ 1U9NA 1JT0A 2LKXA 3WHCA 3BTJA 2EZIA 2M8GX 2DA1A 2XPWA 4XRMA 5BNGA 3SDGA 4I76A 1A5JA 1ORKA 1ZK8A 3RKQA 1ETVA 5F0HA 3FK7A 2E2IJ 4FISA 4Y52J 1JGGA 1DU6A 1YRNA 4M3BA 4D5CA 1VFCA 4A69C 4QSHA 5FLMJ 1HOMA 1PUFA 1IC8A 3S1NJ 2NVQJ 5F27A 3DCFA 3RZDJ 4A3LJ 2IEKA 2DA4A 1HDPA 2LP0A 5F1JA 4A3KJ 5EZHA 1R9TJ 2CU7A 4DZJA 5IYBJ 3IH4A 3HOZJ 4A3BJ 3MKLA 5GPCA 3LSPA 2N8GA 4M3EA 4XK4A 3QPSA 3BG9A 2EZKA 3E7LA 2LVSA 2FJ1A 4DYQA 3S1MJ 3S16J 3QQAA 2R7ZJ 3S17J 3NARA 4A3GJ 2QF7A 2ELKA 4L5EA 2JA8J 2CUEA 1JT6A 1QVUA 1AKHA 3A02A 1Z0XA 3RQIA 1RESA 1XS9A 3A01A 1FIPA 2ZB9A 2X48A 3K7AJ 3LSGA 1JJ8C 3Q3SA 5EGOA 4G12A 2FQ4A 3VPRA 3HDDA 2QCOA 4DW6A 2ECCA 2HI3A 4BY7J 4QTRA 2NVYJ 2EBIA 3S1RJ 1OJLA 2XGCA 1TWAJ 4MLOA 1MH4A 2XPVA 1AHDP 2DMQA 2B63J 1F43A 1G2HA 2DA2A 3SFIA 3G1LA 1LE8A 4DYCA 4CYCB 4FE4A 5EG0B 4AYBN 3I4MJ 1OFCX 2JN6A 2IBDA 1MBGA 3LSJA 2K40A 3SJMA 4EEFG 4Y7NJ 3ZQFA 4A3JJ 1BW6A 3IH2A 2NVTJ 2NS7A 3BR2A 1ITYA 3H0GJ 2DMTA 4UUTA 2AHQA 2FD5A 2HXIA 5E3LA 1TWCJ 5IP9J 2R5YA 2OF7A 1I50J 1B8IA 2CUFA 3BQYA 1UG2A 2JA6J 1JTYA 2P81A 5EF6A 1RKWA 1BJZA 2ME6A 1ZQ3P 2KT0A 2K9QA 5FJ8J 3QPLA 3OOUA 1X2MA 1MBJA 4BBSJ 3JREA 4X6AJ 1S7EA 1ZTRA 2L7FP 2R5ZA 1VI0A 3FISA 5DS9A 1RETA 1IDYA 4JX6A
chains in the Genus database with same CATH superfamily
1JGSA 3BCBA 2O9LA 1K79A 3DPUA 1UCRA 2DBBA 3IP4B 2M2EA 1BR1A 3LA7A 2V6EA 3DTEA 3GTLJ 4AD9A 2DCEA 3KCCA 3I59A 2DMNA 4CDGA 2PMHA 3X2QH 4M9XA 5EZGA 2VT2A 5ICCA 2JZYA 3BQZA 3IC7A 3CCLI 2WTEA 5M5WJ 4IXAA 2LY9A 4I6ZA 3WTUC 3MFKA 4KYWA 5HODA 5D8LB 1Y0UA 3IAS2 3ZQLA 2ID6A 5JI6A 2MFZA 1BN5A 2K3FA 5FKOA 3U9GA 2VJIA 4L0YB 4KUMA 2L4MA 2H94A 2MYSA 3G1MA 4PUSA 2O7OA 2VKHA 4P5OA 1JKOC 2IGKA 1XX5A 1B9MA 3BLYA 4LMYA 2FQ3A 2LF8A 5HNHA 2VQGA 2F5VA 3IKVA 3CUQC 4KMFA 5LRRA 5GTHC 2Y0MA 3WTSC 4BXUA 2VT3A 2WB1N 2OD5A 2IGOA 4DBQA 4ENJA 5CQEA 1TW3A 2JQ7A 3PQKA 2QQBA 4IRGA 4L9TA 3GFIA 2DN0A 3J7AO 3L7WA 2NNYA 1WJCA 1IRFA 2DFHA 2LK2A 4JQFA 4N4NB 3C2HA 4MIMA 5EYRA 2QA4I 4AU7A 5J8FA 3K70D 2OV7A 1ZKGA 3SEZA 4DNCA 2OPTA 3A1YA 2LLKA 2JSCA 3ASOH 5K1YA 1Y8RB 2VOPA 4BQAA 1OYYA 1BOBA 2O8XA 3KP6A 3S3MA 1YX5A 2XSJC 2VJ5A 3BTIA 4AUXA 4BAYA 3MZHA 2XSDC 4XL9A 3GCMA 1R49A 1K61A 2L01A 1OISA 2F5EA 3TKYA 1H89C 1XSXA 1R5GA 5BOXA 2LNBA 1QO0D 4UV8A 2P5KA 2HR3A 2K4BA 4XRFA 3TQNA 2X6XA 2W7NA 5LLQA 1SFEA 3OYDA 4L0ZB 1G3SA 3TW6A 3MAJA 2DA3A 2QSHX 3DTKA 1QZEA 2IT0A 3B6CA 1K7AA 1LUJB 3GTJJ 1LDKB 1MD0A 1CF7B 2OQGA 4LK1F 4BJ6C 4QPOA 4B4CA 4LLLA 3SQNA 2V1DA 1ETOA 3OR2C 1VQMI 3MWMA 1WJEA 2HKXA 1A04A 1U5TC 3MQ0A 4FETA 4B1RA 2XAUA 3OYGA 2GIVA 2OQRA 4AYBA 3KZYA 1MJ9A 1FYMA 1AOYA 4QIWN 3E1SA 3F22A 2KRCA 2BY2A 2V79A 1PJRA 4XR6A 3BZKA 5D5WB 3OWTA 5K5RA 3S2DJ 2OU2A 2XB5A 3A0HC 1VQ8I 1P7JA 4MQ9F 2XGEA 3ABLH 3ZMTA 3CUQA 4EM1A 3OYHA 3ZMSA 1YS7A 4KIFA 3LA2A 4CA0A 3OL4A 4AIDA 1L0OC 4G6TB 4GO1A 3W2WA 2UV1A 3FMQA 3I54A 1D8KA 1FBSA 5L3EA 5BPDA 4MTDA 2OCCH 4BY1J 2RQPA 1FSHA 1KQ9A 2VI6A 1B59A 1SVMA 1J2XA 1DPUA 2DDAA 2IVMA 4CYCA 1WJDA 2F4IA 5EG0A 1RKTA 2VB6A 5JVGF 2M34A 3TO6A 5LHIA 1YJWI 2RDPA 3O3KA 3EETA 4W1UA 1O4XA 4I01A 2LBFA 1OKRA 3MZ8A 3GBGA 1X3WB 3I3LA 3H3VK 4G9YA 2BVLA 2E36A 2MBFA 1W0UA 1W36C 3NEUA 3KEQA 3N05A 4OWRB 1UELB 3PNTA 1G3WA 3C3WA 3MN2A 2JK3A 3FIWA 3NWSA 5FD5A 3ZCOA 1IXSB 4RMNA 3DKXA 1BW5A 4M73A 3M8EA 4F3QA 1MBFA 1CGPA 3HZJA 4U0WA 2KP6A 4RBOA 4KDPA 1BIAA 2DPUA 5JLXA 1XG1A 1BI2A 2K3PA 4Y4RA 3JR9A 5J3LA 3CD6I 3KP5A 2HPMA 3AG1H 4BUPA 2WV0A 1W0TA 3BDDA 2X0LA 1ZG5A 3A4CA 4L9JA 4H4KC 2WWYA 2EH3A 1GHCA 1ZYRF 1RC9A 2I8DA 2DFEA 3K10A 4GDFA 5IPAA 4XLFA 4RLFA 3OR1C 2ZO4A 1E3PA 4XKCA 4ESFA 2AQEA 4HX8A 1HLVA 1I6HJ 2K9MA 4J00A 2FUG2 1FY7A 1SFOJ 4U7BA 3H1CA 3R0AA 4HX7A 2O0YA 2EWNA 2Z33A 1ENHA 4LB5A 3CMMA 3O6BB 3WG9A 3IV5A 2X1DA 3WHBA 3S2HJ 3ZOBA 2P7VB 5EDNA 4LIVA 1U5TA 1JUPA 2HOAA 1TC3C 5E3OA 1OMIA 4BH9A 1LPQA 1HF0A 2IA1A 4E7ZA 2M5WA 2ZXHA 4CXFA 4Y3OA 4HDUA 1GXQA 5FKNA 3K1MA 3BJOA 5J1UA 1ZRFA 3CC4I 1SD6A 3CUOA 2E1MB 3TOBA 4MQVA 1K83J 1XMKA 3J7YJ 3HM5A 1HCRA 4M6VA 4P9FA 1NH3A 1JUSA 5B1BH 4K2EA 5IYCJ 4C2TA 4XRSG 1OCTC 3T8TA 2IS1A 3RJPA 2CQQA 3KIOA 5F6FA 5M5XJ 1SC7A 1V54H 1HKQA 2PMUA 2ISZA 5L3BA 2V6CA 5M3FJ 5M5YJ 2F48A 2COBA 3K4KA 3BTLA 1ZGWA 1MJAA 2KIQA 1B4AA 3P5JA 2KZGA 1FZPB 4OOIA 5L3GA 1LKXA 1ZR2A 1TNTA 3HSRA 3Q0VA 1WQ2A 2ACJA 5FKLA 4LOCA 2HYGD 1OCOH 3JRAA 4AM3A 5FD6A 1VNDA 2VKDA 2DK8A 4C9YA 1FSEA 2WY7Q 3ECOA 3MZYA 4O6JA 1ULYA 4ZZDA 3KEYA 3FZVA 5GAEJ 5ERIA 1S29A 2DTRA 1YIOA 4BHPA 2JJ7A 2PMZA 2HOEA 5CVJA 5E20A 4XRSA 3VYUB 1XDUA 2KKOA 5HS7A 2R7UA 5JLWA 2FBIA 3Q0UA 2EFWA 3S15J 5ILVA 3SZPA 5FROA 3F6OA 3FXOA 2EV0A 3MKYB 2XAFA 4A0ZA 4G7ZF 5DD4A 1U9NA 4WXDA 1JT0A 5A2QZ 5B1AH 3CCMI 1DGWY 3WE3A 1Z05A 1ORKA 2VL8A 2D45A 2QYOA 1ZK8A 3DU5A 3H0DA 3RKQA 3S2WA 4ZYAA 2E2IJ 2BEOA 2CYYA 1Y8QB 3OYEA 1CF7A 1LDJA 3CC7I 1F5TA 3OS2A 1R22A 4KA4A 1KQ0A 2NYXA 3H35A 4E7IA 2NVQJ 1D1BA 1X4PA 4UVBA 3DCFA 3RZDJ 4N4OB 1A35A 3HIFA 4DOZA 2DA4A 1ZHFA 5F1JA 2DT5A 5EZHA 5CVUA 1RRJA 3BY6A 3ZR8X 4DZJA 3I53A 2E34A 1NHAA 3V4GA 3IAM2 3P9KA 4MEYF 3CLQA 3UR3C 3LSPA 2N8GA 2A05A 2A69F 4C2UA 3QPSA 2E1MC 1FOKA 3I64A 2JSPA 4RB1A 3F72A 3RKYA 4DYQA 3FM3A 1ZAOA 3S16J 3P9IA 3QQAA 2A07F 3I0TA 3IL2A 3S17J 2RN7A 2MA3A 1YG2A 1JT6A 4EJUA 3K0LA 3CCRI 3A02A 1BR2A 2ZMEB 3CESA 1RESA 1ZLJA 5DCMB 2HTSA 2X48A 3E5QA 3Q3SA 4G12A 1TBXA 3FBIB 3GLXA 3ISPA 2JPBA 2F5FA 2V1NA 2OC6A 2CW7A 4CYDA 1JHHA 4WF2A 4BE1A 2HNHA 3D0SA 1O3QA 5D8KB 4GYGA 1IRXA 3WTTC 1XSVA 2EINH 4MLOA 4LIUA 3KP3A 1J9IA 2PJPA 3SFIA 1R1UA 2K27A 4X0GA 2DU9A 4AYBN 2BZTA 3CJNA 4F91B 3COAC 1MBGA 2K40A 1S5LC 4CCKA 2HZDA 2KMUA 5LRSA 4OAZA 2FBHA 2LH9A 5DM6F 4A3JJ 4IL6C 1S8NA 3I55I 1BW6A 1V55H 3I5UA 1ITYA 5J47A 3T1BA 2AHQA 3E5XA 1R58A 1P4WA 1TWCJ 3D5RC 3T5XA 1JTYA 3JSOA 2P81A 3AL0B 5EF6A 3LSHA 4I02A 2OBPA 4A2UA 1BJZA 3BZCA 2VIXA 4IRHA 5HVQC 1ERDA 3K2ZA 3QPLA 2KFDA 1MBJA 1O57A 4PGGA 3GX4X 2IPQX 1YW8A 4X6AJ 4KT6A 4RB0A 3RI4A 2L7FP 3BOQA 1MNEA 4NQWB 3KETA 2Z16A 4RAZA 4U0VA 2HVQA 1RETA 3GZ5A 2FBKA 5CYVA 3I9V2 4EJVA 1JKPC 3AG2H 2K02A 4L9NA 4UY8I 2E19A 3BWGA 3TL4X 1PP7U 3O2PE 2BVMA 4JX5A 1TQMA 1T08B 4G6QA 4FX0A 2DAOA 4DJAA 2L02A 3E6MA 4RB2C 3J80Z 4L5IA 3QODA 2Z99A 2Q1ZB 5HS8A 1R1VA 1LVKA 2R4GA 2E2HJ 3OOPA 2XRLA 4Q5SF 4V19K 3ZMVA 2DO7A 3DQVC 4U7DA 3ZMDA 3KP4A 4UNOA 3PNVA 3I71A 5IOYA 2L7MP 1XPXA 2E1OA 1BA5A 1S7OA 4XN3A 3LSKA 1MMGA 3DKWA 3H5RA 5F0FA 1IN8A 2LMDA 1BI1A 2WAEA 3LMMA 3TP3A 3ZQHA 3RSNA 4ESBA 3CCUI 4M6XA 1JJ6C 3DXJF 2RAEA 1REPC 3DFGA 3BPXA 4M74A 2HOTA 2GOMA 3DBRB 1FOYA 2O61A 1FTTA 1GVDA 3CP8A 3R4KA 1MDMB 2HYJA 2QGUA 2HOSA 4IHTA 2FMYA 1R00A 3KEOA 3SZTA 4HPQA 4IHWA 3WG7H 1ZRDA 1U9OA 2XAJA 1BBYA 3E6BA 5GTIC 2R7DA 4BXFA 5FFXA 4F7ZA 2GLOA 2EK5A 2W00A 3QOEA 1D1CA 2DMUA 4C3HJ 5F04A 2M1BA 2QQ8A 2DYRH 1XGSA 3HBLA 5K7FA 1TQPA 1BOAA 2MLKA 2JA7J 3O8HA 1J59A 3QU3A 9ANTA 4PCQA 5HLHA 2EZLA 1O3TA 2L0KA 4ON0A 1QVTA 2YSRA 3PO3J 3DEWA 2PG4A 1ETKA 3F6VA 2P7CB 1FIAA 1DP7P 2LDUA 2BY0A 5ED4A 2KIUA 1OYIA 1UAAA 4AC0A 3B6AA 1JXSA 3TP0A 4XICA 1SVOA 1OQYA 3HUGB 3L00A 5AIQA 2ID3A 2AO9A 2KJBA 3L9FA 2VJ4A 1K4TA 4BHCA 2X1CA 1EA3A 5JR3A 3WODF 3KZIC 2O03A 2PFBA 1MGTA 2R7TA 3H5NA 5IOZA 1D8JA 3NAUA 1KZHA 4KT5C 2V26A 1T38A 4NC7A 5J6XA 3TDZC 4WWCA 3H9GA 1Y6IA 1YRNB 1SFXA 2XV4S 5IT3A 4UUVA 4MO7A 1QQIA 3W2AA 2Y31A 2PMZN 3ESWB 3FKJA 4EJOA 5LEJA 4XN0A 2CV0A 2FF4A 4RM3A 1D5YA 2CGPA 2IS2A 1GLNA 1HBXG 2GIZA 5FLVA 5DUKA 1SAXA 1B72A 2K86A 2ZFUA 3MCZA 2R0QC 3M9AA 1YYVA 4EV0A 5CQGA 3PIOF 5E1XA 2L5QA 3D5LA 4G8XA 3QU6A 2HGCA 2NS0A 4G7HF 2Y9ZA 1RUOA 2KIMA 3F8CA 5B66C 5DCMA 3RKXA 4A3FJ 5KVRA 1OPCA 3FKIJ 2XUBA 2VQHA 1JKRC 4GFBA 2LKSA 2O3FA 3JRFA 2STWA 3NRVA 3N97A 3BC8A 1ZR4A 2X9DA 3H9QA 2VUMJ 1BJAA 4OU0A 1FOWA 2FNAA 3PIPF 3QRFF 2VE9A 1PDNC 3FBNB 3C1DA 1PP8F 4BHBA 4J19A 4II3A 1QPMA 1APLC 2KQRA 3MMYB 4CCJA 1XN7A 4D1QA 3G4SI 4IRIA 5ILSA 4G94A 4ZDOA 4C3IJ 1X58A 2ELHA 5K5OA 4CCOA 1IZ1A 1IDZA 2ADUA 5GAGJ 3V8JA 1MMDA 2DJNA 2VXZA 2K9NA 4JYKA 3RCOA 4UXNA 1NK2P 4NHJA 2M7AA 2HU9A 4L9VA 3K1NA 3VYRB 1LE8B 5C44J 3J80K 1GV2A 2FEZA 2IA2A 3TEDA 2XKOA 1EKEA 4QWQA 2VKVA 5EEAA 2PLYA 2DOAA 5C4JJ 1T33A 1ETQA 2BBYA 2QZ8A 5FGMA 2Y30A 5HLGA 3I58A 2VASA 5E8GA 1SD5A 4KMUX 4PZJA 4F52A 3WGIA 2MC3A 1R4NB 1UMQA 1VQKI 1EH8A 1B8IB 4S0HB 4ZJZA 4AIJA 3J81K 1IRZA 4PK4A 4XLHA 1WI9A 1NG6A 1IN5A 1D1AA 2M9HA 1MSEC 3OIQA 4LGWA 5B5EC 