2M8GX

Structure, function, and tethering of dna-binding domains in 54 transcriptional activators
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
b'TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator
publication title Structure, function, and tethering of DNA-binding domains in sigma (54) transcriptional activators.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m8gX00
4DW6A 2VKEA 3H3VK 3JREA 2YU9J 2O9LA 3MN2A 2ID6A 5K7FA 2KT0A 3JRBA 2QF7A 5GPCA 2COBA 1ETYA 2XPUA 5FKLA 2LY9A 1VFCA 3MVPA 4GFBA 1OCPA 4MFDA 5GP9A 4Y7NJ 1ORKA 2OPTA 1WGXA 4BY1J 1HOMA 2DA5A 1JT6A 3QQAA 1B8IB 2E2IJ 1JTXA 2OF7A 3CMYA 2B63J 1JUSA 5K7ZA 5IPAA 3F0CA 3BQYA 1RKTA 4C3IJ 4AYBN 4Y52J 3TW7A 3JRHA 1MSEC 1UHSA 3IH3A 2DMPA 4A69C 2HOTA 3RQIA 2Y31A 3TP3A 1Y1VJ 1MH4A 4XIDA 4L5EA 4XK4A 3G1LA 1PUFA 2LLKA 2YS9A 2LVSA 1B8IA 1JKRC 5C3EJ 1LFUP 1GV2A 4D5CA 2LK2A 4A3JJ 1BL0A 3GTGJ 2LTPA 4HNVA 3W6VA 1GDTA 4UUTA 3BG9A 2X48A 3JRAA 2L9RA 2XGEA 3LSJA 3BG3A 1I50J 2LFBA 1QPIA 1MH3A 3Q3SA 1O4XA 2XB0X 2Y0SN 5FKMA 1XC5A 1DU6A 1IUFA 3FK6A 3S1NJ 1BW5A 4B1RA 1ZK8A 1OJLA 3BQZA 4BXXJ 5EEAA 4FE4A 3OSFA 1JKOC 5J3LA 1QRYA 2HI3A 5EZHA 3GTJJ 1LE8A 3HOZJ 2L7ZA 3GBGA 4JX5A 2NS8A 2ME6A 3FISA 2CJJA 2ZB9A 1XG1A 2EZIA 1W0TA 3MKLA 1TWAJ 1ZQ3P 5EGOA 3BR3A 4UUSB 1FIAA 1ETQA 3DEWA 2JWTA 5FKNA 3RZDJ 9ANTA 4B4CA 1NTCA 4IHWA 2ME0A 3H0GJ 2VPRA 4M3GA 2R93J 3HOYJ 4XRSG 4DZPA 2K9SA 1G2HA 3GTQJ 1HDDC 3S1QJ 4JYKA 1X2MA 5EDNA 4D7MA 2E2HJ 4DYCA 1TWHJ 2JN6A 2DA2A 4AUXA 3LSPA 5IP6A 1JTYA 1GVDA 1TC3C 2X9DA 5FKKA 1IG7A 3ZQGA 3PO2J 4DYQA 2W48A 1WCMJ 1JJ8C 1ETKA 2WAQN 3BR1A 3B6AA 1HLVA 3S16J 1IGNA 1B72B 4QTRA 2JA7J 1F36A 3SDGA 1W0UA 3LOCA 5DS9A 5F08A 5F0FA 4C3JJ 2ELKA 1U78A 3LSGA 2E19A 5JLXA 4JP0A 1NK3P 1X2NA 2FJ1A 3RKQA 3UKGA 1IJWC 2H8RA 2GM4A 1F43A 2Y2ZA 2LR8A 3ZQLA 4NDLA 1WH7A 4QSHA 1SANA 3GTOJ 3I4NJ 3PO3J 4IEJA 1D5YA 1BJZA 2IAIA 4M6VA 3Q0UA 3HOXJ 1IC8A 3FKIJ 3L1PA 2QCOA 1MNMC 1Q1VA 1VI0A 4W1UA 2CUFA 5F27A 3HOWJ 2ECBA 2HOAA 3C2BA 2MSYA 1TWFJ 2Y30A 1ETVA 1UMQA 3K2AA 1BW6A 1POGA 4XICA 4CYCB 2DN0A 1PUFB 4FISA 3FK7A 3HEFA 2L7MP 2TRTA 1R9TJ 2M9HA 4ABZA 5EG0A 3ZOBA 4BBSJ 5K7HA 4RBOA 2HXOA 3NAUA 1P7JA 1I6HJ 2DA3A 3S14J 3D1NI 4A3FJ 5M5WJ 4A93J 4A3CJ 3I4MJ 4CYCA 5FJ8J 4XRSA 4M3FA 4XRMA 5M3FJ 3O8GA 4M3BA 4X6AJ 1T56A 3IH4A 4C3HJ 3JRGA 2DA6A 2DJNA 3BR0A 4BBRJ 3OIOA 1ZGWA 1ETOA 1JT0A 5FLVA 1LE8B 1JGGA 3HDDA 2AHQA 1HDPA 2NVQJ 3BTIA 3GTKJ 2R92J 5M5XJ 1I3QJ 1QVUA 2M34A 5EGOB 4A3LJ 2K9NA 2NS7A 3HGGA 1ETWA 3HOVJ 3BTLA 3JRDA 2DMTA 1H88C 1OCTC 2P81A 1U8BA 1IV6A 3A01A 1FEXA 2I10A 2O8KA 1IRZA 1Z0XA 4MLOA 5IYBJ 1ZTRA 2HXIA 2XGDA 1UG2A 2DMNA 2R5ZB 1MBHA 3OOUA 1IDYA 1HCRA 5E3MA 1ZR2A 5F0HA 4S0HB 2JA8J 2VI6A 4FE7A 2VKVA 4FCYA 3LNQA 1FIPA 4MIMA 2CQQA 5C44J 2NVXJ 3JRCA 2NVTJ 1RR7A 3A02A 4B3AA 2R5ZA 2CUEA 1ZR4A 1JJ6C 1H8AC 1A5JA 4AC0A 3VPRA 3M3YJ 4JX6A 2XSDC 1AU7A 2RAEA 2NVYJ 3TEDA 2O7OA 3HM5A 5FKOA 3GTMJ 4A3KJ 4J19A 1WI3A 4V2GA 2CU7A 2GLOA 3BTCA 3CCYA 3GTLJ 4BKXA 2MG4A 5E3NA 4C2MJ 2D5VA 2E1OA 1K83J 5FLMJ 2EBIA 3NARA 4BY7J 5J1RA 2R5YA 2K40A 2MW8A 1OFCX 2DMQA 1GV5A 3SJMA 3IH2A 3ZQIA 1S7EA 1TWGJ 2Y9YA 4A3BJ 5IYCJ 3ZQCA 3JRIA 1JUPA 5EG0B 1AKHB 1APLC 3BTJA 4IHXA 5EF6A 2JA5J 3DCFA 3S1RJ 2N8GA 3WHCA 5IP7J 1GT0C 1Y1WJ 2YUSA 1IDZA 5J1UA 4QIWN 2K9QA 3E7LA 2LKXA 1RKWA 2WV1A 1RPWA 3BR5A 1AKHA 5IP9J 1HF0A 2VUMJ 4JX4A 4V2FA 4RDUA 4M3DA 5F1JA 1WH5A 4D5FA 4IHVA 3BT9A 2HYJA 2HQ5A 2CQXA 3CDLA 3ZQFA 2FD5A 5EZGA 2NOGA 1FTTA 3FIWA 