5H6QA 4AVZA 3BG3A 2Y9YA 3BR1A 1V5FA 2MSYA 3CCVI 4HLXA 2MABA 4MFEA 4JX4A 2EIJH 3RPUD 3O8GA 4XMYA 4CCNA 1GDTA 2L7ZA 3JW4A 3M1CA 2R5ZB 3CTAA 3BPVA 4HAMA 2Q0OA 2A6HF 4YIIA 5AONA 3ZN0A 2X6YA 4E4HA 3HKZA 1W1WE 3V8KA 4ZTJA 2E60A 3GMEA 2L9RA 4F93B 3CJRB 4BKXA 2ZJQF 2AQFA 2COMA 4PJJA 3LSTA 1IN6A 5EEHA 2FU4A 4BBRJ 2YU9J 4I99C 3AG3H 3F8NA 4JBAA 1N75A 2WY8Q 1SMTA 1F1ZA 3P9CA 4Q4ZF 1XMAA 3ZMZA 4D0PA 2NOGA 2CFXA 4BNCA 1D0YA 2XROA 3TW7A 2NOJB 4XLEA 3HRUA 1OYWA 2E35A 1WHUA 2CQ7A 3GW2A 3L2VA 1I6XA 1X1AA 4YFNF 1R5HA 2NRAC 1KA8A 1IF1A 2RNJA 4P1WA 1X1PA 2OCEA 4U87A 4EVIA 4U0YA 3S3OA 1MDMA 3DTIA 3VOEA 2F2EA 4B44A 2CO5A 3KPHA 4E7KA 4C3JJ 1GXPA 1XB4A 1GT0C 3LA3A 1U2WA 3WE2A 4HDVA 4MGRA 1VQOI 3K4NA 4RGSA 2D2WA 1B1BA 4F55A 1IRGA 3L1PA 1O3RA 1V3FA 4I0BA 2XAQA 2PQ8A 3OSFA 1YQAA 2XGDA 1Y0NA 2BOLA 1T95A 2LSOA 3KFWX 4HZFA 4A6EA 4A5MA 2XGXA 2MGQA 1YFHA 1O7FA 5K7ZA 3GTQJ 5IP7J 2CV1A 4A3DJ 4HV5A 2Y0SA 3BTCA 2R7WA 4ENNA 4KJZA 4M72A 2R7QA 4YFKF 3K9TA 1HW5A 2WAFA 3QPHA 4B09A 3OYCA 2LD5A 5EJCA 1IGNA 1P9QC 4UUSB 1EH7A 3KZZA 5B3SH 4E7HA 1ZLKA 2OZ6A 3HUGA 2GBYA 2RVCA 4LJZF 4XSZF 2CRGA 4BS9A 2HQ5A 2DJIA 3E3VA 4A3IJ 2EJRA 3K70C 2DK5A 4YRVA 1B9NA 3EUHA 3WHCA 5AIPA 2EZIA 2XPWA 4XRMA 5KCMA 1TT5B 4I76A 4LK0F 3DP7A 3SDGA 3CCQI 1K78B 1ZGAA 3IWZA 1FMVA 3DBHB 1N77A 2DFFA 3FK7A 4C30A 2D1HA 4FISA 5TISC 1JGGA 1Z67A 5LHHA 3KE2A 2ZJPF 1YRNA 2EIKH 5E1ZB 4D5CA 2HWVA 4QSHA 5FLMJ 1WFXA 1HOMA 1IC8A 3S1NJ 3HOSA 1I5ZA 1VQ4I 4P9UA 4EJTA 4YELA 1HA8A 2GOXB 2DLLA 3OV8A 4A3LJ 2QKLB 3C2GA 4HF0A 4LG0B 3OYNA 1R9TJ 2CU7A 4LLNA 4IQJA 4OIPF 3M1EA 4M9ZA 5IYBJ 4HNTA 1X19A 4A3BJ 3MKLA 3CC2I 1A5JA 1J75A 4XK4A 4GCVA 4BU2A 3BG9A 2EZKA 4IZZA 2JRMA 2PBIA 4WK8F 3EYYA 3S1MJ 1ZELA 3KYDB 3LFUA 2IXSA 3IRQA 3E6CC 4L5EA 2CUEA 3R60A 1YOVB 1JHFA 1R7JA 1A36A 3OIPA 1D0ZA 2DXIA 1S9HA 1XTAA 4AVPA 4BGDA 3BG7A 1Z91A 2ZKZA 3K4BA 2XDVA 1P2FA 2DYSH 4B47A 4M6YA 3HC7A 2FQ4A 1IXCA 1AWCA 2QCOA 5TGTA 5DS9A 2R7VA 3A0BC 1C0WA 1E17A 2QWWA 3W3CA 4BY7J 2NVYJ 4QTRA 4WXCA 4EJWA 1EV7A 2L4AA 4ZYGA 2VODA 1W7PD 4E7LA 2Y48A 2DODA 3OYKA 1W7PB 2PX9A 4TV7A 1MH4A 5L3FA 1XD7A 1G2HA 1ON2A 2B63J 1F43A 2WAQA 4DQ2A 4LG3A 1LE8A 4DYCA 1VQNI 2F4MB 2JN6A 2EILH 2V1UA 4EEFG 3OYJA 2P6SA 1O3SA 1ODDA 4MEXF 2QBYB 2M8EA 3ZQFA 2HDCA 4I7HA 5CJ9A 2DOEA 3IH2A 3LWFA 2NS7A 3F3XA 1PYVA 3BR2A 3OYAA 2W85A 3DU6A 2HXIA 2X6WA 5CVVA 1I50J 4ANJA 2L2OA 1B8IA 2CUFA 2JA6J 3PSFA 1TLHB 5J8CA 2FA5A 3KYCB 2XAHA 4LD5A 3G73A 3DEUA 2KJCA 2K9QA 1YTYA 3OOUA 2HQNA 1HW2A 1IN7A 1QZZA 1ZTRA 3GFJA 3RPUA 5ICGA 1TP4A 2R5ZA 2EPFA 2LY2A 3CCEI 1RIOH 1KGSA 3F21A 4JX6A 4Q48A 3GZNB 2GWRA 2NAZA 4Y33A 2VN2A 2JPCA 3HTUA 4KNYA 1YIJI 5FLXK 5C3EJ 3BT9A 1S7AA 1MH3A 1IN4A 1GV5A 1IUFA 4ETSA 1KU3A 3HPHA 5E79C 4HA8A 3K1PA 3V7CA 2YX7A 1ZARA 3CLOA 1X3ZB 1JTXA 4GRIA 5KHDA 2CV2A 2CH0A 4UB6C 2HYFA 4XQFA 1XMXA 3AG4H 2KRHA 4A3CJ 2LOOA 3HRSA 4HSTA 3I56I 3CDLA 4RGXA 1WCMJ 2YU3A 1W5TA 1X2NA 2V9KA 1IO2A 3ZRGA 5HOOA 2ME0A 1A6IA 4B48A 5BQTA 1U78A 1X4OA 4WXHA 3PO2J 4CHUA 4HEA2 2X4HA 2VBXA 5JFRA 2L7KA 1XGOA 1MNMC 3L2QA 1LQ1A 1UG0A 2EV5A 4N9HA 3R0JA 4RGRA 3V7SA 1SFKA 5GADJ 3SEQA 4HNVA 5TRDA 1RR8C 1H0MA 4IHXA 1I1SA 4A6DA 1A6QA 2RQQA 1OCRH 3FXLA 3K6GA 6PAXA 2FE3A 4IEJA 1D3YA 1D0XA 3PSIA 3HKZN 2KZVA 2OTJI 3SHFA 2DW4A 1IV8A 1LVAA 2R7FA 2V9PA 3VSLA 2MD0A 4R1HA 1B6AA 1J5YA 3G1OA 5FKKA 3IKTA 1FT9A 4HX4A 2E1CA 1X1BA 2JWTA 3CO6C 4S05A 3BCAA 2LY1A 2ECBA 4XKWA 4OIRF 2NVXJ 3CQZJ 3VODA 2HDWA 3F8FA 4XBFA 1U0JA 3HGYA 1ZN2A 3FK6A 4UV9A 4FTHA 4UUSA 3QWLA 2UZKA 4XONA 1AU7A 1XSDA 4IOAF 4R79A 2K4JA 2CS3A 1S72I 2FSWA 4ZH4F 3FXUA 1SD7A 1WRJA 1E2XA 2BXYA 5DM7F 2ZJRF 4MHGA 4B43A 3UKGA 2KPMA 2XVCA 3TO9A 1Y39A 2DT6A 2W25A 4BQOA 2KRFA 3L2UA 2J5OA 1H88C 1Z77A 5F1RA 2CUZA 4ZYDA 1P7IA 5J40A 2JVHA 2M30A 4IHVA 5C4XJ 2Z5UA 3R61A 2ZXWH 1ZGJA 2IA0A 2W84A 1J7KA 2R92J 4PSWA 2CQKA 4HNUA 4FX4A 3PM1A 4RB3C 2IGNA 1KONA 1VQ5I 2CMPA 5KAFC 1VF9A 4JP0A 3VEPA 1IV6A 1SANA 2PI0A 2EQRA 3M4OJ 1QRYA 2W24A 2X51A 2E71A 2CW8A 2TDXA 2ZNZA 1IUYA 1QHHD 3V8LA 3K4JA 2FOKA 3HEFA 1MJBA 1IJWC 2A5WA 2P6TA 2LREA 3ZQIA 2HVSA 3RZOJ 5HDGA 2KDZA 3GZ6A 1PUFB 1JI8A 4UVCA 4MTEA 3OIOA 1P92A 3S8PA 1FYKA 3PUBA 3TOAA 4EMSA 3E0JB 4ITVA 2TRTA 1MMAA 2H6BA 1WH5A 4E70A 3CP2A 3GLLA 4L18B 4XKBA 1WI3A 3F9KA 3NQOA 4WX9A 3HG9A 2GXAA 1N78A 3FHNA 2HFHA 1HSJA 1MSFC 2BE5F 3I4PA 2A6TA 4V2GA 4EM0B 5F0CA 2HTJA 1BI0A 4M3FA 2Q2EB 2YUSA 5F08A 2CQXA 4IO9F 3KX2A 4HYEA 1U8BA 3PUFA 1OR7C 3PFYA 4CH7A 3ECHA 2HS5A 2DA5A 4P96A 3M8JA 4KN7X 5L3DA 3ZQCA 3ULQB 3GTKJ 1AKHB 2FMLA 1W7PA 1QZYA 4EGZA 3RYPA 2Z9OA 3A01B 2EV6A 3EPZA 3RPQA 2W57A 2UWMA 3MVPA 2O8KA 5FB2A 4XIDA 2BV6A 1HDDC 2V7FA 2LG4A 3H9JA 3QP5A 4BJTA 2I5UA 3AAFA 5IYDJ 1ETWA 2ZMEC 4ZYEA 2P0WA 2QBYA 2EFNA 2QENA 3J81Z 1UHWA 1Z1DA 1LFUP 2VXDA 2HDDA 1SD4A 2OUMA 1YLFA 4M3GA 1TWGJ 3LAJA 3J7ZI 1RZ4A 3ABMH 4ZDPA 2NXNB 4IOCF 2H8RA 4QLCU 1PUEE 3L2WA 3H3UA 4XSXF 1O7LA 3QYEA 3HB9A 4CO8A 1PVEA 3FMSA 3IHUA 3FHZA 1G8XA 4V2FA 5J1RA 1H8AC 5K7HA 3IWFA 4WCGA 2VE8A 3BP8A 2A61A 1FJLA 1S6LA 4M9SA 1LFPA 5FRMA 3A03A 3BZ6A 4ASNA 3AFHA 3OSGA 3GTMJ 4G6DA 3ZQGA 1BIBA 1J0RA 1F9NA 5LD2C 3FXKA 4P55A 1U3EM 3QPTA 5J4YA 3OS0A 1QPIA 3ZQ7A 2E2JJ 2M45A 2TCTA 3CMEI 3EYIA 1G59A 2WAQN 5E3MA 2LTPA 4Z6YA 3OYIA 2HZTA 3GFMA 5D6EA 3UNGC 4KICA 3DLLF 3HHGA 3LQRA 3HOYJ 1MBKA 1V5EA 3AL0C 3LSIA 2NS8A 1QGPA 3HTSB 4FE7A 2DOFA 1HKTA 4YEJA 2MH2A 3LSRA 3L2CA 4CICA 4YFXF 3L2RA 2XKPA 3OL3A 1UZCA 4KIBA 3DV8A 4ZZLA 1IG7A 4A93J 1UFMA 3HOUJ 5M3MJ 2Z1DA 4M3DA 2B0LA 2IS6A 4IJAA 2OTLI 2O5RA 2KISA 1OR7A 3K4CA 1ETYA 3GVAA 1DP3A 1TNSA 2V9VA 1F36A 2CW0F 4KN4X 1LJ9A 1OCCH 3HOXJ 2ZXJA 3WGHA 4HG2A 3KLOA 2K9SA 1ACIA 3CCYA 3LFKA 2DTZA 1SAUA 4PJNA 3IUOA 2LBFB 4HW0A 3CO7C 1K4SA 3K2AA 4NC6A 4UB8C 3S1QJ 5JVTA 2B7EA 3HRMA 2L9SA 4RAFA 4A12A 4J01A 2JMWA 1V4RA 3CMYA 2JVGA 1E3HA 2WBMA 2ZMEA 3GTGJ 3TGNA 2LC2A 4HSRA 5IT9K 2XHKA 5DTDA 3PNYA 2CQNA 2EFQA 1DUXC 2Y2ZA 3GWZA 3HOVJ 5LGNA 3EQLF 2V4JC 4RLQA 1FEXA 5J1YA 4W97A 1Y56A 1TL8A 3RYRA 3ZGKA 1TZLA 3FWEA 1E0EA 3W6JB 3CCJI 2PN6A 5FKMA 3KYLA 2VQCA 3G3ZA 3JRBA 1KU9A 1QBJA 2BHYA 3B02A 3VFZA 2H6CA 2P8TA 1RPWA 1Q1HA 2HEOA 3QP6A 5DD8A 2AS5F 2MC4A 3JRDA 2DA6A 3F8MA 2CUJA 2M0CA 3HOWJ 1IAWA 3CCSI 2K9LA 1QU3A 1SFUA 3BTJA 2M8GX 4XOPA 5D5XB 4BE2A 2XIGA 3WU2C 3H5AA 5BNGA 2ETHA 3L09A 1I3AA 4FT8A 2VQLA 1U5TB 2GAUA 5ICFA 2FXAA 2EB7A 4DIQA 1DU6A 3ERMA 2GA2A 3ASNH 2KHMA 4BQNA 1VFCA 5DUIA 2QSGX 3GFLA 5D6FA 2XASA 1X3UA 2QLZA 1MMNA 3V42A 1PUFA 2X1EA 1QNTA 1W5SA 1DQUA 2DI3A 3J7AY 3M07A 2IEKA 2IGMA 4IPAA 2GXBA 3ZP5A 2JT1A 1FPQA 2DFIA 2XF7A 3PFIA 3IH4A 4NQWA 1Z3XA 2GZWA 3EUHC 5GPCA 4M3EA 2W4SA 3RIRA 5D5UB 2LF7A 4JOMA 4BYYA 1KYZA 2K7LA 1R6RA 4HQEA 4BE0A 2Q2EA 5DYMA 3KLNA 3ROUA 4NB5A 2FJ1A 3V7RA 1U6GA 2M7BA 1W4MA 2E7XA 4Y17A 2ZNYA 2QF7A 3FXJA 1Z3YA 2JRTA 3HOTA 5HLIA 4PJMA 4CCLA 1QVUA 2ZJ2A 1Z7LA 3CDIA 2FNPA 4II2A 3C18A 1BC7C 1Z0XA 1AKHA 3D5SC 3HPGA 2Y75A 2IRFG 4BEHB 3A01A 1W36D 3HRTA 3M8FA 1FIPA 1LEAA 3K7AJ 3LSGA 3A2KA 4PSXA 2MD5A 3U1KA 3VPRA 1BC8C 1TW2A 3VDXA 4FQGA 3HDDA 1Z9CA 5GAHJ 3KP7A 5H6RA 2XF6A 3QOPA 1HQCA 2EBIA 1XGMA 4PGHA 4AIKA 1OJLA 3QYBA 1WKMA 4AIHA 1IW7F 5KNLA 4IVNA 2XPVA 1AHDP 1TT0A 2DA2A 2CG4A 1X1DA 2BYVE 3H92A 5KAIC 3WTYC 2Y69H 2HVRA 4EQQA 3FMRA 3LSJA 3SJMA 2STTA 3Q9VA 4BACA 1W5CC 1LB2A 1FP1D 2NVTJ 3E5UA 2AXTC 3S3NA 1QA6A 1ZG3A 4OMZA 2KL4A 3Q5FA 4ZTFA 4RGUA 5IP9J 2ZBKA 4NNJA 4L5JA 5E3LA 3ELKA 5FLXZ 2GA1A 3BQYA 1UG2A 2ZXIA 1VQ7I 2VLAA 3JTHA 4A0YA 5LGTA 2R7OA 5FJ8J 3E97A 2Q8KA 1X2MA 4OIQF 4G7OF 2F4OB 2ESHA 5KK1A 4O3MA 1VQ6I 4I2OA 2RV8A 1ONVA 3TDUC 1IDYA 1MKMA 3OYFA 1XGNA 1Z21A 2IW5A 3DPTA 3H3ZA 3U2RA 4ZC3A 4D9JA 3JAMK 3JSPA 2VONA 2VC0A 2RC4A 2VC1A 4EGYA 1T98A 4RAGA 2RGVA 1YW7A 2BW3B 2M0MA 1EF4A 1XCBA 2X6OA 5GP9A 1ZH5A 1Z6RA 1BI3A 1FC3A 1R36A 2H1KA 2UUZA 1WZ2A 1CQTA 3PQJA 5LBQA 4Y15A 1MMSA 5HLTA 5L3CA 1VTNC 2HQAA 1P4AA 4BQQA 1UHMA 4E6KG 1R1TA 1E3OC 1YX3A 1POGA 3TO7A 1Y1WJ 1WGXA 1Z7UA 2QUFA 3LNQA 1YJNI 2OA4A 3H36A 1HXDA 2F5CA 1I27A 2RREA 5JHUA 2QSFX 1SEUA 3WGGA 4E7SA 3W6KB 2E5NA 1I3QJ 2ELJA 1KU7A 2VPLA 2BY1A 1XC5A 4XM3A 3IH3A 2GM4A 4D7NA 1ZRCA 4EM2A 1R5ID 1UJ8A 3C2BA 1RR7A 3F8BA 1DPRA 4ABZA 4IHYA 1T56A 3ABKH 4DGWB 3SZGA 4EATA 1USTA 4D7MA 1UHSA 2EZHA 2VBZA 3WTVC 3M3YJ 2EA4A 1WVRA 3JRIA 4XLNF 4M71A 5D5VB 4KFCA 1WJFA 4ENMA 4PDKA 2PJRB 