3A01B 1LFBA 3O8HA 5HODA 1TWCJ 2H1KA 2R7ZJ 5C4XJ 1RETA 1EF4A 1JUMA 1GUUA 5M3MJ 4IHYA 3M4OJ 1ETXA 1FJLA 3BG5A 2IBDA 4X1EA 3BR6A 5BNGA 3IV5A 4DZJA 3HB9A 3QPSA 2LD5A 1MBFA 3TW6A 1MBEA 1T33A 1DU0A 3TP0A 5GPAA 5C4JJ 1QVTA 1A6IA 2DA1A 3A03A 3S1MJ 2ID3A 4MO7A 2FX0A 3LSRA 3S15J 1JKPC 3GTPJ 2JMWA 3QPLA 1SFOJ 2MGQA 1CQTA 2PMZN 2DMUA 5M5YJ 3S2HJ 3JRFA 2XRLA 1RESA 1ENHA 2XB5A 3BR2A 2WB1N 5E3LA 3HBLA 2Y9ZA 2HDDA 2M0CA 2M2EA 2DA4A 5F04A 2TCTA 1ZKGA 2X6OA 2HOSA 3PM1A 2JK3A 5IOZA 1JKQC 3S2DJ 1MBJA 1MBGA 3Q0WA 5E3OA 1MSFC 2LP0A 2R5YB 1VF9A 1FTZA 1U9OA 2XPWA 2GBYA 4G12A 4I6ZA 3S17J 1H89C 1U9NA 1YRNB 1ITYA 2CRGA 5DTDA 4DYRA 1K61A 2M8GX 3OSGA 1BA5A 1AHDP 4FTHA 1XS9A 2EZKA 3B6CA 4LOCA 4EEFG 3Q0VA 2DTZA 1E3OC 4W97A 3SFIA 1NK2P 1P7IA 2DA7A 4UUSA 3RZOJ 2KDZA 4A3DJ 4A3EJ 4M3EA 2EQRA 1X58A 3JR9A 1YRNA 1Z77A 2IEKA 3HGYA 2JJ7A 3ZQHA 1MBKA 2R0QC 2ECCA 5F0CA 1WPKA 2EZHA 4A3IJ 3G1OA 4MFEA 2EH3A 4A3MJ 3G1MA 5EYRA 3HKZN 5IOYA 3WHBA 2E2JJ 1VNDA 2FQ4A 2L7FP 2JA6J 5J1YA 3HOUJ 2XGCA 4I76A 2G0EA 3K7AJ 4A3GJ 2AO9A 3CQZJ 4D7NA 2EZLA 2L0KA 5IYDJ 5JLWA 2XPVA 1B72A
chains in the Genus database with same CATH superfamily
3H9GA 4DW6A 2PEXA 3JREA 4PJLA 4XN0A 4BHCA 1IRGA 2V7FA 3S32A 1IXSB 1LQ1A 3PIOF 3JCUC 2OTJI 2XPUA 1YJWI 2XKOA 5CJ9A 4GFBA 4MFDA 2DTRA 4DJAA 4Y7NJ 1WGXA 3LSIA 4BY1J 1W5SA 4LLGF 3ZMTA 2DA5A 1USTA 1Q1HA 3U1DA 1JT6A 1BM9A 3QQAA 2BY0A 3CMYA 4NC8A 3L2UA 2IS4A 1LFPA 2PN6A 2WY7Q 4N0BA 3LL7A 1WJAA 3HSFA 2NVUB 3TW7A 4AD9A 1UHSA 2PMZA 3IH3A 2V1NA 2D2WA 4V19K 3RQIA 2UXNA 3D5LA 1BR4A 2F6CA 3FXJA 1MH4A 2XKPA 3MAJA 1E0EA 1NH3A 4P9UA 2BY2A 3K4MA 5CKTA 3GUDA 5J40A 2YS9A 2BW3B 3LMMA 2CQNA 5C3EJ 4ZYGA 3CCMI 1QNTA 3KZYA 3G4SI 3GTGJ 3P5JA 3SEZA 3W6VA 4GXOA 4NQWA 2F48A 4X0GA 2BZTA 4YG2F 2PX9A 5AIQA 4UUTA 1SD7A 1Y6IA 1IRFA 3MKWB 1XSDA 1MH3A 3HC7A 5J8FA 2DLLA 1DU6A 4EMSA 1IUFA 3S1NJ 1IN8A 4P55A 2HU9A 1IRXA 1T6SA 2RV8A 1P9QC 2RN7A 3BQZA 3J81Z 4CCKA 5EEAA 2MLKA 4EJTA 5HNHA 2F5CA 2A61A 3PUFA 3OR1C 4CO8A 3OS0A 3I55I 5B5EC 1I6XA 3CLOA 5EZHA 3N97A 2NS8A 3FHNA 2O03A 3FISA 4U7BA 2WV0A 3T5XA 2EZIA 2XF7A 1KONA 5H6QA 4UUSB 1FIAA 1XPXA 9ANTA 1ZELA 1NTCA 2ZSHB 3IUOA 1J2XA 5HS9A 2VBZA 1G3SA 4XRSG 1W7PD 1HDDC 4CSWA 2ZC2A 4EM1A 2VPLA 1TQMA 2VQCA 2K7LA 3IAM2 4RAZA 1MJAA 5L3FA 1HW5A 1I5ZA 2IVMA 3LSPA 5B1BH 1GVDA 5CVVA 2GIZA 2FXAA 1XDUA 2Z5UA 4FT8A 2VE8A 1IXRC 2WAQN 2VC0A 2P6TA 1B72B 4M71A 1PP7U 1J7KA 4E7SA 1HSTA 2EINH 3SDGA 5D5VB 2IGNA 1T8IA 2DT7B 1CF7A 3E5XA 2IW5A 1S9HA 2OJED 1SMYF 4A5NA 2ELKA 2O0YA 4ZH4F 1U78A 5EJCA 3FXMA 3WGHA 1U0JA 2B0LA 1X2NA 5HS7A 2L02A 3DBHB 2FJ1A 1IJWC 2LR8A 3ZQLA 1WH7A 4QSHA 3I4NJ 1ZH5A 1BJZA 1HXDA 3F3XA 4AYBA 1O57A 3S3NA 3OYDA 3HOXJ 3L1PA 1DP7P 4I7HA 3T8TA 2KIMA 4DBQA 4XLPF 4KISA 3HOWJ 3BCAA 3GWZA 1P6RA 2BHZA 2LY2A 1IO2A 1UELB 3BWGA 3BZCA 1ZG1A 5DCMA 3F8NA 2CFOA 4RAGA 1BW6A 1GLNA 2BHYA 2VJJA 3M9AA 1ZAOA 4ZDOA 3ISPA 1PUFB 2KDOA 4FISA 2XASA 2TRTA 3OYGA 1OLTA 4ABZA 5HVQC 3ZOBA 4RBOA 1FSHA 1P7JA 4QWQA 5EEGA 3FX3A 3CCJI 3ZGKA 5E79C 4RM3A 5HLGA 4A3CJ 5FFZA 3QWLA 2ESNA 3KYLA 1P2FA 2I5UA 3TBIA 4XRMA 1RRJA 3O8GA 4RGRA 2KHMA 3K6GA 2DA6A 2VOOA 4UY8I 1ETOA 4LIUA 2TDXA 5FGMA 4WK8F 3HTUA 4GYIA 3OL4A 2A6HF 2AHQA 1HDPA 2NVQJ 3OL3A 4UUVA 1YJ9I 5M5XJ 3I64A 4RMNA 1QGPA 3ULQB 4KN4X 2MBFA 1QZZA 3BTLA 2H6CA 1BJAA 3JRDA 2VXZA 4YFKF 2P81A 3KLOA 5KK1A 1U8BA 4ASNA 1FZPB 3KEOA 1FYMA 2NRAC 3MZYA 4KMUX 2ZMEC 2STWA 2OCCH 3H92A 2OU2A 4LD5A 3WTYC 3RKXA 1Z0XA 4KT5C 1T0FA 3JAMZ 1REPC 