4KIGA 4A0XA 1WSUA 4LITA 5HNFA 1G3TA 5E8IA 2HQRA 4CZCA 5BPIA 2EFPA 4UHTA 1KQ8A 3LSMA 1DU0A 2DPDA 1UB9A 3BR5A 4XLAA 2E7WA 1U8RA 4YIFA 5ILUA 5HDKA 3GTPJ 1FTZA 1H9GA 4HBLA 4HV6A 2Z2SB 2DDBA 1NK3P 4XOTA 1LEBA 5E1WA 5E17F 1RNLA 1OCPA 2UXNA 4LFUA 3SXYA 4B8XA 2M4GA 2JTVA 2DQRA 2W48A 2XB0X 2MW8A 4R8HA 4ESJA 1X1CA 3PJRA 3W6VA 1WH7A 1STZA 4RS8A 2QVOA 4X1EA 2FOWA 1LDDA 4A5NA 1JUMA 3SFZA 3SDBA 5ICEA 1GVJA 5BMZA 5JHFA 2UXXA 3JRCA 2L3DA 1QHGA 1TWHJ 2JA2A 3RKWA 4CUGA 4HF2A 2CJJA 4U88A 2ZSIB 3WTXC 1HSTA 5BS6A 4I98B 4B3AA 3HL2A 1R71A 4ENKA 4PFPA 4XORA 4AWXB 3BR3A 3LQQA 5DV5A 2X85A 2XPUA 4MFDA 2PEXA 4BXXJ 1D5VA 1Y1VJ 4BDYA 3Q0WA 5IY5H 2P5LC 2E5ZA 3JTGA 1USSA 3GEZA 3GYHX 2KLOA 1KYWA 3WU0A 3EUAA 1P6RA 4RAYA 1BM9A 2A3SA 4DYRA 3JCUC 2MLGA 5CKTA 4Z2YA 4BEHA 2A68F 4PJ0C 1VZ0A 2QKMB 4F92B 2G7UA 1I1GA 3GUDA 3DLAA 2A6EF 2IJLA 2JUCA 4GGGA 3JRHA 2FX0A 2DMPA 2IAIA 1KU2A 2MH9A 3WU1B 2OAZA 3KP2A 2O6GE 3OYBA 1YO5C 4Y13A 1VQ9I 3HGGA 5IP6A 1FYLA 2CFOA 3ABTA 1T39A 1LNWA 3S93A 2VKEA 2DA7A 3FDYA 2QQ9A 1T0FC 5EGOB 3MKWB 1EJ9A 1LFBA 3OYMA 2JA5J 3HJEA 3DWLE 3TBIA 1NG7A 1Q1VA 2L9VA 3CDHA 5F64A 2WADA 2H27A 5FRNA 1MBEA 4BL0B 3I4NJ 2CWEA 1DGRM 4QPQA 3VSKA 3T8RA 4IHSA 3F0CA 1BL0A 2M3AA 2ZC2A 1YITI 4HRIA 3OS1A 5E3NA 2DQLA 5E18F 3IRRA 3K4LA 2D1VA 1NTCA 2BGCA 1K6YA 3QYFA 3CMAI 1ZG1A 3EUKL 5CLSA 3C7JA 3DBLB 2YS9A 2Z3YA 3BJ6A 3FM5A 2R5YB 3M7GA 2BHZA 2VPRA 4NUBA 2G0EA 4CSWA 2OJED 3OYLA 4BDZA 5K5QA 3BROA 3G2BA 1G3YA 1YW9A 5LGUA 2LR8A 2F6CA 2ZSHB 4YG2F 1B72B 2E1NA 5LHGA 1YI2I 2GXGA 4A3EJ 2EIMH 2NNNA 2IS4A 4BJ5C 2BW3A 4PJLA 3R6SA 4FCYA 3ZN1A 2WB1A 4XLCA 1HW1A 3D1NI 2MG4A 2ESNA 2KIFA 1HKSA 3BR0A 1FP2A 1WPKA 1K78A 4UVAA 2R7RA 3VWBA 4LB6B 3MKZA 1ZREA 3ABUA 3U1DA 3DKYA 4ZYHA 3P7NA 2BY3A 3REOA 4NDLA 3GO5A 2R93J 1P4XA 4N0BA 3I59B 1GUUA 1RI7A 1VQLI 4A3MJ 5FFZA 2XRNA 2LFBA 5CVRA 5CVIA 3CF5F 3PL8A 3ZQQA 5IT9Z 4RM2A 2BXZA 4LG0A 3FXRA 3HXLA 2YPRA 3Q9SA 3HSEA 1EH6A 3DF8A 1Z6TA 3DPLC 4C2MJ 4HOBA 2A5YB 3FXQA 4YIRX 2Y0SN 4DBRA 1ETXA 2LYCA 3EDPA 3ZPLA 3ONQA 3B73A 1WWXA 2WA0A 2JUGA 5LFAA 1G6NA 2HKOA 2FRHA 1HC8A 2D5VA 3BG5A 1T0FA 4RDUA 4CGZA 1F4KA 5LEKA 1WJAA 2LKPA 1MBHA 3HHHA 3LOCA 3ZXSA 1T8IA 4KISA 1TTYA 4D5FA 3W2VA 2B9SA 2WV1A 3N4MA 2W1OA 4OINF 2PJRA 2H09A 1YE9A 1V5GA 2ICWG 5D4SA 4DZPA 1T6SA 3SYTA 3S32A 3FF5A 4ZDLA 1FOXA 4RA2A 2GQQA 3DEEA 1TWFJ 1JKQC 2HXOA 3BJAA 1AA7A 1JE8A 2P4WA 3RTRA 2CSOA 3HYIA 1J09A 3BR6A 4LLGF 3ML6A 3OY9A 5GPAA 1FNNA 3AKZA 2M4KA 3LAPA 1IXRC 2R7SA 3NWTA 1T2KA 3S14J 3K69A 3WTWC 3MD2A 2L54A 4IX7A 2I10A 4OIOF 1R4MB 5J4VA 3JRGA 2NVUB 4KITB 3ZMUA 3GTOJ 2LKXA 1OCZH 3CJTB 2DA1A 4XKVA 2V1XA 2VBWA 3TMOA 2QEXI 1ETVA 1ON1A 5F0HA 2RNGA 4Y52J 2ISYA 4M3BA 1WJBA 4A69C 1OLTA 3G71I 1YHQI 4B3XA 5F27A 1MNDA 4XNFA 2H1LA 2VJJA 4IKFA 3T0YA 1FBUA 1HDPA 2LP0A 3VYSB 4A3KJ 3VB2A 5HDNA 2VOOA 4JK1X 1K6OA 1S3JA 5A2QK 1FBQA 3RQ4A 3HOZJ 3CF2A 1MZBA 1SVLA 2P5VA 4CCMA 4GXOA 3LL7A 2R3SA 3E7LA 2LVSA 1DDNA 2WC2A 4OMYA 5D4RA 2R7ZJ 3NARA 4A3GJ 2ELKA 3CZ6A 3QAHA 2JA8J 4O5VA 2RKHA 4MNUA 2K5CA 3F23A 1R23A 2M87A 3RDIA 3RQIA 1XS9A 1SMYF 3OMYA 4N9IA 2ZB9A 1G4DA 1JJ8C 2J5PA 2OZUA 2QQAA 4I09A 5EGOA 2KDOA 3CUQB 4Q47A 3GXOA 4DW6A 2HPIA 2ECCA 2HI3A 5FO5A 2EFOA 3E6DA 2YX4A 2ZCWA 1N25A 1I39A 1BR4A 2YR2A 3FX3A 3MEXA 3S1RJ 2XGCA 4XLPF 1TWAJ 3U21A 2DT7B 4FASD 2DMQA 2G9WA 2IP2A 2EA2A 2H8WA 5CPRB 2L9NA 3G1LA 4NC8A 3ERED 2ZFWA 4CYCB 5EEGA 4FE4A 5EG0B 3I4MJ 1OFCX 1FX7A 2IBDA 5TJJA 2XAGA 4OAYA 4HF1A 4GYIA 1XCVA 4Y7NJ 5DCFA 2K85A 3HSFA 5DEQA 5HS9A 3WTZA 1FMWA 4IQ4A 3CJQB 2AXLA 1YJ9I 2G7HA 2F5DA 1MIJA 3JAMZ 3H0GJ 2DMTA 4UUTA 4S04A 2FD5A 2VBYA 2R5YA 1FLIA 2R7XA 2OF7A 2QM3A 4H0EA 5H20A 4E7JA 1RKWA 4HQMA 3G6EI 1YS6A 3FXMA 5H2FC 2ME6A 3BG6A 1H9TA 1WJ5A 4I0AA 1ZQ3P 2KT0A 2C6YA 4PFOA 3K4MA 4NBQA 4CZZA 3GF2A 4BBSJ 1M1EB 4HLYA 1A31A 1FWZA 1TQIA 2XF5A 4FHTA 3VYTB 3JREA 1VQPI 1L3LA 4IF4A 1RUNA 1S7EA 1XDSA 1MW7A 1VI0A 2LRDA 2XC7A 3FISA 5DDGA 2W82A
chains in the Genus database with same CATH topology
1JKPC 2E19A 2O9LA 5C3EJ 3BT9A 2M2EA 1MH3A 4JX5A 1GV5A 3GTLJ 1IUFA 1EF4A 2DMNA 2X6OA 5GP9A 5EZGA 3BQZA 5M5WJ 1JTXA 2LY9A 4I6ZA 2H1KA 2E2HJ 2XRLA 1CQTA 5HODA 4A3CJ 3ZQLA 2ID6A 5IOYA 2L7MP 5FKOA 3CDLA 2E1OA 1BA5A 1WCMJ 1E3OC 1X2NA 5F0FA 1POGA 3G1MA 1Y1WJ 2ME0A 2O7OA 1A6IA 1WGXA 1JKOC 3TP3A 3ZQHA 3LNQA 1U78A 3PO2J 1JJ6C 2RAEA 1MNMC 2HOTA 4HNVA 2WB1N 1I3QJ 4IHXA 1FTTA 1XC5A 1GVDA 3IH3A 2GM4A 4D7NA 4IEJA 2DN0A 2HYJA 3C2BA 3HKZN 2HOSA 1RR7A 4IHYA 4ABZA 1T56A 2LK2A 4MIMA 4D7MA 5EYRA 1UHSA 2EZHA 3M3YJ 4IHWA 3G1OA 5FKKA 3JRIA 2JWTA 1U9OA 1ZKGA 2ECBA 2NVXJ 3CQZJ 2OPTA 2GLOA 2LLKA 3HGYA 2DMUA 3FK6A 4C3HJ 4FTHA 5F04A 4UUSA 1DU0A 1AU7A 3BR5A 3BTIA 3HBLA 4AUXA 5K7FA 2XSDC 2JA7J 3GTPJ 3O8HA 1K61A 9ANTA 1FTZA 2EZLA 2L0KA 3PO3J 1QVTA 1H89C 3DEWA 1NK3P 1ETKA 3UKGA 1FIAA 1OCPA 4AC0A 3B6AA 1H88C 1Z77A 3TP0A 2W48A 2XB0X 2MW8A 4XICA 1P7IA 3W6VA 1WH7A 4IHVA 2ID3A 2AO9A 4X1EA 5C4XJ 2R92J 1JUMA 3TW6A 3PM1A 2DA3A 3JRCA 5IOZA 1TWHJ 3NAUA 1VF9A 4JP0A 1IV6A 1SANA 3B6CA 2CJJA 2EQRA 3GTJJ 1QRYA 3M4OJ 4B3AA 1YRNB 3HEFA 1IJWC 4B4CA 4MO7A 1ETOA 3ZQIA 3RZOJ 3BR3A 2Y31A 2PMZN 2KDZA 1PUFB 2XPUA 4MFDA 4BXXJ 1Y1VJ 1D5YA 3OIOA 3Q0WA 5FLVA 1B72A 4B1RA 2R0QC 2TRTA 1WH5A 4QIWN 1WI3A 2Y9ZA 4DYRA 1MSFC 3S2DJ 2XB5A 4V2GA 1P7JA 5F0CA 4M3FA 4A3FJ 2YUSA 5F08A 2CQXA 2XGEA 3FKIJ 3JRHA 2FX0A 1U8BA 1JKRC 2DMPA 4GFBA 3JRFA 2IAIA 2DA5A 3ZQCA 1ZR4A 3GTKJ 2X9DA 1AKHB 4BY1J 2VUMJ 3HGGA 5IP6A 2VI6A 4J19A 3A01B 1APLC 2VKEA 2DA7A 5EGOB 4CYCA 3MVPA 5EG0A 1RKTA 4C3IJ 4XIDA 2O8KA 1X58A 1HDDC 2M34A 1LFBA 1IDZA 5IYDJ 2JA5J 1ETWA 4W1UA 1O4XA 2DJNA 2K9NA 1Q1VA 3GBGA 4JYKA 3H3VK 1LFUP 1W0UA 1NK2P 2HDDA 1LE8B 1MBEA 4M3GA 3MN2A 2JK3A 3FIWA 5C44J 1TWGJ 1GV2A 3I4NJ 1BW5A 2H8RA 3TEDA 1MBFA 3F0CA 1BL0A 2VKVA 5EEAA 4RBOA 3HB9A 5C4JJ 5JLXA 1T33A 1ETQA 1XG1A 5E3NA 3JR9A 2Y30A 4V2FA 5J3LA 5J1RA 1H8AC 5K7HA 1NTCA 1W0TA 1FJLA 2YS9A 1UMQA 3A03A 2R5YB 3OSGA 1B8IB 2EH3A 3GTMJ 2VPRA 4S0HB 3ZQGA 2G0EA 1IRZA 5IPAA 1QPIA 2E2JJ 1HLVA 1I6HJ 2TCTA 2LR8A 2M9HA 1MSEC 1SFOJ 3BG3A 2WAQN 2Y9YA 2LTPA 3BR1A 2MSYA 5E3MA 1B72B 4A3EJ 4MFEA 4JX4A 1ENHA 3O8GA 4FCYA 1GDTA 2L7ZA 1MBKA 2R5ZB 3HOYJ 3IV5A 2NS8A 2MG4A 3D1NI 3WHBA 3BR0A 3ZOBA 3S2HJ 4FE7A 1WPKA 5EDNA 1JUPA 2HOAA 1TC3C 5E3OA 2L9RA 4NDLA 4BKXA 1HF0A 3LSRA 5FKNA 2R93J 4BBRJ 2YU9J 1GUUA 5J1UA 1IG7A 4A93J 3HOUJ 5M3MJ 4M3DA 4A3MJ 1K83J 2LFBA 2NOGA 1ETYA 3HM5A 3TW7A 1HCRA 4C2MJ 1F36A 4M6VA 1JUSA 3HOXJ 2Y0SN 2K9SA 1ETXA 3CCYA 5IYCJ 2DTZA 4XRSG 1OCTC 3K2AA 3S1QJ 2D5VA 3BG5A 4RDUA 2CQQA 2JMWA 5M5XJ 4C3JJ 3CMYA 1MBHA 1GT0C 3LOCA 5M3FJ 4D5FA 5M5YJ 2WV1A 2COBA 3GTGJ 3BTLA 1ZGWA 3L1PA 5DTDA 4DZPA 1ZR2A 3OSFA 3Q0VA 5FKLA 4LOCA 2XGDA 1TWFJ 2Y2ZA 3JRAA 3HOVJ 1JKQC 1FEXA 5J1YA 1VNDA 2HXOA 4W97A 2MGQA 3GTQJ 5K7ZA 5IP7J 4A3DJ 3BR6A 5FKMA 3BTCA 5GPAA 2JJ7A 4XRSA 3JRBA 3S14J 5JLWA 2LD5A 1RPWA 3Q0UA 3S15J 1IGNA 4UUSB 3JRDA 2DA6A 2I10A 2GBYA 2CRGA 2HQ5A 2M0CA 3HOWJ 4A3IJ 3JRGA 3GTOJ 1U9NA 1JT0A 2LKXA 3WHCA 3BTJA 2EZIA 2M8GX 2DA1A 2XPWA 4XRMA 5BNGA 3SDGA 4I76A 1A5JA 1ORKA 1ZK8A 3RKQA 1ETVA 5F0HA 3FK7A 2E2IJ 4FISA 4Y52J 1JGGA 1DU6A 1YRNA 4M3BA 4D5CA 1VFCA 4A69C 4QSHA 5FLMJ 1HOMA 1PUFA 1IC8A 3S1NJ 2NVQJ 5F27A 3DCFA 3RZDJ 4A3LJ 2IEKA 2DA4A 1HDPA 2LP0A 5F1JA 4A3KJ 5EZHA 1R9TJ 2CU7A 4DZJA 5IYBJ 3IH4A 3HOZJ 4A3BJ 3MKLA 5GPCA 3LSPA 2N8GA 4M3EA 4XK4A 3QPSA 3BG9A 2EZKA 3E7LA 2LVSA 2FJ1A 4DYQA 3S1MJ 3S16J 3QQAA 2R7ZJ 3S17J 3NARA 4A3GJ 2QF7A 2ELKA 4L5EA 2JA8J 2CUEA 1JT6A 1QVUA 1AKHA 3A02A 1Z0XA 3RQIA 1RESA 1XS9A 3A01A 1FIPA 2ZB9A 2X48A 3K7AJ 3LSGA 1JJ8C 3Q3SA 5EGOA 4G12A 2FQ4A 3VPRA 3HDDA 2QCOA 4DW6A 2ECCA 2HI3A 4BY7J 4QTRA 2NVYJ 2EBIA 3S1RJ 1OJLA 2XGCA 1TWAJ 4MLOA 1MH4A 2XPVA 1AHDP 2DMQA 2B63J 1F43A 1G2HA 2DA2A 3SFIA 3G1LA 1LE8A 4DYCA 4CYCB 4FE4A 5EG0B 4AYBN 3I4MJ 1OFCX 2JN6A 2IBDA 1MBGA 3LSJA 2K40A 3SJMA 4EEFG 4Y7NJ 3ZQFA 4A3JJ 1BW6A 3IH2A 2NVTJ 2NS7A 3BR2A 1ITYA 3H0GJ 2DMTA 4UUTA 2AHQA 2FD5A 2HXIA 5E3LA 1TWCJ 5IP9J 2R5YA 2OF7A 1I50J 1B8IA 2CUFA 3BQYA 1UG2A 2JA6J 1JTYA 2P81A 5EF6A 1RKWA 1BJZA 2ME6A 1ZQ3P 2KT0A 2K9QA 5FJ8J 3QPLA 3OOUA 1X2MA 1MBJA 4BBSJ 3JREA 4X6AJ 1S7EA 1ZTRA 2L7FP 2R5ZA 1VI0A 3FISA 5DS9A 1RETA 1IDYA 4JX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKP C;  2E19 A;  2O9L A;  5C3E J;  3BT9 A;  2M2E A;  1MH3 A;  4JX5 A;  1GV5 A;  3GTL J;  1IUF A;  1EF4 A;  2DMN A;  2X6O A;  5GP9 A;  5EZG A;  3BQZ A;  5M5W J;  1JTX A;  2LY9 A;  4I6Z A;  2H1K A;  2E2H J;  2XRL A;  1CQT A;  5HOD A;  4A3C J;  3ZQL A;  2ID6 A;  5IOY A;  2L7M P;  5FKO A;  3CDL A;  2E1O A;  1BA5 A;  1WCM J;  1E3O C;  1X2N A;  5F0F A;  1POG A;  3G1M A;  1Y1W J;  2ME0 A;  2O7O A;  1A6I A;  1WGX A;  1JKO C;  3TP3 A;  3ZQH A;  3LNQ A;  1U78 A;  3PO2 J;  1JJ6 C;  2RAE A;  1MNM C;  2HOT A;  4HNV A;  2WB1 N;  1I3Q J;  4IHX A;  1FTT A;  1XC5 A;  1GVD A;  3IH3 A;  2GM4 A;  4D7N A;  4IEJ A;  2DN0 A;  2HYJ A;  3C2B A;  3HKZ N;  2HOS A;  1RR7 A;  4IHY A;  4ABZ A;  1T56 A;  2LK2 A;  4MIM A;  4D7M A;  5EYR A;  1UHS A;  2EZH A;  3M3Y J;  4IHW A;  3G1O A;  5FKK A;  3JRI A;  2JWT A;  1U9O A;  1ZKG A;  2ECB A;  2NVX J;  3CQZ J;  2OPT A;  2GLO A;  2LLK A;  3HGY A;  2DMU A;  3FK6 A;  4C3H J;  4FTH A;  5F04 A;  4UUS A;  1DU0 A;  1AU7 A;  3BR5 A;  3BTI A;  3HBL A;  4AUX A;  5K7F A;  2XSD C;  2JA7 J;  3GTP J;  3O8H A;  1K61 A;  9ANT A;  1FTZ A;  2EZL A;  2L0K A;  3PO3 J;  1QVT A;  1H89 C;  3DEW A;  1NK3 P;  1ETK A;  3UKG A;  1FIA A;  1OCP A;  4AC0 A;  3B6A A;  1H88 C;  1Z77 A;  3TP0 A;  2W48 A;  2XB0 X;  2MW8 A;  4XIC A;  1P7I A;  3W6V A;  1WH7 A;  4IHV A;  2ID3 A;  2AO9 A;  4X1E A;  5C4X J;  2R92 J;  1JUM A;  3TW6 A;  3PM1 A;  2DA3 A;  3JRC A;  5IOZ A;  1TWH J;  3NAU A;  1VF9 A;  4JP0 A;  1IV6 A;  1SAN A;  3B6C A;  2CJJ A;  2EQR A;  3GTJ J;  1QRY A;  3M4O J;  4B3A A;  1YRN B;  3HEF A;  1IJW C;  4B4C A;  4MO7 A;  1ETO A;  3ZQI A;  3RZO J;  3BR3 A;  2Y31 A;  2PMZ N;  2KDZ A;  1PUF B;  2XPU A;  4MFD A;  4BXX J;  1Y1V J;  1D5Y A;  3OIO A;  3Q0W A;  5FLV A;  1B72 A;  4B1R A;  2R0Q C;  2TRT A;  1WH5 A;  4QIW N;  1WI3 A;  2Y9Z A;  4DYR A;  1MSF C;  3S2D J;  2XB5 A;  4V2G A;  1P7J A;  5F0C A;  4M3F A;  4A3F J;  2YUS A;  5F08 A;  2CQX A;  2XGE A;  3FKI J;  3JRH A;  2FX0 A;  1U8B A;  1JKR C;  2DMP A;  4GFB A;  3JRF A;  2IAI A;  2DA5 A;  3ZQC A;  1ZR4 A;  3GTK J;  2X9D A;  1AKH B;  4BY1 J;  2VUM J;  3HGG A;  5IP6 A;  2VI6 A;  4J19 A;  3A01 B;  1APL C;  2VKE A;  2DA7 A;  5EGO B;  4CYC A;  3MVP A;  5EG0 A;  1RKT A;  4C3I J;  4XID A;  2O8K A;  1X58 A;  1HDD C;  2M34 A;  1LFB A;  1IDZ A;  5IYD J;  2JA5 J;  1ETW A;  4W1U A;  1O4X A;  2DJN A;  2K9N A;  1Q1V A;  3GBG A;  4JYK A;  3H3V K;  1LFU P;  1W0U A;  1NK2 P;  2HDD A;  1LE8 B;  1MBE A;  4M3G A;  3MN2 A;  2JK3 A;  3FIW A;  5C44 J;  1TWG J;  1GV2 A;  3I4N J;  1BW5 A;  2H8R A;  3TED A;  1MBF A;  3F0C A;  1BL0 A;  2VKV A;  5EEA A;  4RBO A;  3HB9 A;  5C4J J;  5JLX A;  1T33 A;  1ETQ A;  1XG1 A;  5E3N A;  3JR9 A;  2Y30 A;  4V2F A;  5J3L A;  5J1R A;  1H8A C;  5K7H A;  1NTC A;  1W0T A;  1FJL A;  2YS9 A;  1UMQ A;  3A03 A;  2R5Y B;  3OSG A;  1B8I B;  2EH3 A;  3GTM J;  2VPR A;  4S0H B;  3ZQG A;  2G0E A;  1IRZ A;  5IPA A;  1QPI A;  2E2J J;  1HLV A;  1I6H J;  2TCT A;  2LR8 A;  2M9H A;  1MSE C;  1SFO J;  3BG3 A;  2WAQ N;  2Y9Y A;  2LTP A;  3BR1 A;  2MSY A;  5E3M A;  1B72 B;  4A3E J;  4MFE A;  4JX4 A;  1ENH A;  3O8G A;  4FCY A;  1GDT A;  2L7Z A;  1MBK A;  2R5Z B;  3HOY J;  3IV5 A;  2NS8 A;  2MG4 A;  3D1N I;  3WHB A;  3BR0 A;  3ZOB A;  3S2H J;  4FE7 A;  1WPK A;  5EDN A;  1JUP A;  2HOA A;  1TC3 C;  5E3O A;  2L9R A;  4NDL A;  4BKX A;  1HF0 A;  3LSR A;  5FKN A;  2R93 J;  4BBR J;  2YU9 J;  1GUU A;  5J1U A;  1IG7 A;  4A93 J;  3HOU J;  5M3M J;  4M3D A;  4A3M J;  1K83 J;  2LFB A;  2NOG A;  1ETY A;  3HM5 A;  3TW7 A;  1HCR A;  4C2M J;  1F36 A;  4M6V A;  1JUS A;  3HOX J;  2Y0S N;  2K9S A;  1ETX A;  3CCY A;  5IYC J;  2DTZ A;  4XRS G;  1OCT C;  3K2A A;  3S1Q J;  2D5V A;  3BG5 A;  4RDU A;  2CQQ A;  2JMW A;  5M5X J;  4C3J J;  3CMY A;  1MBH A;  1GT0 C;  3LOC A;  5M3F J;  4D5F A;  5M5Y J;  2WV1 A;  2COB A;  3GTG J;  3BTL A;  1ZGW A;  3L1P A;  5DTD A;  4DZP A;  1ZR2 A;  3OSF A;  3Q0V A;  5FKL A;  4LOC A;  2XGD A;  1TWF J;  2Y2Z A;  3JRA A;  3HOV J;  1JKQ C;  1FEX A;  5J1Y A;  1VND A;  2HXO A;  4W97 A;  2MGQ A;  3GTQ J;  5K7Z A;  5IP7 J;  4A3D J;  3BR6 A;  5FKM A;  3BTC A;  5GPA A;  2JJ7 A;  4XRS A;  3JRB A;  3S14 J;  5JLW A;  2LD5 A;  1RPW A;  3Q0U A;  3S15 J;  1IGN A;  4UUS B;  3JRD A;  2DA6 A;  2I10 A;  2GBY A;  2CRG A;  2HQ5 A;  2M0C A;  3HOW J;  4A3I J;  3JRG A;  3GTO J;  1U9N A;  1JT0 A;  2LKX A;  3WHC A;  3BTJ A;  2EZI A;  2M8G X;  2DA1 A;  2XPW A;  4XRM A;  5BNG A;  3SDG A;  4I76 A;  1A5J A;  1ORK A;  1ZK8 A;  3RKQ A;  1ETV A;  5F0H A;  3FK7 A;  2E2I J;  4FIS A;  4Y52 J;  1JGG A;  1DU6 A;  1YRN A;  4M3B A;  4D5C A;  1VFC A;  4A69 C;  4QSH A;  5FLM J;  1HOM A;  1PUF A;  1IC8 A;  3S1N J;  2NVQ J;  5F27 A;  3DCF A;  3RZD J;  4A3L J;  2IEK A;  2DA4 A;  1HDP A;  2LP0 A;  5F1J A;  4A3K J;  5EZH A;  1R9T J;  2CU7 A;  4DZJ A;  5IYB J;  3IH4 A;  3HOZ J;  4A3B J;  3MKL A;  5GPC A;  3LSP A;  2N8G A;  4M3E A;  4XK4 A;  3QPS A;  3BG9 A;  2EZK A;  3E7L A;  2LVS A;  2FJ1 A;  4DYQ A;  3S1M J;  3S16 J;  3QQA A;  2R7Z J;  3S17 J;  3NAR A;  4A3G J;  2QF7 A;  2ELK A;  4L5E A;  2JA8 J;  2CUE A;  1JT6 A;  1QVU A;  1AKH A;  3A02 A;  1Z0X A;  3RQI A;  1RES A;  1XS9 A;  3A01 A;  1FIP A;  2ZB9 A;  2X48 A;  3K7A J;  3LSG A;  1JJ8 C;  3Q3S A;  5EGO A;  4G12 A;  2FQ4 A;  3VPR A;  3HDD A;  2QCO A;  4DW6 A;  2ECC A;  2HI3 A;  4BY7 J;  4QTR A;  2NVY J;  2EBI A;  3S1R J;  1OJL A;  2XGC A;  1TWA J;  4MLO A;  1MH4 A;  2XPV A;  1AHD P;  2DMQ A;  2B63 J;  1F43 A;  1G2H A;  2DA2 A;  3SFI A;  3G1L A;  1LE8 A;  4DYC A;  4CYC B;  4FE4 A;  5EG0 B;  4AYB N;  3I4M J;  1OFC X;  2JN6 A;  2IBD A;  1MBG A;  3LSJ A;  2K40 A;  3SJM A;  4EEF G;  4Y7N J;  3ZQF A;  4A3J J;  1BW6 A;  3IH2 A;  2NVT J;  2NS7 A;  3BR2 A;  1ITY A;  3H0G J;  2DMT A;  4UUT A;  2AHQ A;  2FD5 A;  2HXI A;  5E3L A;  1TWC J;  5IP9 J;  2R5Y A;  2OF7 A;  1I50 J;  1B8I A;  2CUF A;  3BQY A;  1UG2 A;  2JA6 J;  1JTY A;  2P81 A;  5EF6 A;  1RKW A;  1BJZ A;  2ME6 A;  1ZQ3 P;  2KT0 A;  2K9Q A;  5FJ8 J;  3QPL A;  3OOU A;  1X2M A;  1MBJ A;  4BBS J;  3JRE A;  4X6A J;  1S7E A;  1ZTR A;  2L7F P;  2R5Z A;  1VI0 A;  3FIS A;  5DS9 A;  1RET A;  1IDY A;  4JX6 A; 
#chains in the Genus database with same CATH topology
 1JGS A;  3BCB A;  2O9L A;  1K79 A;  3DPU A;  1UCR A;  2DBB A;  3IP4 B;  2M2E A;  1BR1 A;  3LA7 A;  2V6E A;  3DTE A;  3GTL J;  4AD9 A;  2DCE A;  3KCC A;  3I59 A;  2DMN A;  4CDG A;  2PMH A;  3X2Q H;  4M9X A;  5EZG A;  2VT2 A;  5ICC A;  2JZY A;  3BQZ A;  3IC7 A;  3CCL I;  2WTE A;  5M5W J;  4IXA A;  2LY9 A;  4I6Z A;  3WTU C;  3MFK A;  4KYW A;  5HOD A;  5D8L B;  1Y0U A;  3IAS 2;  3ZQL A;  2ID6 A;  5JI6 A;  2MFZ A;  1BN5 A;  2K3F A;  5FKO A;  3U9G A;  2VJI A;  4L0Y B;  4KUM A;  2L4M A;  2H94 A;  2MYS A;  3G1M A;  4PUS A;  2O7O A;  2VKH A;  4P5O A;  1JKO C;  2IGK A;  1XX5 A;  1B9M A;  3BLY A;  4LMY A;  2FQ3 A;  2LF8 A;  5HNH A;  2VQG A;  2F5V A;  3IKV A;  3CUQ C;  4KMF A;  5LRR A;  5GTH C;  2Y0M A;  3WTS C;  4BXU A;  2VT3 A;  2WB1 N;  2OD5 A;  2IGO A;  4DBQ A;  4ENJ A;  5CQE A;  1TW3 A;  2JQ7 A;  3PQK A;  2QQB A;  4IRG A;  4L9T A;  3GFI A;  2DN0 A;  3J7A O;  3L7W A;  2NNY A;  1WJC A;  1IRF A;  2DFH A;  2LK2 A;  4JQF A;  4N4N B;  3C2H A;  4MIM A;  5EYR A;  2QA4 I;  4AU7 A;  5J8F A;  3K70 D;  2OV7 A;  1ZKG A;  3SEZ A;  4DNC A;  2OPT A;  3A1Y A;  2LLK A;  2JSC A;  3ASO H;  5K1Y A;  1Y8R B;  2VOP A;  4BQA A;  1OYY A;  1BOB A;  2O8X A;  3KP6 A;  3S3M A;  1YX5 A;  2XSJ C;  2VJ5 A;  3BTI A;  4AUX A;  4BAY A;  3MZH A;  2XSD C;  4XL9 A;  3GCM A;  1R49 A;  1K61 A;  2L01 A;  1OIS A;  2F5E A;  3TKY A;  1H89 C;  1XSX A;  1R5G A;  5BOX A;  2LNB A;  1QO0 D;  4UV8 A;  2P5K A;  2HR3 A;  2K4B A;  4XRF A;  3TQN A;  2X6X A;  2W7N A;  5LLQ A;  1SFE A;  3OYD A;  4L0Z B;  1G3S A;  3TW6 A;  3MAJ A;  2DA3 A;  2QSH X;  3DTK A;  1QZE A;  2IT0 A;  3B6C A;  1K7A A;  1LUJ B;  3GTJ J;  1LDK B;  1MD0 A;  1CF7 B;  2OQG A;  4LK1 F;  4BJ6 C;  4QPO A;  4B4C A;  4LLL A;  3SQN A;  2V1D A;  1ETO A;  3OR2 C;  1VQM I;  3MWM A;  1WJE A;  2HKX A;  1A04 A;  1U5T C;  3MQ0 A;  4FET A;  4B1R A;  2XAU A;  3OYG A;  2GIV A;  2OQR A;  4AYB A;  3KZY A;  1MJ9 A;  1FYM A;  1AOY A;  4QIW N;  3E1S A;  3F22 A;  2KRC A;  2BY2 A;  2V79 A;  1PJR A;  4XR6 A;  