2EFPA 3ERED 4A6DA 2M45A 2DMNA 4E6KG 1SVMA 3VSLA 4M74A 2MD0A 5CVRA 4BU2A 3GF2A 2QUFA 3CC4I 5AIPA 3JSOA 2VQGA 4FE7A 2XHKA 2VKVA 3ABTA 4FCYA 3K4JA 1FIPA 2O5RA 4LITA 5LGTA 3G71I 1EV7A 1LKXA 4G94A 2RREA 2VQLA 4ZYAA 1PDNC 1RC9A 2KP6A 1SFKA 5DV5A 1W1WE 1RR7A 3KE2A 4G6DA 3PNYA 3G3ZA 4I98B 3P9IA 2QKLB 5DYMA 3J7ZI 2XSDC 2J5OA 2QSGX 2O7OA 1S29A 3K4LA 1WJFA 4N9IA 2EFWA 4ZZLA 2CU7A 2VBYA 1VTNC 1JGSA 2KZVA 3FXUA 4C2MJ 2D5VA 5J47A 1K83J 2EBIA 2M5WA 2F4IA 4IOCF 4HF1A 1N25A 5J1RA 2K40A 2QQBA 1OFCX 1BC7C 2DMQA 3HPHA 2DU9A 4KT6A 4IQJA 5DUIA 3LSTA 1TWGJ 3HUGA 5GAEJ 1ZG3A 2L9NA 1S8NA 4ON0A 3DTIA 4A3BJ 1ONVA 3ZQCA 2L3DA 1FBUA 4HX4A 2ESHA 2IS6A 3GLLA 3WG9A 5EG0B 4U0YA 2H6BA 4HSTA 5LD2C 3W2AA 2P7VB 3OMYA 1APLC 1FPQA 3HYIA 3N4MA 3DCFA 3S1RJ 3F72A 2NNYA 2M87A 2R7XA 2R7QA 5IP7J 4XLFA 5J6XA 4BQQA 2LKPA 3E7LA 3EUAA 2KRFA 4L9NA 3H5AA 2ISZA 2DCEA 4EM0B 2VODA 2KLOA 3PNTA 3DPUA 2VBWA 3BR5A 3H3UA 3LWFA 4JX4A 4KN7X 3WGIA 2H8WA 4RLQA 2WBMA 3BT9A 2HQ5A 3CDLA 4EGZA 2FD5A 4L0ZB 2VE9A 1D3YA 3FIWA 5JFRA 1D1BA 4IRGA 2QZ8A 1EF4A 2H1KA 2IRFG 4UV9A 3VYUB 3CCLI 4MHGA 4EJWA 4B43A 1LDKB 2RDPA 1IN5A 3AG4H 1XGMA 3MWMA 4IHYA 4WX9A 1KQ8A 5GADJ 1IV8A 2ICWG 3FMQA 2QBYA 4DZJA 3K69A 1TQPA 1MBFA 3RKWA 1WJEA 2QSHX 1X1AA 5GPAA 1FWZA 3RSNA 3F22A 3LAJA 1Z6TA 3HRSA 3EUHC 1LPQA 4MTDA 3QPLA 2CUZA 4ESJA 4M6XA 1SFOJ 1A6QA 3DEEA 3JRFA 3ZPLA 5JVGF 3AL0B 1WJBA 4OU0A 3M8FA 1JHFA 2Z3YA 1RESA 2GIVA 4GRIA 2LKSA 3GXOA 3QPTA 5E3LA 4HAMA 2XRNA 3H36A 4D0PA 2PMUA 3FZVA 2M0CA 2M2EA 4ESFA 3HZJA 3TO9A 1R4NB 4UB6C 2HOSA 4ZTFA 5D4SA 4PZJA 3Q0WA 4OIPF 1MMSA 4M72A 5JI6A 2OA4A 3O6BB 2XPWA 4Q47A 2A07F 4I6ZA 4KYWA 3S17J 1P4AA 2HNHA 2V1UA 2ZXHA 1DGWY 4L5JA 3J80Z 5CPRB 1ITYA 2ZCWA 2ZJQF 4QLCU 3G73A 2ZXIA 2XF5A 1VQ7I 3TDUC 3OSGA 2WC2A 1AHDP 1MZBA 3VB2A 1Z7UA 3B6CA 3C1DA 3K10A 4XKCA 3Q0VA 2W1OA 2PJRA 3QOPA 1CGPA 3L2VA 1FNNA 2V1DA 2DI3A 3RZOJ 2KDZA 3QPHA 4F55A 2ZJRF 1T0FC 1AOYA 2VL8A 3HGYA 3CJNA 1WPKA 4A3IJ 3CCQI 4KDPA 5EEHA 4AVPA 5F6FA 3RYRA 1WWXA 3ZR8X 3I9V2 1I27A 2EH3A 3ASOH 1OCZH 3HKZN 4G7OF 1FLIA 2MABA 1STZA 3KX2A 2FQ4A 1S7AA 1G8XA 2G0EA 2AO9A 4RA2A 4XBFA 4C2UA 1KA8A 1XGSA 2KPMA 2XPVA 5JLWA 4YFNF 2KMUA 3OR2C 5F1RA 3V8JA 3ZP5A 1R36A 1YHQI 1KQ0A 2KT0A 3JRBA 1UZCA 3CC7I 3HOSA 2R7OA 1KU7A 1IN7A 2COBA 1ETYA 2F5DA 2MD5A 2Q2EB 4CYDA 3HHGA 5FKLA 1VFCA 4UVCA 1OCPA 2VT2A 2GQQA 3PUBA 2XAFA 1RUOA 2WADA 5GP9A 1HOMA 4D1QA 1XD7A 3QRFF 2OC6A 4XLCA 1R1TA 2JA2A 3FKJA 2CGPA 2R7UA 2JTVA 3JW4A 1EKEA 2E2IJ 4YFXF 5LGUA 3F8CA 2B63J 1IUYA 2JSPA 3K1NA 4BGDA 5K5OA 1JUSA 4FETA 1RR8C 3WODF 3F0CA 4C3IJ 1R5GA 1WRJA 2DMPA 3S3MA 2HOTA 1XX5A 3WG7H 2Z1DA 3HOTA 4F52A 1Y1VJ 4LLNA 2WB1A 1G3TA 4XIDA 4L5EA 4J00A 1Z21A 1GXQA 4QPQA 4XQFA 2LLKA 1IAWA 1BN5A 1FX7A 4BJ6C 1LFUP 4D5CA 3HL2A 1X19A 5CLSA 1KU9A 1YFHA 1K6YA 2HGCA 1WHUA 2F4OB 2ZXJA 4YEJA 4CA0A 2IGMA 2DK5A 3FXQA 3CLQA 2X48A 2ZJ2A 2P5LC 2DPUA 4I99C 2DW4A 3VOEA 2L9RA 2R7TA 1I50J 4YIRX 3DEUA 1Z3XA 1O4XA 5LRRA 3FK6A 3GMEA 2STTA 2Z2SB 1D0ZA 1MD0A 4BXXJ 4BACA 1JKOC 4FE4A 3A0HC 4XSZF 5D6EA 1R23A 1RIOH 1HKQA 1SAUA 2CQKA 2FEZA 2HI3A 1LE8A 1WFXA 2A6TA 4HDUA 3GBGA 2LC2A 4I0BA 2W85A 1R58A 1W7PA 1XG1A 3MKLA 5EGOA 2XC7A 1O3QA 1ETQA 2WAFA 2K9LA 3RZDJ 3ROUA 4CZCA 3SYTA 4U7DA 2M8EA 4M3GA 4AIJA 3MMYB 3HSRA 2K9SA 4L9TA 3ABKH 5CVUA 3O2PE 4DZPA 1VQ9I 3S1QJ 1G2HA 1X2MA 4MGRA 1Z7LA 3LSKA 2Q8KA 5EDNA 2E2HJ 4HNTA 5TISC 1TWHJ 1HA8A 5LRSA 4EV0A 1QZEA 3TO7A 4D9JA 3K9TA 3RI4A 5ERIA 4HA8A 5FKKA 5J8CA 5K1YA 2CW0F 4HW0A 1JJ8C 1WCMJ 3CUQA 3CZ6A 3BR1A 3B6AA 1HLVA 2VJ4A 1IGNA 1R5HA 3L2RA 2JA7J 3PL8A 1JXSA 2PQ8A 2WTEA 2P5VA 3EUKL 2HPMA 2ELHA 2KQRA 2WAEA 2JUCA 2E19A 3BG6A 4PJ0C 2GZWA 5D8LB 4OIRF 3I59A 3K4NA 2EFNA 4BQAA 2HS5A 4HBLA 1YW7A 2H8RA 2GM4A 1I39A 1F43A 3DBRB 1B9NA 2KJCA 3A0BC 1V55H 5A2QZ 4HSRA 2ZMEB 1W5CC 2VIXA 4CCOA 1D5YA 2IAIA 4PGGA 1G6NA 2LY1A 1USSA 3CCEI 1TTYA 2GA1A 5HNFA 2P0WA 3F8BA 3GZ6A 4M6YA 2Z9OA 3WTUC 2KKOA 3CO6C 3M8JA 4KA4A 3LSHA 2VLAA 1YIJI 1ON1A 3LAPA 2OUMA 2XIGA 4WF2A 1PP8F 3ABMH 3F21A 1J5YA 4HNUA 3K2AA 1H9TA 4CYCB 1F1ZA 2XSJC 2ZMEA 2VT3A 5LLQA 1XTAA 4ZYDA 3HEFA 2EV0A 1T95A 2LREA 1LNWA 1SD6A 2R7SA 2E1CA 4NQWB 3U2RA 1XCBA 2HXOA 4BXFA 5TRDA 2ZNYA 3NAUA 3ZN1A 1I6HJ 4IL6C 1T2KA 1SFUA 5M5WJ 4CYCA 3W2WA 2IS1A 2DOEA 1MMAA 5M3FJ 4H0EA 4M3BA 1LJ9A 4X6AJ 4GGGA 1V5EA 4H4KC 3M7GA 3IH4A 1XMAA 1OCOH 4M9XA 4C3HJ 3J80K 3SXYA 3BR0A 4E7IA 3PQKA 2X0LA 4XKWA 1LVAA 4BJTA 1WQ2A 4DQ2A 4RGXA 3D0SA 4F7ZA 5BOXA 2HDCA 4A3LJ 2HKOA 1YW8A 4NHJA 1WJ5A 2K9NA 1ETWA 1Z67A 3OWTA 3Q9SA 3IKVA 2IGKA 3QAHA 3RPUA 2COMA 3WU1B 2FF4A 2F5FA 1IV6A 2DODA 1N77A 2EFOA 2K27A 2RVCA 3DLAA 2XV4S 5E18F 3AKZA 4MLOA 3GZ5A 2M4KA 3MZ8A 5IYBJ 2HXIA 1XCVA 2XGDA 1YYVA 1UG2A 1FY7A 3GO5A 2DOAA 3GZNB 2C6YA 1LEBA 1D0YA 2QEXI 2H27A 1OYYA 1IDYA 3OOUA 1O7LA 1RNLA 4XM3A 1UHWA 3ERMA 2JA8J 4JOMA 3ZMVA 2QENA 1O7FA 3LNQA 4MIMA 5HDNA 4P96A 4BH9A 2E7XA 1VQ6I 2A69F 1OISA 1CF7B 5IY5H 4Y4RA 2L5QA 3OYFA 4LGWA 1A5JA 4AC0A 1YQAA 4ITVA 3GYHX 3M3YJ 1SMTA 2PFBA 4BNCA 3IP4B 4KUMA 1YJNI 2NVYJ 2K4JA 3GTMJ 3HM5A 3DQVC 3K1MA 5JVTA 3M1CA 2KIUA 3BTCA 3CCYA 3GFLA 1FYKA 1MJ9A 3CJTB 2MG4A 4EQQA 5E3NA 2BGCA 2E1MC 5FLMJ 1V54H 3BROA 2DQLA 4FX0A 4RS8A 4BY7J 1EH6A 4IX7A 5DCMB 2L01A 2Z99A 5FLXK 2EIKH 5KAIC 3AG1H 3NWTA 3OS2A 1U5TA 2O8XA 4UXNA 3BZ6A 3L2QA 1T38A 4DBRA 3H0DA 1QHGA 3ABLH 1HW2A 5BQTA 2B7EA 2ZSIB 5HLHA 3BY6A 4R79A 2RQQA 1M1EB 4KFCA 3WGGA 2V6EA 3OV8A 4IHXA 2MH2A 1FC3A 5EF6A 2LF8A 3IC7A 1SEUA 2JA5J 4N4OB 2MC4A 3DP7A 2FA5A 4A0XA 3WHCA 4PCQA 1Y1WJ 3ZMUA 3CUQC 3H5NA 3EUHA 1TNSA 1X1PA 4WXHA 2ZFUA 2P8TA 5H6RA 1JE8A 1ZN2A 3DXJF 5IP9J 1UFMA 4CXFA 3TL4X 2FNPA 2VXDA 2Y0SA 4U88A 4V2FA 4M3DA 3LQRA 3VDXA 1F4KA 5F1JA 1R7JA 1ZREA 2NXNB 3K0LA 2CSOA 2HQNA 2XAUA 4C30A 1WJDA 4UB8C 3I56I 3V7RA 1D1AA 2K4BA 5EZGA 4RB3C 4K2EA 3I0TA 3FMSA 3JTGA 2BY1A 3KFWX 4S05A 2WWYA 1HBXG 3OYEA 2V9VA 5C4XJ 1MMDA 5FRNA 1VQOI 3B73A 2BXZA 3QYBA 1OCCH 3OYKA 1VQ4I 3BG7A 1GUUA 3O3KA 4A0ZA 2V79A 4P5OA 1ETXA 1FJLA 4BDYA 5ILUA 3BR6A 1NG6A 3H3ZA 2JQ7A 2QQ9A 2W84A 4LIVA 3BZKA 3RCOA 4IQ4A 1Z6RA 1SVOA 5BPDA 2M4GA 4PSWA 2QYOA 3TW6A 1MBEA 1ZGAA 1DU0A 3EYYA 3KEYA 3MD2A 2JVHA 5C4JJ 1OYIA 3A03A 4IHSA 4MO7A 1YTYA 3WU2C 4DGWB 2FX0A 3S15J 2MLGA 2JMWA 1R5ID 2HZDA 3RPUD 2EB7A 5M5YJ 3S2HJ 2A5WA 2JPBA 2R7RA 2NS0A 3BR2A 1VQLI 3BLYA 3HBLA 2Y9ZA 2HDDA 2CW8A 4TV7A 3E5QA 3U1KA 2IJLA 1E17A 2W82A 2DA4A 4DOZA 5F04A 5K5RA 2X1EA 3CJRB 1ZKGA 4FASD 2X6OA 2PLYA 2CFXA 5A2QK 1HC8A 1YS6A 2R4GA 3ABUA 2JK3A 2YX7A 2Y75A 4OINF 1E2XA 4LG0A 1JKQC 3S2DJ 2A6EF 4G6QA 2QM3A 3G2BA 2LP0A 3V8KA 3K70D 4B48A 1X3ZB 1GXPA 1VF9A 1FTZA 5D6FA 1BC8C 2LG4A 2CV0A 2DQRA 1KYZA 1BI3A 1ON2A 2AXTC 2GBYA 2VKDA 4Y15A 2Z16A 2NYXA 3I54A 4ESBA 2OQRA 1YRNB 1HW1A 3HUGB 2CH0A 3R0JA 3A4CA 1AWCA 1KQ9A 1FOKA 3GEZA 2ELJA 1ZYRF 4MTEA 1I1SA 2V9PA 4M9SA 3SFIA 1P7IA 3ZQ7A 2CMPA 2V26A 1PJRA 2X6XA 4O5VA 2GXBA 3MEXA 5L3DA 2K3FA 4CZZA 3JR9A 3W3CA 1YRNA 1PUEE 2IEKA 1MBKA 2ECCA 5F0CA 3AG2H 1EJ9A 2DYSH 2DK8A 4MFEA 2JT1A 