3BZK A;  5D5W B;  3OWT A;  5K5R A;  3S2D J;  2OU2 A;  2XB5 A;  3A0H C;  1VQ8 I;  1P7J A;  4MQ9 F;  2XGE A;  3ABL H;  3ZMT A;  3CUQ A;  4EM1 A;  3OYH A;  3ZMS A;  1YS7 A;  4KIF A;  3LA2 A;  4CA0 A;  3OL4 A;  4AID A;  1L0O C;  4G6T B;  4GO1 A;  3W2W A;  2UV1 A;  3FMQ A;  3I54 A;  1D8K A;  1FBS A;  5L3E A;  5BPD A;  4MTD A;  2OCC H;  4BY1 J;  2RQP A;  1FSH A;  1KQ9 A;  2VI6 A;  1B59 A;  1SVM A;  1J2X A;  1DPU A;  2DDA A;  2IVM A;  4CYC A;  1WJD A;  2F4I A;  5EG0 A;  1RKT A;  2VB6 A;  5JVG F;  2M34 A;  3TO6 A;  5LHI A;  1YJW I;  2RDP A;  3O3K A;  3EET A;  4W1U A;  1O4X A;  4I01 A;  2LBF A;  1OKR A;  3MZ8 A;  3GBG A;  1X3W B;  3I3L A;  3H3V K;  4G9Y A;  2BVL A;  2E36 A;  2MBF A;  1W0U A;  1W36 C;  3NEU A;  3KEQ A;  3N05 A;  4OWR B;  1UEL B;  3PNT A;  1G3W A;  3C3W A;  3MN2 A;  2JK3 A;  3FIW A;  3NWS A;  5FD5 A;  3ZCO A;  1IXS B;  4RMN A;  3DKX A;  1BW5 A;  4M73 A;  3M8E A;  4F3Q A;  1MBF A;  1CGP A;  3HZJ A;  4U0W A;  2KP6 A;  4RBO A;  4KDP A;  1BIA A;  2DPU A;  5JLX A;  1XG1 A;  1BI2 A;  2K3P A;  4Y4R A;  3JR9 A;  5J3L A;  3CD6 I;  3KP5 A;  2HPM A;  3AG1 H;  4BUP A;  2WV0 A;  1W0T A;  3BDD A;  2X0L A;  1ZG5 A;  3A4C A;  4L9J A;  4H4K C;  2WWY A;  2EH3 A;  1GHC A;  1ZYR F;  1RC9 A;  2I8D A;  2DFE A;  3K10 A;  4GDF A;  5IPA A;  4XLF A;  4RLF A;  3OR1 C;  2ZO4 A;  1E3P A;  4XKC A;  4ESF A;  2AQE A;  4HX8 A;  1HLV A;  1I6H J;  2K9M A;  4J00 A;  2FUG 2;  1FY7 A;  1SFO J;  4U7B A;  3H1C A;  3R0A A;  4HX7 A;  2O0Y A;  2EWN A;  2Z33 A;  1ENH A;  4LB5 A;  3CMM A;  3O6B B;  3WG9 A;  3IV5 A;  2X1D A;  3WHB A;  3S2H J;  3ZOB A;  2P7V B;  5EDN A;  4LIV A;  1U5T A;  1JUP A;  2HOA A;  1TC3 C;  5E3O A;  1OMI A;  4BH9 A;  1LPQ A;  1HF0 A;  2IA1 A;  4E7Z A;  2M5W A;  2ZXH A;  4CXF A;  4Y3O A;  4HDU A;  1GXQ A;  5FKN A;  3K1M A;  3BJO A;  5J1U A;  1ZRF A;  3CC4 I;  1SD6 A;  3CUO A;  2E1M B;  3TOB A;  4MQV A;  1K83 J;  1XMK A;  3J7Y J;  3HM5 A;  1HCR A;  4M6V A;  4P9F A;  1NH3 A;  1JUS A;  5B1B H;  4K2E A;  5IYC J;  4C2T A;  4XRS G;  1OCT C;  3T8T A;  2IS1 A;  3RJP A;  2CQQ A;  3KIO A;  5F6F A;  5M5X J;  1SC7 A;  1V54 H;  1HKQ A;  2PMU A;  2ISZ A;  5L3B A;  2V6C A;  5M3F J;  5M5Y J;  2F48 A;  2COB A;  3K4K A;  3BTL A;  1ZGW A;  1MJA A;  2KIQ A;  1B4A A;  3P5J A;  2KZG A;  1FZP B;  4OOI A;  5L3G A;  1LKX A;  1ZR2 A;  1TNT A;  3HSR A;  3Q0V A;  1WQ2 A;  2ACJ A;  5FKL A;  4LOC A;  2HYG D;  1OCO H;  3JRA A;  4AM3 A;  5FD6 A;  1VND A;  2VKD A;  2DK8 A;  4C9Y A;  1FSE A;  2WY7 Q;  3ECO A;  3MZY A;  4O6J A;  1ULY A;  4ZZD A;  3KEY A;  3FZV A;  5GAE J;  5ERI A;  1S29 A;  2DTR A;  1YIO A;  4BHP A;  2JJ7 A;  2PMZ A;  2HOE A;  5CVJ A;  5E20 A;  4XRS A;  3VYU B;  1XDU A;  2KKO A;  5HS7 A;  2R7U A;  5JLW A;  2FBI A;  3Q0U A;  2EFW A;  3S15 J;  5ILV A;  3SZP A;  5FRO A;  3F6O A;  3FXO A;  2EV0 A;  3MKY B;  2XAF A;  4A0Z A;  4G7Z F;  5DD4 A;  1U9N A;  4WXD A;  1JT0 A;  5A2Q Z;  5B1A H;  3CCM I;  1DGW Y;  3WE3 A;  1Z05 A;  1ORK A;  2VL8 A;  2D45 A;  2QYO A;  1ZK8 A;  3DU5 A;  3H0D A;  3RKQ A;  3S2W A;  4ZYA A;  2E2I J;  2BEO A;  2CYY A;  1Y8Q B;  3OYE A;  1CF7 A;  1LDJ A;  3CC7 I;  1F5T A;  3OS2 A;  1R22 A;  4KA4 A;  1KQ0 A;  2NYX A;  3H35 A;  4E7I A;  2NVQ J;  1D1B A;  1X4P A;  4UVB A;  3DCF A;  3RZD J;  4N4O B;  1A35 A;  3HIF A;  4DOZ A;  2DA4 A;  1ZHF A;  5F1J A;  2DT5 A;  5EZH A;  5CVU A;  1RRJ A;  3BY6 A;  3ZR8 X;  4DZJ A;  3I53 A;  2E34 A;  1NHA A;  3V4G A;  3IAM 2;  3P9K A;  4MEY F;  3CLQ A;  3UR3 C;  3LSP A;  2N8G A;  2A05 A;  2A69 F;  4C2U A;  3QPS A;  2E1M C;  1FOK A;  3I64 A;  2JSP A;  4RB1 A;  3F72 A;  3RKY A;  4DYQ A;  3FM3 A;  1ZAO A;  3S16 J;  3P9I A;  3QQA A;  2A07 F;  3I0T A;  3IL2 A;  3S17 J;  2RN7 A;  2MA3 A;  1YG2 A;  1JT6 A;  4EJU A;  3K0L A;  3CCR I;  3A02 A;  1BR2 A;  2ZME B;  3CES A;  1RES A;  1ZLJ A;  5DCM B;  2HTS A;  2X48 A;  3E5Q A;  3Q3S A;  4G12 A;  1TBX A;  3FBI B;  3GLX A;  3ISP A;  2JPB A;  2F5F A;  2V1N A;  2OC6 A;  2CW7 A;  4CYD A;  1JHH A;  4WF2 A;  4BE1 A;  2HNH A;  3D0S A;  1O3Q A;  5D8K B;  4GYG A;  1IRX A;  3WTT C;  1XSV A;  2EIN H;  4MLO A;  4LIU A;  3KP3 A;  1J9I A;  2PJP A;  3SFI A;  1R1U A;  2K27 A;  4X0G A;  2DU9 A;  4AYB N;  2BZT A;  3CJN A;  4F91 B;  3COA C;  1MBG A;  2K40 A;  1S5L C;  4CCK A;  2HZD A;  2KMU A;  5LRS A;  4OAZ A;  2FBH A;  2LH9 A;  5DM6 F;  4A3J J;  4IL6 C;  1S8N A;  3I55 I;  1BW6 A;  1V55 H;  3I5U A;  1ITY A;  5J47 A;  3T1B A;  2AHQ A;  3E5X A;  1R58 A;  1P4W A;  1TWC J;  3D5R C;  3T5X A;  1JTY A;  3JSO A;  2P81 A;  3AL0 B;  5EF6 A;  3LSH A;  4I02 A;  2OBP A;  4A2U A;  1BJZ A;  3BZC A;  2VIX A;  4IRH A;  5HVQ C;  1ERD A;  3K2Z A;  3QPL A;  2KFD A;  1MBJ A;  1O57 A;  4PGG A;  3GX4 X;  2IPQ X;  1YW8 A;  4X6A J;  4KT6 A;  4RB0 A;  3RI4 A;  2L7F P;  3BOQ A;  1MNE A;  4NQW B;  3KET A;  2Z16 A;  4RAZ A;  4U0V A;  2HVQ A;  1RET A;  3GZ5 A;  2FBK A;  5CYV A;  3I9V 2;  4EJV A;  1JKP C;  3AG2 H;  2K02 A;  4L9N A;  4UY8 I;  2E19 A;  3BWG A;  3TL4 X;  1PP7 U;  3O2P E;  2BVM A;  4JX5 A;  1TQM A;  1T08 B;  4G6Q A;  4FX0 A;  2DAO A;  4DJA A;  2L02 A;  3E6M A;  4RB2 C;  3J80 Z;  4L5I A;  3QOD A;  2Z99 A;  2Q1Z B;  5HS8 A;  1R1V A;  1LVK A;  2R4G A;  2E2H J;  3OOP A;  2XRL A;  4Q5S F;  4V19 K;  3ZMV A;  2DO7 A;  3DQV C;  4U7D A;  3ZMD A;  3KP4 A;  4UNO A;  3PNV A;  3I71 A;  5IOY A;  2L7M P;  1XPX A;  2E1O A;  1BA5 A;  1S7O A;  4XN3 A;  3LSK A;  1MMG A;  3DKW A;  3H5R A;  5F0F A;  1IN8 A;  2LMD A;  1BI1 A;  2WAE A;  3LMM A;  3TP3 A;  3ZQH A;  3RSN A;  4ESB A;  3CCU I;  4M6X A;  1JJ6 C;  3DXJ F;  2RAE A;  1REP C;  3DFG A;  3BPX A;  4M74 A;  2HOT A;  2GOM A;  3DBR B;  1FOY A;  2O61 A;  1FTT A;  1GVD A;  3CP8 A;  3R4K A;  1MDM B;  2HYJ A;  2QGU A;  2HOS A;  4IHT A;  2FMY A;  1R00 A;  3KEO A;  3SZT A;  4HPQ A;  4IHW A;  3WG7 H;  1ZRD A;  1U9O A;  2XAJ A;  1BBY A;  3E6B A;  5GTI C;  2R7D A;  4BXF A;  5FFX A;  4F7Z A;  2GLO A;  2EK5 A;  2W00 A;  3QOE A;  1D1C A;  2DMU A;  4C3H J;  5F04 A;  2M1B A;  2QQ8 A;  2DYR H;  1XGS A;  3HBL A;  5K7F A;  1TQP A;  1BOA A;  2MLK A;  2JA7 J;  3O8H A;  1J59 A;  3QU3 A;  9ANT A;  4PCQ A;  5HLH A;  2EZL A;  1O3T A;  2L0K A;  4ON0 A;  1QVT A;  2YSR A;  3PO3 J;  3DEW A;  2PG4 A;  1ETK A;  3F6V A;  2P7C B;  1FIA A;  1DP7 P;  2LDU A;  2BY0 A;  5ED4 A;  2KIU A;  1OYI A;  1UAA A;  4AC0 A;  3B6A A;  1JXS A;  3TP0 A;  4XIC A;  1SVO A;  1OQY A;  3HUG B;  3L00 A;  5AIQ A;  2ID3 A;  2AO9 A;  2KJB A;  3L9F A;  2VJ4 A;  1K4T A;  4BHC A;  2X1C A;  1EA3 A;  5JR3 A;  3WOD F;  3KZI C;  2O03 A;  2PFB A;  1MGT A;  2R7T A;  3H5N A;  5IOZ A;  1D8J A;  3NAU A;  1KZH A;  4KT5 C;  2V26 A;  1T38 A;  4NC7 A;  5J6X A;  3TDZ C;  4WWC A;  3H9G A;  1Y6I A;  1YRN B;  1SFX A;  2XV4 S;  5IT3 A;  4UUV A;  4MO7 A;  1QQI A;  3W2A A;  2Y31 A;  2PMZ N;  3ESW B;  3FKJ A;  4EJO A;  5LEJ A;  4XN0 A;  2CV0 A;  2FF4 A;  4RM3 A;  1D5Y A;  2CGP A;  2IS2 A;  1GLN A;  1HBX G;  2GIZ A;  5FLV A;  5DUK A;  1SAX A;  1B72 A;  2K86 A;  2ZFU A;  3MCZ A;  2R0Q C;  3M9A A;  1YYV A;  4EV0 A;  5CQG A;  3PIO F;  5E1X A;  2L5Q A;  3D5L A;  4G8X A;  3QU6 A;  2HGC A;  2NS0 A;  4G7H F;  2Y9Z A;  1RUO A;  2KIM A;  3F8C A;  5B66 C;  5DCM A;  3RKX A;  4A3F J;  5KVR A;  1OPC A;  3FKI J;  2XUB A;  2VQH A;  1JKR C;  4GFB A;  2LKS A;  2O3F A;  3JRF A;  2STW A;  3NRV A;  3N97 A;  3BC8 A;  1ZR4 A;  2X9D A;  3H9Q A;  2VUM J;  1BJA A;  4OU0 A;  1FOW A;  2FNA A;  3PIP F;  3QRF F;  2VE9 A;  1PDN C;  3FBN B;  3C1D A;  1PP8 F;  4BHB A;  4J19 A;  4II3 A;  1QPM A;  1APL C;  2KQR A;  3MMY B;  4CCJ A;  1XN7 A;  4D1Q A;  3G4S I;  4IRI A;  5ILS A;  4G94 A;  4ZDO A;  4C3I J;  1X58 A;  2ELH A;  5K5O A;  4CCO A;  1IZ1 A;  1IDZ A;  2ADU A;  5GAG J;  3V8J A;  1MMD A;  2DJN A;  2VXZ A;  2K9N A;  4JYK A;  3RCO A;  4UXN A;  1NK2 P;  4NHJ A;  2M7A A;  2HU9 A;  4L9V A;  3K1N A;  3VYR B;  1LE8 B;  5C44 J;  3J80 K;  1GV2 A;  2FEZ A;  2IA2 A;  3TED A;  2XKO A;  1EKE A;  4QWQ A;  2VKV A;  5EEA A;  2PLY A;  2DOA A;  5C4J J;  1T33 A;  1ETQ A;  2BBY A;  2QZ8 A;  5FGM A;  2Y30 A;  5HLG A;  3I58 A;  2VAS A;  5E8G A;  1SD5 A;  4KMU X;  4PZJ A;  4F52 A;  3WGI A;  2MC3 A;  1R4N B;  1UMQ A;  1VQK I;  1EH8 A;  