4FX4A 4LK0F 3HRTA 3K70C 4E7KA 2RKHA 1D5VA 2E2JJ 3HTSB 2L7FP 5FRMA 1EH7A 4XRFA 3SEQA 3HOUJ 4EVIA 3PQJA 3CQZJ 1FP2A 2H94A 3IWFA 2VJIA 5LGNA 2CYYA 1TNTA 1ZLJA 2VKEA 3H3VK 2YU9J 2O9LA 2Y0MA 3M8EA 4L18B 1R49A 3E0JB 1T08B 1WI9A 2ID6A 3CP2A 5E8IA 3J81K 3FWEA 1U6GA 4HG2A 5K5QA 2VBXA 2HVRA 2QF7A 5GPCA 4BAYA 4L5IA 3PIPF 5KNLA 2KZGA 1ZRCA 1Y8QB 2X51A 2OPTA 4PDKA 5D4RA 3DU5A 2QBYB 3ZMZA 1AA7A 1XB4A 2HR3A 3CMMA 4EJVA 1UHMA 4HF0A 3SDBA 1B8IB 1JTXA 2OF7A 3KYDB 4O6JA 1C0WA 1LDJA 1B6AA 2K86A 4I02A 5K7ZA 2XAGA 3BJAA 1MNDA 1U5TC 1BI0A 1RKTA 2K9MA 5DM7F 4Y52J 3JRHA 4N9HA 1MSEC 4HYEA 4IRHA 3K4KA 3OYCA 3AFHA 2HYGD 2RNGA 2CWEA 3E6CC 2OCEA 4BQOA 2LVSA 1ZG5A 1B8IA 1JKRC 4BXUA 1GV2A 4A3JJ 1LVKA 2LK2A 1BL0A 1G3WA 5KVRA 2HVSA 2G9WA 2DBBA 4HNVA 1S3JA 1RI7A 4OWRB 3ZN0A 1N78A 2LRDA 1GDTA 2XUBA 3BG9A 3EPZA 1B4AA 1VQ8I 4LFUA 3LSJA 3BG3A 2H09A 1QPIA 4EJOA 3Q3SA 2X1CA 2EA4A 2FBIA 3LFKA 5FKMA 1NG7A 1XC5A 3PFYA 3GW2A 3ZXSA 3ASNH 4B1RA 1LDDA 1LUJB 1OJLA 2BVMA 3L00A 2FOWA 3OSFA 4FHTA 1B9MA 1ODDA 3DPTA 4DNCA 2XAQA 4L9JA 3KYCB 3HOZJ 2HQRA 3TMOA 2OBPA 4L9VA 3BCBA 1R22A 3AAFA 2PJRB 2ZB9A 2AQFA 4HLYA 3KCCA 1W0TA 5L3EA 2MH9A 3DEWA 2JWTA 3KZIC 3M1EA 4B4CA 1R71A 1P4XA 4IHWA 1MMGA 2G7UA 2ME0A 3H0GJ 2IPQX 2VPRA 3DBLB 2PI0A 4U87A 4CICA 4A2UA 1A04A 4B44A 3GTQJ 3KP5A 4XOTA 1HQCA 1IXCA 4D7MA 3MZHA 1W4MA 2JN6A 4J01A 2DO7A 3KP7A 3F23A 3CCSI 4AUXA 3KIOA 5IP6A 3ML6A 4MEYF 2MA3A 3COAC 1IG7A 4KNYA 3PO2J 2FQ3A 3OYAA 4DYQA 1WSUA 4XR6A 2A5YB 2LMDA 4A5MA 5LHGA 3F8FA 4IF4A 1SD5A 4LMYA 5FROA 5ED4A 2HTJA 5FO5A 1SC7A 3LFUA 2M0MA 5KCMA 5HDGA 2M1BA 1BOAA 3JTHA 2JSCA 1G4DA 3WU0A 4CCNA 4OIOF 4JP0A 4BEHA 2X4HA 2Q0OA 4EATA 2VN2A 3DTEA 3UKGA 4YRVA 2Y2ZA 3TDZC 2QSFX 4NDLA 3GTOJ 4XL9A 2J5PA 5L3GA 4XNFA 5L3CA 2ADUA 3FKIJ 1Q1VA 4BL0B 5ILVA 3CC2I 1VI0A 1KU2A 2CUFA 3QU6A 5F27A 1DUXC 1WZ2A 3J7AO 2ECBA 1X4OA 5D5UB 3VYTB 2A68F 3R0AA 4XLAA 4XSXF 4BYYA 1TWFJ 3JAMK 3T1BA 1ETVA 3SZPA 1LB2A 1UMQA 2K85A 1POGA 2QVOA 3UNGC 1QA6A 5B3SH 3NQOA 5E20A 3OYNA 2PBIA 1VQPI 3CJQB 2ZBKA 1R9TJ 4RB1A 2ACJA 1OR7C 2FU4A 3OY9A 5K7HA 1BR1A 5FFXA 3GFJA 2DA3A 3H5RA 4G6TB 3KLNA 3D1NI 4B3XA 2HWVA 3CF5F 3K2ZA 2R7FA 3I4MJ 5FJ8J 3OOPA 2QKMB 1F9NA 2I8DA 4XRSA 4XKVA 4LG3A 1TT5B 3E5UA 4EGYA 5KHDA 2E1MB 3JRGA 4ZDLA 2VONA 1MIJA 4BBRJ 1ZGWA 1JT0A 1TW3A 5CVIA 2E7WA 1LE8B 4ETSA 3HDDA 1YX5A 3KZZA 1MDMA 1ZRDA 4B09A 2PG4A 2R92J 4QPOA 1W7PB 3R4KA 3BP8A 4F92B 3C18A 1QVUA 4UHTA 2M34A 5EGOB 3HGGA 4RM2A 3V8LA 2P5KA 1MW7A 3WTSC 1OCTC 3A01A 4ZTJA 1TQIA 1T39A 5CYVA 1OYWA 1BR2A 2I10A 3RYPA 5IT3A 1OKRA 1ZARA 4NNJA 4B47A 2O8KA 3FBNB 3VFZA 2E34A 4HLXA 1RUNA 2PMHA 4XORA 4MQVA 4CCMA 1ZTRA 1X4PA 2AXLA 2R5ZB 1FOWA 4E7LA 4S04A 5LEJA 1FBQA 5ICFA 3HXLA 2JUGA 3CMEI 1K78A 5E3MA 1Z91A 1G59A 3GLXA 3CUQB 4YIFA 5F0HA 1D1CA 2R3SA 4RB2C 3JRCA 1YO5C 3M07A 3DLLF 3A02A 3DFGA 4B3AA 2R5ZA 2ZKZA 1Z9CA 1ZR4A 1JJ6C 1H8AC 4LK1F 3H9JA 3ELKA 4KITB 3IAS2 3VPRA 3X2QH 5E17F 3I59B 3DV8A 1XMKA 5FD6A 2HTSA 3TEDA 3GFMA 2YPRA 5FKOA 3BJOA 2GOXB 3IL2A 4L0YB 3FXRA 4A3KJ 1Z3YA 4J19A 2FSWA 1T98A 3LQQA 1ACIA 2WY8Q 2GLOA 4P9FA 2UXXA 1MMNA 2RC4A 2E35A 4CGZA 2EPFA 3L2CA 4BKXA 2E1OA 1JI8A 4YELA 5GTIC 1FT9A 2UZKA 2R5YA 4Y3OA 4OAYA 2MW8A 3SFZA 1F5TA 3BOQA 3HG9A 3K1PA 3SJMA 1ERDA 3ZQIA 1S7EA 4IZZA 2L9VA 2EV6A 2DAOA 4AIHA 2LH9A 4G7ZF 1J09A 2Y9YA 2XVCA 1BBYA 5IYCJ 3OIPA 3JRIA 3P9KA 1RZ4A 2M30A 1O3SA 1JUPA 3LA3A 1AKHB 2X6YA 3F9KA 3ZCOA 1R6RA 3RQ4A 5F64A 4ZYHA 1YX3A 2F2EA 3NWSA 5E8GA 1Y39A 2M7AA 2XGXA 3AL0C 2D1VA 1P4WA 2K3PA 2UWMA 2K9QA 3NEUA 2FUG2 4HEA2 4AWXB 3TKYA 2VC1A 2OTLI 4UVBA 5J4YA 4PK4A 4Q5SF 1RPWA 1AKHA 4RLFA 4ENNA 5DCFA 4XMYA 4RDUA 4LB5A 1D8JA 1YIOA 2DJIA 1UJ8A 4D5FA 4I09A 4HX8A 4IHVA 2HYJA 4PUSA 5B1AH 3OIQA 2CQXA 1VQMI 1QPMA 5LEKA 4HOBA 5AONA 2NOGA 1FTTA 3EQLF 3CUOA 3O8HA 4WWCA 1TWCJ 3IRQA 2R7ZJ 4GO1A 4HV6A 1A35A 2NNNA 4M9ZA 2DFIA 3RPQA 3BG5A 1J0RA 2IBDA 4X1EA 1HSJA 1MJBA 4IOAF 5BNGA 2IA2A 3VEPA 2P4WA 2P6SA 2R7WA 2RQPA 3QPSA 2HZTA 4LLLA 5LFAA 4IPAA 3E6BA 3PSIA 5LBQA 2GXAA 4WXCA 3TP0A 4CDGA 3IHUA 5JHFA 2HDWA 1A6IA 2DA1A 4OAZA 2ID3A 4NC7A 3LSRA 4RAFA 5DDGA 1IZ1A 1JKPC 2BYVE 1FSEA 3GTPJ 5FB2A 3U9GA 2MGQA 3BPVA 2PMZN 1CQTA 2R7VA 2WAQA 2XRLA 1X3UA 1FBSA 3J7AY 4I01A 2XB5A 3L9FA 2BW3A 3CCUI 3T0YA 4C9YA 2OQGA 2GAUA 4F3QA 5D5XB 1WJCA 2HKXA 3A1YA 3DKXA 5JHUA 2TCTA 3QU3A 3CDIA 3PM1A 3C2GA 3C2HA 2L4AA 2W25A 2HVQA 2YSRA 4E70A 1KYWA 2JVGA 1YS7A 2F4MB 5H2FC 1MBJA 1MBGA 5E3OA 4MNUA 2GOMA 1XN7A 4G8XA 2YX4A 3DF8A 3HPGA 4G12A 2EIMH 2Y69H 3VYRB 1FMVA 4LB6B 4GYGA 5DD4A 3S3OA 2MYSA 2DFHA 1U5TB 2O3FA 4DYRA 1K61A 4WCGA 1V5GA 1J9IA 3FBIB 4FTHA 4LJZF 2EZKA 4LOCA 4Z6YA 2O6GE 2DTZA 1E3OC 2GXGA 3HRMA 4RGSA 3SQNA 1VQ5I 1NK2P 2B9SA 2DA7A 4UUSA 4CHUA 4BE2A 4A3EJ 3OYIA 1X58A 4ENKA 3I4PA 1TLHB 1BI2A 1Z77A 2JJ7A 2V4JC 2YR2A 3MFKA 2EZHA 3KEQA 1QBJA 2EJRA 1U2WA 4E7JA 2CO5A 4PJMA 2LF7A 2XDVA 4A3MJ 1DDNA 3S2WA 3CESA 1UG0A 3G1MA 3ZQQA 2QA4I 5IOYA 3WHBA 3OYJA 2IP2A 1VNDA 2JA6J 3CD6I 2BXYA 2GWRA 1D8KA 4RB0A 3A2KA 4D7NA 4AM3A 4F93B 2Y48A 1X1BA 4E4HA 2IT0A 2EZLA 3WE3A 4W1UA 5DD8A 1B72A 1U8RA 3MCZA 5CVJA 2NAZA 4ZJZA 1K4SA 3CMAI 1ZGJA 3MN2A 1BIAA 3L09A 5B66C 3JSPA 1J59A 5K7FA 2RNJA 2DDBA 4ZDPA 3E6DA 2UV1A 2LY9A 3CDHA 5ICEA 3MVPA 3V42A 1XGNA 5FD5A 3TOBA 1ORKA 2UUZA 2CUJA 3BPXA 3PNVA 3ESWB 1ULYA 3L2WA 4WXDA 1O3TA 1V3FA 3CP8A 5HLIA 3WTWC 4U0VA 2E5NA 1DP3A 3EDPA 4BUPA 5IPAA 2JPCA 3IRRA 3BQYA 4AYBN 2E5ZA 4XLEA 2DOFA 4A69C 1SD4A 4M73A 4IVNA 3EYIA 2L4MA 2Y31A 1SFEA 1P92A 3TP3A 1B59A 1L3LA 3EETA 5CQEA 1DPRA 5KAFC 4XK4A 3G1LA 2Q1ZB 1PUFA 1ZLKA 1NHAA 2QQAA 3F6OA 4CUGA 1S7OA 2EA2A 4E7ZA 2LTPA 2KRCA 4AVZA 3F8MA 3TQNA 4I0AA 2XROA 3HSEA 1Y0UA 5TGTA 3JRAA 1ZHFA 4LG0B 2XGEA 1YLFA 4BHBA 2LFBA 2EK5A 3Q9VA 2DT5A 3Q5FA 2XB0X 2Y0SN 4C2TA 1QZYA 1BW5A 4PGHA 2V6CA 3RDIA 2BOLA 1ZK8A 3HIFA 3REOA 3WTXC 2CV2A 2JRTA 2FBKA 3BC8A 4XONA 5E1WA 3OYHA 2DDAA 2CG4A 5J3LA 1QRYA 3GTJJ 4IJAA 3P7NA 2L7ZA 2IS2A 4JX5A 2ME6A 1YI2I 2CJJA 2XF6A 1ZQ3P 1TWAJ 1BI1A 3BR3A 1UCRA 2FNAA 3E6MA 4GDFA 1MKMA 5FKNA 4I2OA 4GCVA 3VYSB 3MKZA 4HZFA 2VB6A 2R93J 2V9KA 3HOYJ 1TBXA 3WTVC 1I1GA 4JYKA 4MEXF 4DYCA 4PSXA 1TP4A 1A36A 4HF2A 4IHTA 2DA2A 1XMXA 4OMZA 2DPDA 2DFEA 3FXLA 1YW9A 4RGUA 4UNOA 1FMWA 1SAXA 4II2A 1JTYA 2LBFB 2LYCA 1XGOA 1TC3C 2X9DA 2KISA 3ZQGA 3HHHA 1IF1A 2W48A 5HLTA 1ETKA 5BMZA 1E3HA 2FBHA 1O3RA 2W00A 1TW2A 4A0YA 2OV7A 1OR7A 3S16J 2X85A 2R7DA 4QTRA 4R1HA 4F91B 1F36A 3V7SA 4HPQA 2OAZA 5JR3A 1FOXA 4ENJA 1W0UA 1BOBA 2LSOA 3E3VA 3LOCA 3CCRI 5ILSA 4NUBA 5DS9A 5F08A 5F0FA 4C3JJ 4KICA 1U3EM 2E71A 2QQ8A 2LBFA 3LSGA 1TT0A 5JLXA 2P7CB 4NB5A 3QP6A 4BDZA 1NK3P 3DWLE 5GAHJ 2VJ5A 5D5WB 4IRIA 3RKQA 1R00A 3LSMA 3TGNA 4CCJA 3I3LA 1SANA 2VOPA 2D1HA 3MQ0A 3PO3J 2OD5A 4IEJA 2Z33A 2ZXWH 3GFIA 2W24A 2E36A 4M6VA 2OZUA 1LEAA 3Q0UA 3RTRA 1IC8A 4G9YA 2VKHA 2QCOA 4II3A 4U0WA 1MNMC 3ECOA 3HRUA 1QQIA 1R1UA 5E1ZB 3CTAA 2HOAA 5D8KB 3C2BA 1IN4A 2MSYA 4NBQA 4UV8A 5TJJA 2Y30A 3NRVA 4XLNF 5ICGA 2AS5F 4ANJA 4XICA 