1B8I B;  4S0H B;  4ZJZ A;  4AIJ A;  3J81 K;  1IRZ A;  4PK4 A;  4XLH A;  1WI9 A;  1NG6 A;  1IN5 A;  1D1A A;  2M9H A;  1MSE C;  3OIQ A;  4LGW A;  5B5E C;  5H6Q A;  4AVZ A;  3BG3 A;  2Y9Y A;  3BR1 A;  1V5F A;  2MSY A;  3CCV I;  4HLX A;  2MAB A;  4MFE A;  4JX4 A;  2EIJ H;  3RPU D;  3O8G A;  4XMY A;  4CCN A;  1GDT A;  2L7Z A;  3JW4 A;  3M1C A;  2R5Z B;  3CTA A;  3BPV A;  4HAM A;  2Q0O A;  2A6H F;  4YII A;  5AON A;  3ZN0 A;  2X6Y A;  4E4H A;  3HKZ A;  1W1W E;  3V8K A;  4ZTJ A;  2E60 A;  3GME A;  2L9R A;  4F93 B;  3CJR B;  4BKX A;  2ZJQ F;  2AQF A;  2COM A;  4PJJ A;  3LST A;  1IN6 A;  5EEH A;  2FU4 A;  4BBR J;  2YU9 J;  4I99 C;  3AG3 H;  3F8N A;  4JBA A;  1N75 A;  2WY8 Q;  1SMT A;  1F1Z A;  3P9C A;  4Q4Z F;  1XMA A;  3ZMZ A;  4D0P A;  2NOG A;  2CFX A;  4BNC A;  1D0Y A;  2XRO A;  3TW7 A;  2NOJ B;  4XLE A;  3HRU A;  1OYW A;  2E35 A;  1WHU A;  2CQ7 A;  3GW2 A;  3L2V A;  1I6X A;  1X1A A;  4YFN F;  1R5H A;  2NRA C;  1KA8 A;  1IF1 A;  2RNJ A;  4P1W A;  1X1P A;  2OCE A;  4U87 A;  4EVI A;  4U0Y A;  3S3O A;  1MDM A;  3DTI A;  3VOE A;  2F2E A;  4B44 A;  2CO5 A;  3KPH A;  4E7K A;  4C3J J;  1GXP A;  1XB4 A;  1GT0 C;  3LA3 A;  1U2W A;  3WE2 A;  4HDV A;  4MGR A;  1VQO I;  3K4N A;  4RGS A;  2D2W A;  1B1B A;  4F55 A;  1IRG A;  3L1P A;  1O3R A;  1V3F A;  4I0B A;  2XAQ A;  2PQ8 A;  3OSF A;  1YQA A;  2XGD A;  1Y0N A;  2BOL A;  1T95 A;  2LSO A;  3KFW X;  4HZF A;  4A6E A;  4A5M A;  2XGX A;  2MGQ A;  1YFH A;  1O7F A;  5K7Z A;  3GTQ J;  5IP7 J;  2CV1 A;  4A3D J;  4HV5 A;  2Y0S A;  3BTC A;  2R7W A;  4ENN A;  4KJZ A;  4M72 A;  2R7Q A;  4YFK F;  3K9T A;  1HW5 A;  2WAF A;  3QPH A;  4B09 A;  3OYC A;  2LD5 A;  5EJC A;  1IGN A;  1P9Q C;  4UUS B;  1EH7 A;  3KZZ A;  5B3S H;  4E7H A;  1ZLK A;  2OZ6 A;  3HUG A;  2GBY A;  2RVC A;  4LJZ F;  4XSZ F;  2CRG A;  4BS9 A;  2HQ5 A;  2DJI A;  3E3V A;  4A3I J;  2EJR A;  3K70 C;  2DK5 A;  4YRV A;  1B9N A;  3EUH A;  3WHC A;  5AIP A;  2EZI A;  2XPW A;  4XRM A;  5KCM A;  1TT5 B;  4I76 A;  4LK0 F;  3DP7 A;  3SDG A;  3CCQ I;  1K78 B;  1ZGA A;  3IWZ A;  1FMV A;  3DBH B;  1N77 A;  2DFF A;  3FK7 A;  4C30 A;  2D1H A;  4FIS A;  5TIS C;  1JGG A;  1Z67 A;  5LHH A;  3KE2 A;  2ZJP F;  1YRN A;  2EIK H;  5E1Z B;  4D5C A;  2HWV A;  4QSH A;  5FLM J;  1WFX A;  1HOM A;  1IC8 A;  3S1N J;  3HOS A;  1I5Z A;  1VQ4 I;  4P9U A;  4EJT A;  4YEL A;  1HA8 A;  2GOX B;  2DLL A;  3OV8 A;  4A3L J;  2QKL B;  3C2G A;  4HF0 A;  4LG0 B;  3OYN A;  1R9T J;  2CU7 A;  4LLN A;  4IQJ A;  4OIP F;  3M1E A;  4M9Z A;  5IYB J;  4HNT A;  1X19 A;  4A3B J;  3MKL A;  3CC2 I;  1A5J A;  1J75 A;  4XK4 A;  4GCV A;  4BU2 A;  3BG9 A;  2EZK A;  4IZZ A;  2JRM A;  2PBI A;  4WK8 F;  3EYY A;  3S1M J;  1ZEL A;  3KYD B;  3LFU A;  2IXS A;  3IRQ A;  3E6C C;  4L5E A;  2CUE A;  3R60 A;  1YOV B;  1JHF A;  1R7J A;  1A36 A;  3OIP A;  1D0Z A;  2DXI A;  1S9H A;  1XTA A;  4AVP A;  4BGD A;  3BG7 A;  1Z91 A;  2ZKZ A;  3K4B A;  2XDV A;  1P2F A;  2DYS H;  4B47 A;  4M6Y A;  3HC7 A;  2FQ4 A;  1IXC A;  1AWC A;  2QCO A;  5TGT A;  5DS9 A;  2R7V A;  3A0B C;  1C0W A;  1E17 A;  2QWW A;  3W3C A;  4BY7 J;  2NVY J;  4QTR A;  4WXC A;  4EJW A;  1EV7 A;  2L4A A;  4ZYG A;  2VOD A;  1W7P D;  4E7L A;  2Y48 A;  2DOD A;  3OYK A;  1W7P B;  2PX9 A;  4TV7 A;  1MH4 A;  5L3F A;  1XD7 A;  1G2H A;  1ON2 A;  2B63 J;  1F43 A;  2WAQ A;  4DQ2 A;  4LG3 A;  1LE8 A;  4DYC A;  1VQN I;  2F4M B;  2JN6 A;  2EIL H;  2V1U A;  4EEF G;  3OYJ A;  2P6S A;  1O3S A;  1ODD A;  4MEX F;  2QBY B;  2M8E A;  3ZQF A;  2HDC A;  4I7H A;  5CJ9 A;  2DOE A;  3IH2 A;  3LWF A;  2NS7 A;  3F3X A;  1PYV A;  3BR2 A;  3OYA A;  2W85 A;  3DU6 A;  2HXI A;  2X6W A;  5CVV A;  1I50 J;  4ANJ A;  2L2O A;  1B8I A;  2CUF A;  2JA6 J;  3PSF A;  1TLH B;  5J8C A;  2FA5 A;  3KYC B;  2XAH A;  4LD5 A;  3G73 A;  3DEU A;  2KJC A;  2K9Q A;  1YTY A;  3OOU A;  2HQN A;  1HW2 A;  1IN7 A;  1QZZ A;  1ZTR A;  3GFJ A;  3RPU A;  5ICG A;  1TP4 A;  2R5Z A;  2EPF A;  2LY2 A;  3CCE I;  1RIO H;  1KGS A;  3F21 A;  4JX6 A;  4Q48 A;  3GZN B;  2GWR A;  2NAZ A;  4Y33 A;  2VN2 A;  2JPC A;  3HTU A;  4KNY A;  1YIJ I;  5FLX K;  5C3E J;  3BT9 A;  1S7A A;  1MH3 A;  1IN4 A;  1GV5 A;  1IUF A;  4ETS A;  1KU3 A;  3HPH A;  5E79 C;  4HA8 A;  3K1P A;  3V7C A;  2YX7 A;  1ZAR A;  3CLO A;  1X3Z B;  1JTX A;  4GRI A;  5KHD A;  2CV2 A;  2CH0 A;  4UB6 C;  2HYF A;  4XQF A;  1XMX A;  3AG4 H;  2KRH A;  4A3C J;  2LOO A;  3HRS A;  4HST A;  3I56 I;  3CDL A;  4RGX A;  1WCM J;  2YU3 A;  1W5T A;  1X2N A;  2V9K A;  1IO2 A;  3ZRG A;  5HOO A;  2ME0 A;  1A6I A;  4B48 A;  5BQT A;  1U78 A;  1X4O A;  4WXH A;  3PO2 J;  4CHU A;  4HEA 2;  2X4H A;  2VBX A;  5JFR A;  2L7K A;  1XGO A;  1MNM C;  3L2Q A;  1LQ1 A;  1UG0 A;  2EV5 A;  4N9H A;  3R0J A;  4RGR A;  3V7S A;  1SFK A;  5GAD J;  3SEQ A;  4HNV A;  5TRD A;  1RR8 C;  1H0M A;  4IHX A;  1I1S A;  4A6D A;  1A6Q A;  2RQQ A;  1OCR H;  3FXL A;  3K6G A;  6PAX A;  2FE3 A;  4IEJ A;  1D3Y A;  1D0X A;  3PSI A;  3HKZ N;  2KZV A;  2OTJ I;  3SHF A;  2DW4 A;  1IV8 A;  1LVA A;  2R7F A;  2V9P A;  3VSL A;  2MD0 A;  4R1H A;  1B6A A;  1J5Y A;  3G1O A;  5FKK A;  3IKT A;  1FT9 A;  4HX4 A;  2E1C A;  1X1B A;  2JWT A;  3CO6 C;  4S05 A;  3BCA A;  2LY1 A;  2ECB A;  4XKW A;  4OIR F;  2NVX J;  3CQZ J;  3VOD A;  2HDW A;  3F8F A;  4XBF A;  1U0J A;  3HGY A;  1ZN2 A;  3FK6 A;  4UV9 A;  4FTH A;  4UUS A;  3QWL A;  2UZK A;  4XON A;  1AU7 A;  1XSD A;  4IOA F;  4R79 A;  2K4J A;  2CS3 A;  1S72 I;  2FSW A;  4ZH4 F;  3FXU A;  1SD7 A;  1WRJ A;  1E2X A;  2BXY A;  5DM7 F;  2ZJR F;  4MHG A;  4B43 A;  3UKG A;  2KPM A;  2XVC A;  3TO9 A;  1Y39 A;  2DT6 A;  2W25 A;  4BQO A;  2KRF A;  3L2U A;  2J5O A;  1H88 C;  1Z77 A;  5F1R A;  2CUZ A;  4ZYD A;  1P7I A;  5J40 A;  2JVH A;  2M30 A;  4IHV A;  5C4X J;  2Z5U A;  3R61 A;  2ZXW H;  1ZGJ A;  2IA0 A;  2W84 A;  1J7K A;  2R92 J;  4PSW A;  2CQK A;  4HNU A;  4FX4 A;  3PM1 A;  4RB3 C;  2IGN A;  1KON A;  1VQ5 I;  2CMP A;  5KAF C;  1VF9 A;  4JP0 A;  3VEP A;  1IV6 A;  1SAN A;  2PI0 A;  2EQR A;  3M4O J;  1QRY A;  2W24 A;  2X51 A;  2E71 A;  2CW8 A;  2TDX A;  2ZNZ A;  1IUY A;  1QHH D;  3V8L A;  3K4J A;  2FOK A;  3HEF A;  1MJB A;  1IJW C;  2A5W A;  2P6T A;  2LRE A;  3ZQI A;  2HVS A;  3RZO J;  5HDG A;  2KDZ A;  3GZ6 A;  1PUF B;  1JI8 A;  4UVC A;  4MTE A;  3OIO A;  1P92 A;  3S8P A;  1FYK A;  3PUB A;  3TOA A;  4EMS A;  3E0J B;  4ITV A;  2TRT A;  1MMA A;  2H6B A;  1WH5 A;  4E70 A;  3CP2 A;  3GLL A;  4L18 B;  4XKB A;  1WI3 A;  3F9K A;  3NQO A;  4WX9 A;  3HG9 A;  2GXA A;  1N78 A;  3FHN A;  2HFH A;  1HSJ A;  1MSF C;  2BE5 F;  3I4P A;  2A6T A;  4V2G A;  4EM0 B;  5F0C A;  2HTJ A;  1BI0 A;  4M3F A;  2Q2E B;  2YUS A;  5F08 A;  2CQX A;  4IO9 F;  3KX2 A;  4HYE A;  1U8B A;  3PUF A;  1OR7 C;  3PFY A;  4CH7 A;  3ECH A;  2HS5 A;  2DA5 A;  4P96 A;  3M8J A;  4KN7 X;  5L3D A;  3ZQC A;  3ULQ B;  3GTK J;  1AKH B;  2FML A;  1W7P A;  1QZY A;  4EGZ A;  3RYP A;  2Z9O A;  3A01 B;  2EV6 A;  3EPZ A;  3RPQ A;  2W57 A;  2UWM A;  3MVP A;  2O8K A;  5FB2 A;  4XID A;  2BV6 A;  1HDD C;  2V7F A;  2LG4 A;  3H9J A;  3QP5 A;  4BJT A;  2I5U A;  3AAF A;  5IYD J;  1ETW A;  2ZME C;  4ZYE A;  2P0W A;  2QBY A;  2EFN A;  2QEN A;  3J81 Z;  1UHW A;  1Z1D A;  1LFU P;  2VXD A;  2HDD A;  1SD4 A;  2OUM A;  1YLF A;  4M3G A;  1TWG J;  3LAJ A;  3J7Z I;  1RZ4 A;  3ABM H;  4ZDP A;  2NXN B;  4IOC F;  2H8R A;  4QLC U;  1PUE E;  3L2W A;  3H3U A;  4XSX F;  1O7L A;  3QYE A;  3HB9 A;  4CO8 A;  1PVE A;  3FMS A;  3IHU A;  3FHZ A;  1G8X A;  4V2F A;  5J1R A;  1H8A C;  5K7H A;  3IWF A;  4WCG A;  2VE8 A;  3BP8 A;  2A61 A;  1FJL A;  1S6L A;  4M9S A;  1LFP A;  5FRM A;  3A03 A;  3BZ6 A;  4ASN A;  3AFH A;  3OSG A;  3GTM J;  4G6D A;  3ZQG A;  1BIB A;  1J0R A;  1F9N A;  5LD2 C;  3FXK A;  4P55 A;  1U3E M;  3QPT A;  5J4Y A;  3OS0 A;  1QPI A;  3ZQ7 A;  2E2J J;  2M45 A;  2TCT A;  3CME I;  3EYI A;  1G59 A;  2WAQ N;  5E3M A;  2LTP A;  4Z6Y A;  3OYI A;  2HZT A;  3GFM A;  5D6E A;  3UNG C;  4KIC A;  3DLL F;  3HHG A;  3LQR A;  3HOY J;  1MBK A;  1V5E A;  3AL0 C;  3LSI A;  2NS8 A;  1QGP A;  3HTS B;  4FE7 A;  2DOF A;  1HKT A;  4YEJ A;  2MH2 A;  3LSR A;  3L2C A;  4CIC A;  4YFX F;  3L2R A;  2XKP A;  3OL3 A;  1UZC