2FMLA 1PVEA 2DN0A 2A3SA 1OPCA 3MKYB 4YIIA 3FK7A 3ZMDA 4HV5A 4Y17A 2L7MP 2VQHA 4BJ5C 4BS9A 5BS6A 5DM6F 1DPUA 4CH7A 2M9HA 5LHIA 5EG0A 4BBSJ 2MC3A 3S14J 3I58A 2XAHA 5IT9Z 4A3FJ 2BVLA 2DFFA 3SZTA 5LHHA 4A93J 4XOPA 3H1CA 1QO0D 1XSXA 4M3FA 2XAJA 3KETA 2JRMA 1T56A 1V5FA 5H20A 1TZLA 2DJNA 1B1BA 3TO6A 3OIOA 5FLVA 2YU3A 1JGGA 1E3PA 2BE5F 2L54A 4OMYA 2LDUA 3BTIA 3GTKJ 3PFIA 1X1DA 2QLZA 1I3QJ 3V4GA 1YE9A 2GA2A 3FXOA 3W2VA 5DUKA 2NS7A 4CCLA 3HOVJ 3DTKA 1EA3A 1OMIA 2QWWA 2DMTA 1H88C 2JZYA 4Z2YA 3DKWA 3W6JB 3S8PA 3GX4X 2EWNA 1FEXA 1X3WB 2CS3A 3WTTC 3G6EI 2NOJB 5CQGA 1IRZA 5ICCA 3S93A 3U21A 1MBHA 1HCRA 1G3YA 3DPLC 3PJRA 4O3MA 1ZR2A 5J4VA 2W57A 4S0HB 3OYBA 2VI6A 1FP1D 2FOKA 4B8XA 3DU6A 3HKZA 2CQQA 3GCMA 4XKBA 2EIJH 5DEQA 4A12A 5C44J 2IXSA 3RIRA 1K7AA 2NVXJ 3IWZA 2LOOA 2NVTJ 3ECHA 1H9GA 2WA0A 3QODA 2CUEA 4BE1A 1SVLA 1R1VA 1X1CA 4BEHB 4JX6A 4KIGA 5BPIA 1AU7A 2E1NA 2RAEA 3QOEA 3CF2A 3P9CA 3KP2A 2AQEA 1WI3A 2VASA 4V2GA 3FXKA 4BHPA 4JK1X 3GTLJ 2RGVA 1QHHD 3NARA 1H0MA 3I5UA 2O61A 3KP4A 4ZC3A 4KIBA 4P1WA 2BV6A 3KP6A 4PJJA 3UR3C 4G7HF 1OCRH 1GV5A 2L2OA 4HDVA 3IH2A 3QYEA 3SZGA 6PAXA 1VQKI 2DT6A 1GVJA 5HOOA 2OZ6A 3KP3A 2BEOA 3I53A 3LA7A 3N05A 4ZYEA 3FHZA 1QU3A 5GAGJ 1TL8A 1JHHA 3BTJA 3H9QA 3CO7C 2L7KA 5HDKA 1S6LA 3TOAA 2N8GA 2CV1A 4JQFA 1GT0C 2YUSA 3QP5A 1IDZA 5J1UA 4QIWN 1KGSA 2LKXA 2ZJPF 2QGUA 4PFOA 4RAYA 3BJ6A 3FM3A 1RKWA 2WV1A 4DIQA 3VODA 3K4CA 3WTZA 3FF5A 3OYMA 1HF0A 2VUMJ 3L7WA 1Y56A 1L0OC 1WKMA 1MDMB 2FRHA 3FM5A 2L9SA 3C7JA 2KIQA 1N75A 4MQ9F 3B02A 4BE0A 1WH5A 3OYLA 1IW7F 1IN6A 3ZRGA 3ZQFA 3VSKA 1W36D 2CW7A 1FOYA 2HYFA 5HS8A 4AU7A 3A01B 4NC6A 1LFBA 4JBAA 3FDYA 5HODA 4R8HA 1RETA 4IKFA 2Q2EA 1JUMA 3RKYA 2DYRH 3QYFA 1R4MB 2F5VA 3E97A 5M3MJ 2M3AA 5FLXZ 3M4OJ 3RJPA 1XSVA 2FE3A 4BQNA 1K6OA 4KMFA 4ENMA 4IO9F 2PJPA 3IV5A 4EM2A 2W7NA 5E1XA 4Q4ZF 4AIKA 2HEOA 1VQNI 1K78B 1YITI 3HB9A 4Q48A 2LD5A 1KU3A 2EFQA 2X1DA 1FYLA 1T33A 4UVAA 3K4BA 1OQYA 2HOEA 2KRHA 1S72I 1K79A 1J75A 1QVTA 3S1MJ 2H1LA 4FQGA 1DGRM 2X6WA 4Y13A 1Y8RB 2W4SA 4HRIA 1W36C 4A6EA 2DMUA 4XLHA 1K4TA 2KFDA 4HQEA 1MGTA 1DQUA 1ENHA 3IKTA 1EH8A 2K5CA 4OIQF 1VZ0A 2WB1N 3AG3H 4HX7A 3D5SC 3DKYA 3R60A 4XN3A 3T8RA 3CCVI 4AIDA 1Y0NA 3SHFA 1I3AA 1YOVB 5IOZA 2A05A 3I71A 1D0XA 3J7YJ 3OS1A 1ZRFA 4EJUA 4PFPA 3F6VA 1S5LC 1SFXA 4IXAA 1UB9A 1MSFC 1XDSA 3HJEA 2R5YB 3H35A 1U9OA 1Z1DA 4E7HA 2ETHA 1W5TA 1H89C 3D5RC 1U9NA 2MFZA 1UAAA 1BIBA 1MNEA 1Z05A 1KZHA 2CRGA 5DTDA 3LA2A 1YG2A 2M8GX 1BA5A 4KIFA 2EILH 2KJBA 2HFHA 3FMRA 1XS9A 4EEFG 2ISYA 2V1XA 4OOIA 4W97A 2KL4A 1GHCA 3V7CA 4A3DJ 3VWBA 4HQMA 4M3EA 2E60A 2IA0A 2EQRA 2M7BA 3R6SA 2G7HA 3GVAA 1PYVA 2LNBA 5IT9K 2CQ7A 2R0QC 2BY3A 4N4NB 3ZQHA 2ZNZA 5GTHC 3ZMSA 2ZO4A 1A31A 4PJNA 2D45A 2DXIA 3G1OA 2IGOA 4KJZA 5L3BA 3ONQA 2FMYA 2IA1A 2HPIA 1WVRA 5EYRA 2BBYA 1V4RA 3R61A 3KPHA 3PSFA 4Y33A 4ZZDA 1HKTA 5J1YA 3WE2A 2F5EA 3W6KB 2XGCA 4I76A 2ZFWA 3K7AJ 4A3GJ 3E1SA 2KIFA 3C3WA 2HQAA 3BDDA 2EV5A 1HKSA 2L0KA 5IYDJ 2K02A
chains in the Genus database with same CATH topology