A;  4KIB A;  3DV8 A;  4ZZL A;  1IG7 A;  4A93 J;  1UFM A;  3HOU J;  5M3M J;  2Z1D A;  4M3D A;  2B0L A;  2IS6 A;  4IJA A;  2OTL I;  2O5R A;  2KIS A;  1OR7 A;  3K4C A;  1ETY A;  3GVA A;  1DP3 A;  1TNS A;  2V9V A;  1F36 A;  2CW0 F;  4KN4 X;  1LJ9 A;  1OCC H;  3HOX J;  2ZXJ A;  3WGH A;  4HG2 A;  3KLO A;  2K9S A;  1ACI A;  3CCY A;  3LFK A;  2DTZ A;  1SAU A;  4PJN A;  3IUO A;  2LBF B;  4HW0 A;  3CO7 C;  1K4S A;  3K2A A;  4NC6 A;  4UB8 C;  3S1Q J;  5JVT A;  2B7E A;  3HRM A;  2L9S A;  4RAF A;  4A12 A;  4J01 A;  2JMW A;  1V4R A;  3CMY A;  2JVG A;  1E3H A;  2WBM A;  2ZME A;  3GTG J;  3TGN A;  2LC2 A;  4HSR A;  5IT9 K;  2XHK A;  5DTD A;  3PNY A;  2CQN A;  2EFQ A;  1DUX C;  2Y2Z A;  3GWZ A;  3HOV J;  5LGN A;  3EQL F;  2V4J C;  4RLQ A;  1FEX A;  5J1Y A;  4W97 A;  1Y56 A;  1TL8 A;  3RYR A;  3ZGK A;  1TZL A;  3FWE A;  1E0E A;  3W6J B;  3CCJ I;  2PN6 A;  5FKM A;  3KYL A;  2VQC A;  3G3Z A;  3JRB A;  1KU9 A;  1QBJ A;  2BHY A;  3B02 A;  3VFZ A;  2H6C A;  2P8T A;  1RPW A;  1Q1H A;  2HEO A;  3QP6 A;  5DD8 A;  2AS5 F;  2MC4 A;  3JRD A;  2DA6 A;  3F8M A;  2CUJ A;  2M0C A;  3HOW J;  1IAW A;  3CCS I;  2K9L A;  1QU3 A;  1SFU A;  3BTJ A;  2M8G X;  4XOP A;  5D5X B;  4BE2 A;  2XIG A;  3WU2 C;  3H5A A;  5BNG A;  2ETH A;  3L09 A;  1I3A A;  4FT8 A;  2VQL A;  1U5T B;  2GAU A;  5ICF A;  2FXA A;  2EB7 A;  4DIQ A;  1DU6 A;  3ERM A;  2GA2 A;  3ASN H;  2KHM A;  4BQN A;  1VFC A;  5DUI A;  2QSG X;  3GFL A;  5D6F A;  2XAS A;  1X3U A;  2QLZ A;  1MMN A;  3V42 A;  1PUF A;  2X1E A;  1QNT A;  1W5S A;  1DQU A;  2DI3 A;  3J7A Y;  3M07 A;  2IEK A;  2IGM A;  4IPA A;  2GXB A;  3ZP5 A;  2JT1 A;  1FPQ A;  2DFI A;  2XF7 A;  3PFI A;  3IH4 A;  4NQW A;  1Z3X A;  2GZW A;  3EUH C;  5GPC A;  4M3E A;  2W4S A;  3RIR A;  5D5U B;  2LF7 A;  4JOM A;  4BYY A;  1KYZ A;  2K7L A;  1R6R A;  4HQE A;  4BE0 A;  2Q2E A;  5DYM A;  3KLN A;  3ROU A;  4NB5 A;  2FJ1 A;  3V7R A;  1U6G A;  2M7B A;  1W4M A;  2E7X A;  4Y17 A;  2ZNY A;  2QF7 A;  3FXJ A;  1Z3Y A;  2JRT A;  3HOT A;  5HLI A;  4PJM A;  4CCL A;  1QVU A;  2ZJ2 A;  1Z7L A;  3CDI A;  2FNP A;  4II2 A;  3C18 A;  1BC7 C;  1Z0X A;  1AKH A;  3D5S C;  3HPG A;  2Y75 A;  2IRF G;  4BEH B;  3A01 A;  1W36 D;  3HRT A;  3M8F A;  1FIP A;  1LEA A;  3K7A J;  3LSG A;  3A2K A;  4PSX A;  2MD5 A;  3U1K A;  3VPR A;  1BC8 C;  1TW2 A;  3VDX A;  4FQG A;  3HDD A;  1Z9C A;  5GAH J;  3KP7 A;  5H6R A;  2XF6 A;  3QOP A;  1HQC A;  2EBI A;  1XGM A;  4PGH A;  4AIK A;  1OJL A;  3QYB A;  1WKM A;  4AIH A;  1IW7 F;  5KNL A;  4IVN A;  2XPV A;  1AHD P;  1TT0 A;  2DA2 A;  2CG4 A;  1X1D A;  2BYV E;  3H92 A;  5KAI C;  3WTY C;  2Y69 H;  2HVR A;  4EQQ A;  3FMR A;  3LSJ A;  3SJM A;  2STT A;  3Q9V A;  4BAC A;  1W5C C;  1LB2 A;  1FP1 D;  2NVT J;  3E5U A;  2AXT C;  3S3N A;  1QA6 A;  1ZG3 A;  4OMZ A;  2KL4 A;  3Q5F A;  4ZTF A;  4RGU A;  5IP9 J;  2ZBK A;  4NNJ A;  4L5J A;  5E3L A;  3ELK A;  5FLX Z;  2GA1 A;  3BQY A;  1UG2 A;  2ZXI A;  1VQ7 I;  2VLA A;  3JTH A;  4A0Y A;  5LGT A;  2R7O A;  5FJ8 J;  3E97 A;  2Q8K A;  1X2M A;  4OIQ F;  4G7O F;  2F4O B;  2ESH A;  5KK1 A;  4O3M A;  1VQ6 I;  4I2O A;  2RV8 A;  1ONV A;  3TDU C;  1IDY A;  1MKM A;  3OYF A;  1XGN A;  1Z21 A;  2IW5 A;  3DPT A;  3H3Z A;  3U2R A;  4ZC3 A;  4D9J A;  3JAM K;  3JSP A;  2VON A;  2VC0 A;  2RC4 A;  2VC1 A;  4EGY A;  1T98 A;  4RAG A;  2RGV A;  1YW7 A;  2BW3 B;  2M0M A;  1EF4 A;  1XCB A;  2X6O A;  5GP9 A;  1ZH5 A;  1Z6R A;  1BI3 A;  1FC3 A;  1R36 A;  2H1K A;  2UUZ A;  1WZ2 A;  1CQT A;  3PQJ A;  5LBQ A;  4Y15 A;  1MMS A;  5HLT A;  5L3C A;  1VTN C;  2HQA A;  1P4A A;  4BQQ A;  1UHM A;  4E6K G;  1R1T A;  1E3O C;  1YX3 A;  1POG A;  3TO7 A;  1Y1W J;  1WGX A;  1Z7U A;  2QUF A;  3LNQ A;  1YJN I;  2OA4 A;  3H36 A;  1HXD A;  2F5C A;  1I27 A;  2RRE A;  5JHU A;  2QSF X;  1SEU A;  3WGG A;  4E7S A;  3W6K B;  2E5N A;  1I3Q J;  2ELJ A;  1KU7 A;  2VPL A;  2BY1 A;  1XC5 A;  4XM3 A;  3IH3 A;  2GM4 A;  4D7N A;  1ZRC A;  4EM2 A;  1R5I D;  1UJ8 A;  3C2B A;  1RR7 A;  3F8B A;  1DPR A;  4ABZ A;  4IHY A;  1T56 A;  3ABK H;  4DGW B;  3SZG A;  4EAT A;  1UST A;  4D7M A;  1UHS A;  2EZH A;  2VBZ A;  3WTV C;  3M3Y J;  2EA4 A;  1WVR A;  3JRI A;  4XLN F;  4M71 A;  5D5V B;  4KFC A;  1WJF A;  4ENM A;  4PDK A;  2PJR B;  4KIG A;  4A0X A;  1WSU A;  4LIT A;  5HNF A;  1G3T A;  5E8I A;  2HQR A;  4CZC A;  5BPI A;  2EFP A;  4UHT A;  1KQ8 A;  3LSM A;  1DU0 A;  2DPD A;  1UB9 A;  3BR5 A;  4XLA A;  2E7W A;  1U8R A;  4YIF A;  5ILU A;  5HDK A;  3GTP J;  1FTZ A;  1H9G A;  4HBL A;  4HV6 A;  2Z2S B;  2DDB A;  1NK3 P;  4XOT A;  1LEB A;  5E1W A;  5E17 F;  1RNL A;  1OCP A;  2UXN A;  4LFU A;  3SXY A;  4B8X A;  2M4G A;  2JTV A;  2DQR A;  2W48 A;  2XB0 X;  2MW8 A;  4R8H A;  4ESJ A;  1X1C A;  3PJR A;  3W6V A;  1WH7 A;  1STZ A;  4RS8 A;  2QVO A;  4X1E A;  2FOW A;  1LDD A;  4A5N A;  1JUM A;  3SFZ A;  3SDB A;  5ICE A;  1GVJ A;  5BMZ A;  5JHF A;  2UXX A;  3JRC A;  2L3D A;  1QHG A;  1TWH J;  2JA2 A;  3RKW A;  4CUG A;  4HF2 A;  2CJJ A;  4U88 A;  2ZSI B;  3WTX C;  1HST A;  5BS6 A;  4I98 B;  4B3A A;  3HL2 A;  1R71 A;  4ENK A;  4PFP A;  4XOR A;  4AWX B;  3BR3 A;  3LQQ A;  5DV5 A;  2X85 A;  2XPU A;  4MFD A;  2PEX A;  4BXX J;  1D5V A;  1Y1V J;  4BDY A;  3Q0W A;  5IY5 H;  2P5L C;  2E5Z A;  3JTG A;  1USS A;  3GEZ A;  3GYH X;  2KLO A;  1KYW A;  3WU0 A;  3EUA A;  1P6R A;  4RAY A;  1BM9 A;  2A3S A;  4DYR A;  3JCU C;  2MLG A;  5CKT A;  4Z2Y A;  4BEH A;  2A68 F;  4PJ0 C;  1VZ0 A;  2QKM B;  4F92 B;  2G7U A;  1I1G A;  3GUD A;  3DLA A;  2A6E F;  2IJL A;  2JUC A;  4GGG A;  3JRH A;  2FX0 A;  2DMP A;  2IAI A;  1KU2 A;  2MH9 A;  3WU1 B;  2OAZ A;  3KP2 A;  2O6G E;  3OYB A;  1YO5 C;  4Y13 A;  1VQ9 I;  3HGG A;  5IP6 A;  1FYL A;  2CFO A;  3ABT A;  1T39 A;  1LNW A;  3S93 A;  2VKE A;  2DA7 A;  3FDY A;  2QQ9 A;  1T0F C;  5EGO B;  3MKW B;  1EJ9 A;  1LFB A;  3OYM A;  2JA5 J;  3HJE A;  3DWL E;  3TBI A;  1NG7 A;  1Q1V A;  2L9V A;  3CDH A;  5F64 A;  2WAD A;  2H27 A;  5FRN A;  1MBE A;  4BL0 B;  3I4N J;  2CWE A;  1DGR M;  4QPQ A;  3VSK A;  3T8R A;  4IHS A;  3F0C A;  1BL0 A;  2M3A A;  2ZC2 A;  1YIT I;  4HRI A;  3OS1 A;  5E3N A;  2DQL A;  5E18 F;  3IRR A;  3K4L A;  2D1V A;  1NTC A;  2BGC A;  1K6Y A;  3QYF A;  3CMA I;  1ZG1 A;  3EUK L;  5CLS A;  3C7J A;  3DBL B;  2YS9 A;  2Z3Y A;  3BJ6 A;  3FM5 A;  2R5Y B;  3M7G A;  2BHZ A;  2VPR A;  4NUB A;  2G0E A;  4CSW A;  2OJE D;  3OYL A;  4BDZ A;  5K5Q A;  3BRO A;  3G2B A;  1G3Y A;  1YW9 A;  5LGU A;  2LR8 A;  2F6C A;  2ZSH B;  4YG2 F;  1B72 B;  2E1N A;  5LHG A;  1YI2 I;  2GXG A;  4A3E J;  2EIM H;  2NNN A;  2IS4 A;  4BJ5 C;  2BW3 A;  4PJL A;  3R6S A;  4FCY A;  3ZN1 A;  2WB1 A;  4XLC A;  1HW1 A;  3D1N I;  2MG4 A;  2ESN A;  2KIF A;  1HKS A;  3BR0 A;  1FP2 A;  1WPK A;  1K78 A;  4UVA A;  2R7R A;  3VWB A;  4LB6 B;  3MKZ A;  1ZRE A;  3ABU A;  3U1D A;  3DKY A;  4ZYH A;  3P7N A;  2BY3 A;  3REO A;  4NDL A;  3GO5 A;  2R93 J;  1P4X A;  4N0B A;  3I59 B;  1GUU A;  1RI7 A;  1VQL I;  4A3M J;  5FFZ A;  2XRN A;  2LFB A;  5CVR A;  5CVI A;  3CF5 F;  3PL8 A;  3ZQQ A;  5IT9 Z;  4RM2 A;  2BXZ A;  4LG0 A;  3FXR A;  3HXL A;  2YPR A;  3Q9S A;  3HSE A;  1EH6 A;  3DF8 A;  1Z6T A;  3DPL C;  4C2M J;  4HOB A;  2A5Y B;  3FXQ A;  4YIR X;  2Y0S N;  4DBR A;  1ETX A;  2LYC A;  3EDP A;  3ZPL A;  3ONQ A;  3B73 A;  1WWX A;  2WA0 A;  2JUG A;  5LFA A;  1G6N A;  2HKO A;  2FRH A;  1HC8 A;  2D5V A;  3BG5 A;  1T0F A;  4RDU A;  4CGZ A;  1F4K A;  5LEK A;  1WJA A;  2LKP A;  1MBH A;  3HHH A;  3LOC A;  3ZXS A;  1T8I A;  4KIS A;  1TTY A;  4D5F A;  3W2V A;  2B9S A;  2WV1 A;  3N4M A;  2W1O A;  4OIN F;  2PJR A;  2H09 A;  1YE9 A;  1V5G A;  2ICW G;  5D4S A;  4DZP A;  1T6S A;  3SYT A;  3S32 A;  3FF5 A;  4ZDL A;  1FOX A;  4RA2 A;  2GQQ A;  3DEE A;  1TWF J;  1JKQ C;  2HXO A;  3BJA A;  1AA7 A;  1JE8 A;  2P4W A;  3RTR A;  2CSO A;  3HYI A;  1J09 A;  3BR6 A;  4LLG F;  3ML6 A;  3OY9 A;  5GPA A;  1FNN A;  3AKZ A;  2M4K A;  3LAP A;  1IXR C;  2R7S A;  3NWT A;  1T2K A;  3S14 J;  3K69 A;  3WTW C;  3MD2 A;  2L54 A;  4IX7 A;  2I10 A;  4OIO F;  1R4M B;  5J4V A;  3JRG A;  2NVU B;  4KIT B;  3ZMU A;  3GTO J;  2LKX A;  1OCZ H;  3CJT B;  2DA1 A;  4XKV A;  2V1X A;  2VBW A;  3TMO A;  2QEX I;  1ETV A;  1ON1 A;  5F0H A;  2RNG A;  4Y52 J;  2ISY A;  4M3B A;  1WJB A;  4A69 C;  1OLT A;  3G71 I;  1YHQ I;  4B3X A;  5F27 A;  1MND A;  4XNF A;  2H1L A;  2VJJ A;  4IKF A;  3T0Y A;  1FBU A;  1HDP A;  2LP0 A;  3VYS B;  4A3K J;  3VB2 A;  5HDN A;  2VOO A;  4JK1 X;  1K6O A;  1S3J A;  5A2Q K;  1FBQ A;  3RQ4 A;  3HOZ J;  3CF2 A;  1MZB A;  1SVL A;  2P5V A;  4CCM A;  4GXO A;  3LL7 A;  2R3S A;  3E7L A;  2LVS A;  1DDN A;  2WC2 A;  4OMY A;  5D4R A;  2R7Z J;  3NAR A;  4A3G J;  2ELK A;  3CZ6 A;  3QAH A;  2JA8 J;  4O5V A;  2RKH A;  4MNU A;  2K5C A;  3F23 A;  1R23 A;  2M87 A;  3RDI A;  3RQI A;  1XS9 A;  1SMY F;  3OMY A;  4N9I A;  2ZB9 A;  1G4D A;  1JJ8 C;  2J5P A;  2OZU A;  2QQA A;  4I09 A;  5EGO A;  2KDO A;  3CUQ B;  4Q47 A;  3GXO A;  4DW6 A;  2HPI A;  2ECC A;  2HI3 A;  5FO5 A;  2EFO A;  3E6D A;  2YX4 A;  2ZCW A;  1N25 A;  1I39 A;  1BR4 A;  2YR2 A;  3FX3 A;  3MEX A;  3S1R J;  2XGC A;  4XLP F;  1TWA J;  3U21 A;  2DT7 B;  4FAS D;  2DMQ A;  2G9W A;  2IP2 A;  2EA2 A;  2H8W A;  5CPR B;  2L9N A;  3G1L A;  4NC8 A;  3ERE D;  2ZFW A;  4CYC B;  5EEG A;  4FE4 A;  5EG0 B;  3I4M J;  1OFC X;  1FX7 A;  2IBD A;  5TJJ A;  2XAG A;  4OAY A;  4HF1 A;  4GYI A;  1XCV A;  4Y7N J;  5DCF A;  2K85 A;  3HSF A;  5DEQ A;  5HS9 A;  3WTZ A;  1FMW A;  4IQ4 A;  3CJQ B;  2AXL A;  1YJ9 I;  2G7H A;  2F5D A;  1MIJ A;  3JAM Z;  3H0G J;  2DMT A;  4UUT A;  4S04 A;  2FD5 A;  2VBY A;  2R5Y A;  1FLI A;  2R7X A;  2OF7 A;  2QM3 A;  4H0E A;  5H20 A;  4E7J A;  1RKW A;  4HQM A;  3G6E I;  1YS6 A;  3FXM A;  5H2F C;  2ME6 A;  3BG6 A;  1H9T A;  1WJ5 A;  4I0A A;  1ZQ3 P;  2KT0 A;  2C6Y A;  4PFO A;  3K4M A;  4NBQ A;  4CZZ A;  3GF2 A;  4BBS J;  1M1E B;  4HLY A;  1A31 A;  1FWZ A;  1TQI A;  2XF5 A;  4FHT A;  3VYT B;  3JRE A;  1VQP I;  1L3L A;  4IF4 A;  1RUN A;  1S7E A;  1XDS A;  1MW7 A;  1VI0 A;  2LRD A;  2XC7 A;  3FIS A;  5DDG A;  2W82 A; 
#chains in the Genus database with same CATH homology
 1JKP C;  2E19 A;  2O9L A;  5C3E J;  3BT9 A;  2M2E A;  1MH3 A;  4JX5 A;  1GV5 A;  3GTL J;  1IUF A;  1EF4 A;  2DMN A;  2X6O A;  5GP9 A;  5EZG A;  3BQZ A;  5M5W J;  1JTX A;  2LY9 A;  4I6Z A;  2H1K A;  2E2H J;  2XRL A;  1CQT A;  5HOD A;  4A3C J;  3ZQL A;  2ID6 A;  5IOY A;  2L7M P;  5FKO A;  3CDL A;  2E1O A;  1BA5 A;  1WCM J;  1E3O C;  1X2N A;  5F0F A;  1POG A;  3G1M A;  1Y1W J;  2ME0 A;  2O7O A;  1A6I A;  1WGX A;  1JKO C;  3TP3 A;  3ZQH A;  3LNQ A;  1U78 A;  3PO2 J;  1JJ6 C;  2RAE A;  1MNM C;  2HOT A;  4HNV A;  2WB1 N;  1I3Q J;  4IHX A;  1FTT A;  1XC5 A;  1GVD A;  3IH3 A;  2GM4 A;  4D7N A;  4IEJ A;  2DN0 A;  2HYJ A;  3C2B A;  3HKZ N;  2HOS A;  1RR7 A;  4IHY A;  4ABZ A;  1T56 A;  2LK2 A;  4MIM A;  4D7M A;  5EYR A;  1UHS A;  2EZH A;  3M3Y J;  4IHW A;  3G1O A;  5FKK A;  3JRI A;  2JWT A;  1U9O A;  1ZKG A;  2ECB A;  2NVX J;  3CQZ J;  2OPT A;  2GLO A;  2LLK A;  3HGY A;  2DMU A;  3FK6 A;  4C3H J;  4FTH A;  5F04 A;  4UUS A;  1DU0 A;  1AU7 A;  3BR5 A;  3BTI A;  3HBL A;  4AUX A;  5K7F A;  2XSD C;  2JA7 J;  3GTP J;  3O8H A;  1K61 A;  9ANT A;  1FTZ A;  2EZL A;  2L0K A;  3PO3 J;  1QVT A;  1H89 C;  3DEW A;  1NK3 P;  1ETK A;  3UKG A;  1FIA A;  1OCP A;  4AC0 A;  3B6A A;  1H88 C;  1Z77 A;  3TP0 A;  2W48 A;  2XB0 X;  2MW8 A;  4XIC A;  1P7I A;  3W6V A;  1WH7 A;  4IHV A;  2ID3 A;  2AO9 A;  4X1E A;  5C4X J;  2R92 J;  1JUM A;  3TW6 A;  3PM1 A;  2DA3 A;  3JRC A;  5IOZ A;  1TWH J;  3NAU A;  1VF9 A;  4JP0 A;  1IV6 A;  1SAN A;  3B6C A;  2CJJ A;  2EQR A;  3GTJ J;  1QRY A;  3M4O J;  4B3A A;  1YRN B;  3HEF A;  1IJW C;  4B4C A;  4MO7 A;  1ETO A;  3ZQI A;  3RZO J;  3BR3 A;  2Y31 A;  2PMZ N;  2KDZ A;  1PUF B;  2XPU A;  4MFD A;  4BXX J;  1Y1V J;  1D5Y A;  3OIO A;  3Q0W A;  5FLV A;  1B72 A;  4B1R A;  2R0Q C;  2TRT A;  1WH5 A;  4QIW N;  1WI3 A;  2Y9Z A;  4DYR A;  1MSF C;  3S2D J;  2XB5 A;  4V2G A;  1P7J A;  5F0C A;  4M3F A;  4A3F J;  2YUS A;  5F08 A;  2CQX A;  2XGE A;  3FKI J;  3JRH A;  2FX0 A;  1U8B A;  1JKR C;  2DMP A;  4GFB A;  3JRF A;  2IAI A;  2DA5 A;  3ZQC A;  1ZR4 A;  3GTK J;  2X9D A;  1AKH B;  4BY1 J;  2VUM J;  3HGG A;  5IP6 A;  2VI6 A;  4J19 A;  3A01 B;  1APL C;  2VKE A;  2DA7 A;  5EGO B;  4CYC A;  3MVP A;  5EG0 A;  1RKT A;  4C3I J;  4XID A;  2O8K A;  1X58 A;  1HDD C;  2M34 A;  1LFB A;  1IDZ A;  5IYD J;  2JA5 J;  1ETW A;  4W1U A;  1O4X A;  2DJN A;  2K9N A;  1Q1V A;  3GBG A;  4JYK A;  3H3V K;  1LFU P;  1W0U A;  1NK2 P;  2HDD A;  1LE8 B;  1MBE A;  4M3G A;  3MN2 A;  2JK3 A;  3FIW A;  5C44 J;  1TWG J;  1GV2 A;  3I4N J;  1BW5 A;  2H8R A;  3TED A;  1MBF A;  3F0C A;  1BL0 A;  2VKV A;  5EEA A;  4RBO A;  3HB9 A;  5C4J J;  5JLX A;  1T33 A;  1ETQ A;  1XG1 A;  5E3N A;  3JR9 A;  2Y30 A;  4V2F A;  5J3L A;  5J1R A;  1H8A C;  5K7H A;  1NTC A;  1W0T A;  1FJL A;  2YS9 A;  1UMQ A;  3A03 A;  2R5Y B;  3OSG A;  1B8I B;  2EH3 A;  3GTM J;  2VPR A;  4S0H B;  3ZQG A;  2G0E A;  1IRZ A;  5IPA A;  1QPI A;  2E2J J;  1HLV A;  1I6H J;  2TCT A;  2LR8 A;  2M9H A;  1MSE C;  1SFO J;  3BG3 A;  2WAQ N;  2Y9Y A;  2LTP A;  3BR1 A;  2MSY A;  5E3M A;  1B72 B;  4A3E J;  4MFE A;  4JX4 A;  1ENH A;  3O8G A;  4FCY A;  1GDT A;  2L7Z A;  1MBK A;  2R5Z B;  3HOY J;  3IV5 A;  2NS8 A;  2MG4 A;  3D1N I;  3WHB A;  3BR0 A;  3ZOB A;  3S2H J;  4FE7 A;  1WPK A;  5EDN A;  1JUP A;  2HOA A;  1TC3 C;  5E3O A;  2L9R A;  4NDL A;  4BKX A;  1HF0 A;  3LSR A;  5FKN A;  2R93 J;  4BBR J;  2YU9 J;  1GUU A;  5J1U A;  1IG7 A;  4A93 J;  3HOU J;  5M3M J;  4M3D A;  4A3M J;  1K83 J;  2LFB A;  2NOG A;  1ETY A;  3HM5 A;  3TW7 A;  1HCR A;  4C2M J;  1F36 A;  4M6V A;  1JUS A;  3HOX J;  2Y0S N;  2K9S A;  1ETX A;  3CCY A;  5IYC J;  2DTZ A;  4XRS G;  1OCT C;  3K2A A;  3S1Q J;  2D5V A;  3BG5 A;  4RDU A;  2CQQ A;  2JMW A;  5M5X J;  4C3J J;  3CMY A;  1MBH A;  1GT0 C;  3LOC A;  5M3F J;  4D5F A;  5M5Y J;  2WV1 A;  2COB A;  3GTG J;  3BTL A;  1ZGW A;  3L1P A;  5DTD A;  4DZP A;  1ZR2 A;  3OSF A;  3Q0V A;  5FKL A;  4LOC A;  2XGD A;  1TWF J;  2Y2Z A;  3JRA A;  3HOV J;  1JKQ C;  1FEX A;  5J1Y A;  1VND A;  2HXO A;  4W97 A;  2MGQ A;  3GTQ J;  5K7Z A;  5IP7 J;  4A3D J;  3BR6 A;  5FKM A;  3BTC A;  5GPA A;  2JJ7 A;  4XRS A;  3JRB A;  3S14 J;  5JLW A;  2LD5 A;  1RPW A;  3Q0U A;  3S15 J;  1IGN A;  4UUS B;  3JRD A;  2DA6 A;  2I10 A;  2GBY A;  2CRG A;  2HQ5 A;  2M0C A;  3HOW J;  4A3I J;  3JRG A;  3GTO J;  1U9N A;  1JT0 A;  2LKX A;  3WHC A;  3BTJ A;  2EZI A;  2M8G X;  2DA1 A;  2XPW A;  4XRM A;  5BNG A;  3SDG A;  4I76 A;  1A5J A;  1ORK A;  1ZK8 A;  3RKQ A;  1ETV A;  5F0H A;  3FK7 A;  2E2I J;  4FIS A;  4Y52 J;  1JGG A;  1DU6 A;  1YRN A;  4M3B A;  4D5C A;  1VFC A;  4A69 C;  4QSH A;  5FLM J;  1HOM A;  1PUF A;  1IC8 A;  3S1N J;  2NVQ J;  5F27 A;  3DCF A;  3RZD J;  4A3L J;  2IEK A;  2DA4 A;  1HDP A;  2LP0 A;  5F1J A;  4A3K J;  5EZH A;  1R9T J;  2CU7 A;  4DZJ A;  5IYB J;  3IH4 A;  3HOZ J;  4A3B J;  3MKL A;  5GPC A;  3LSP A;  2N8G A;  4M3E A;  4XK4 A;  3QPS A;  3BG9 A;  2EZK A;  3E7L A;  2LVS A;  2FJ1 A;  4DYQ A;  3S1M J;  3S16 J;  3QQA A;  2R7Z J;  3S17 J;  3NAR A;  4A3G J;  2QF7 A;  2ELK A;  4L5E A;  2JA8 J;  2CUE A;  1JT6 A;  1QVU A;  1AKH A;  3A02 A;  1Z0X A;  3RQI A;  1RES A;  1XS9 A;  3A01 A;  1FIP A;  2ZB9 A;  2X48 A;  3K7A J;  3LSG A;  1JJ8 C;  3Q3S A;  5EGO A;  4G12 A;  2FQ4 A;  3VPR A;  3HDD A;  2QCO A;  4DW6 A;  2ECC A;  2HI3 A;  4BY7 J;  4QTR A;  2NVY J;  2EBI A;  3S1R J;  1OJL A;  2XGC A;  1TWA J;  4MLO A;  1MH4 A;  2XPV A;  1AHD P;  2DMQ A;  2B63 J;  1F43 A;  1G2H A;  2DA2 A;  3SFI A;  3G1L A;  1LE8 A;  4DYC A;  4CYC B;  4FE4 A;  5EG0 B;  4AYB N;  3I4M J;  1OFC X;  2JN6 A;  2IBD A;  1MBG A;  3LSJ A;  2K40 A;  3SJM A;  4EEF G;  4Y7N J;  3ZQF A;  4A3J J;  1BW6 A;  3IH2 A;  2NVT J;  2NS7 A;  3BR2 A;  1ITY A;  3H0G J;  2DMT A;  4UUT A;  2AHQ A;  2FD5 A;  2HXI A;  5E3L A;  1TWC J;  5IP9 J;  2R5Y A;  2OF7 A;  1I50 J;  1B8I A;  2CUF A;  3BQY A;  1UG2 A;  2JA6 J;  1JTY A;  2P81 A;  5EF6 A;  1RKW A;  1BJZ A;  2ME6 A;  1ZQ3 P;  2KT0 A;  2K9Q A;  5FJ8 J;  3QPL A;  3OOU A;  1X2M A;  1MBJ A;  4BBS J;  3JRE A;  4X6A J;  1S7E A;  1ZTR A;  2L7F P;  2R5Z A;  1VI0 A;  3FIS A;  5DS9 A;  1RET A;  1IDY A;  4JX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...