4DW6A 2VKEA 3H3VK 3JREA 2YU9J 2O9LA 3MN2A 2ID6A 5K7FA 2KT0A 3JRBA 2QF7A 5GPCA 2COBA 1ETYA 2XPUA 5FKLA 2LY9A 1VFCA 3MVPA 4GFBA 1OCPA 4MFDA 5GP9A 4Y7NJ 1ORKA 2OPTA 1WGXA 4BY1J 1HOMA 2DA5A 1JT6A 3QQAA 1B8IB 2E2IJ 1JTXA 2OF7A 3CMYA 2B63J 1JUSA 5K7ZA 5IPAA 3F0CA 3BQYA 1RKTA 4C3IJ 4AYBN 4Y52J 3TW7A 3JRHA 1MSEC 1UHSA 3IH3A 2DMPA 4A69C 2HOTA 3RQIA 2Y31A 3TP3A 1Y1VJ 1MH4A 4XIDA 4L5EA 4XK4A 3G1LA 1PUFA 2LLKA 2YS9A 2LVSA 1B8IA 1JKRC 5C3EJ 1LFUP 1GV2A 4D5CA 2LK2A 4A3JJ 1BL0A 3GTGJ 2LTPA 4HNVA 3W6VA 1GDTA 4UUTA 3BG9A 2X48A 3JRAA 2L9RA 2XGEA 3LSJA 3BG3A 1I50J 2LFBA 1QPIA 1MH3A 3Q3SA 1O4XA 2XB0X 2Y0SN 5FKMA 1XC5A 1DU6A 1IUFA 3FK6A 3S1NJ 1BW5A 4B1RA 1ZK8A 1OJLA 3BQZA 4BXXJ 5EEAA 4FE4A 3OSFA 1JKOC 5J3LA 1QRYA 2HI3A 5EZHA 3GTJJ 1LE8A 3HOZJ 2L7ZA 3GBGA 4JX5A 2NS8A 2ME6A 3FISA 2CJJA 2ZB9A 1XG1A 2EZIA 1W0TA 3MKLA 1TWAJ 1ZQ3P 5EGOA 3BR3A 4UUSB 1FIAA 1ETQA 3DEWA 2JWTA 5FKNA 3RZDJ 9ANTA 4B4CA 1NTCA 4IHWA 2ME0A 3H0GJ 2VPRA 4M3GA 2R93J 3HOYJ 4XRSG 4DZPA 2K9SA 1G2HA 3GTQJ 1HDDC 3S1QJ 4JYKA 1X2MA 5EDNA 4D7MA 2E2HJ 4DYCA 1TWHJ 2JN6A 2DA2A 4AUXA 3LSPA 5IP6A 1JTYA 1GVDA 1TC3C 2X9DA 5FKKA 1IG7A 3ZQGA 3PO2J 4DYQA 2W48A 1WCMJ 1JJ8C 1ETKA 2WAQN 3BR1A 3B6AA 1HLVA 3S16J 1IGNA 1B72B 4QTRA 2JA7J 1F36A 3SDGA 1W0UA 3LOCA 5DS9A 5F08A 5F0FA 4C3JJ 2ELKA 1U78A 3LSGA 2E19A 5JLXA 4JP0A 1NK3P 1X2NA 2FJ1A 3RKQA 3UKGA 1IJWC 2H8RA 2GM4A 1F43A 2Y2ZA 2LR8A 3ZQLA 4NDLA 1WH7A 4QSHA 1SANA 3GTOJ 3I4NJ 3PO3J 4IEJA 1D5YA 1BJZA 2IAIA 4M6VA 3Q0UA 3HOXJ 1IC8A 3FKIJ 3L1PA 2QCOA 1MNMC 1Q1VA 1VI0A 4W1UA 2CUFA 5F27A 3HOWJ 2ECBA 2HOAA 3C2BA 2MSYA 1TWFJ 2Y30A 1ETVA 1UMQA 3K2AA 1BW6A 1POGA 4XICA 4CYCB 2DN0A 1PUFB 4FISA 3FK7A 3HEFA 2L7MP 2TRTA 1R9TJ 2M9HA 4ABZA 5EG0A 3ZOBA 4BBSJ 5K7HA 4RBOA 2HXOA 3NAUA 1P7JA 1I6HJ 2DA3A 3S14J 3D1NI 4A3FJ 5M5WJ 4A93J 4A3CJ 3I4MJ 4CYCA 5FJ8J 4XRSA 4M3FA 4XRMA 5M3FJ 3O8GA 4M3BA 4X6AJ 1T56A 3IH4A 4C3HJ 3JRGA 2DA6A 2DJNA 3BR0A 4BBRJ 3OIOA 1ZGWA 1ETOA 1JT0A 5FLVA 1LE8B 1JGGA 3HDDA 2AHQA 1HDPA 2NVQJ 3BTIA 3GTKJ 2R92J 5M5XJ 1I3QJ 1QVUA 2M34A 5EGOB 4A3LJ 2K9NA 2NS7A 3HGGA 1ETWA 3HOVJ 3BTLA 3JRDA 2DMTA 1H88C 1OCTC 2P81A 1U8BA 1IV6A 3A01A 1FEXA 2I10A 2O8KA 1IRZA 1Z0XA 4MLOA 5IYBJ 1ZTRA 2HXIA 2XGDA 1UG2A 2DMNA 2R5ZB 1MBHA 3OOUA 1IDYA 1HCRA 5E3MA 1ZR2A 5F0HA 4S0HB 2JA8J 2VI6A 4FE7A 2VKVA 4FCYA 3LNQA 1FIPA 4MIMA 2CQQA 5C44J 2NVXJ 3JRCA 2NVTJ 1RR7A 3A02A 4B3AA 2R5ZA 2CUEA 1ZR4A 1JJ6C 1H8AC 1A5JA 4AC0A 3VPRA 3M3YJ 4JX6A 2XSDC 1AU7A 2RAEA 2NVYJ 3TEDA 2O7OA 3HM5A 5FKOA 3GTMJ 4A3KJ 4J19A 1WI3A 4V2GA 2CU7A 2GLOA 3BTCA 3CCYA 3GTLJ 4BKXA 2MG4A 5E3NA 4C2MJ 2D5VA 2E1OA 1K83J 5FLMJ 2EBIA 3NARA 4BY7J 5J1RA 2R5YA 2K40A 2MW8A 1OFCX 2DMQA 1GV5A 3SJMA 3IH2A 3ZQIA 1S7EA 1TWGJ 2Y9YA 4A3BJ 5IYCJ 3ZQCA 3JRIA 1JUPA 5EG0B 1AKHB 1APLC 3BTJA 4IHXA 5EF6A 2JA5J 3DCFA 3S1RJ 2N8GA 3WHCA 5IP7J 1GT0C 1Y1WJ 2YUSA 1IDZA 5J1UA 4QIWN 2K9QA 3E7LA 2LKXA 1RKWA 2WV1A 1RPWA 3BR5A 1AKHA 5IP9J 1HF0A 2VUMJ 4JX4A 4V2FA 4RDUA 4M3DA 5F1JA 1WH5A 4D5FA 4IHVA 3BT9A 2HYJA 2HQ5A 2CQXA 3CDLA 3ZQFA 2FD5A 5EZGA 2NOGA 1FTTA 3FIWA 3A01B 1LFBA 3O8HA 5HODA 1TWCJ 2H1KA 2R7ZJ 5C4XJ 1RETA 1EF4A 1JUMA 1GUUA 5M3MJ 4IHYA 3M4OJ 1ETXA 1FJLA 3BG5A 2IBDA 4X1EA 3BR6A 5BNGA 3IV5A 4DZJA 3HB9A 3QPSA 2LD5A 1MBFA 3TW6A 1MBEA 1T33A 1DU0A 3TP0A 5GPAA 5C4JJ 1QVTA 1A6IA 2DA1A 3A03A 3S1MJ 2ID3A 4MO7A 2FX0A 3LSRA 3S15J 1JKPC 3GTPJ 2JMWA 3QPLA 1SFOJ 2MGQA 1CQTA 2PMZN 2DMUA 5M5YJ 3S2HJ 3JRFA 2XRLA 1RESA 1ENHA 2XB5A 3BR2A 2WB1N 5E3LA 3HBLA 2Y9ZA 2HDDA 2M0CA 2M2EA 2DA4A 5F04A 2TCTA 1ZKGA 2X6OA 2HOSA 3PM1A 2JK3A 5IOZA 1JKQC 3S2DJ 1MBJA 1MBGA 3Q0WA 5E3OA 1MSFC 2LP0A 2R5YB 1VF9A 1FTZA 1U9OA 2XPWA 2GBYA 4G12A 4I6ZA 3S17J 1H89C 1U9NA 1YRNB 1ITYA 2CRGA 5DTDA 4DYRA 1K61A 2M8GX 3OSGA 1BA5A 1AHDP 4FTHA 1XS9A 2EZKA 3B6CA 4LOCA 4EEFG 3Q0VA 2DTZA 1E3OC 4W97A 3SFIA 1NK2P 1P7IA 2DA7A 4UUSA 3RZOJ 2KDZA 4A3DJ 4A3EJ 4M3EA 2EQRA 1X58A 3JR9A 1YRNA 1Z77A 2IEKA 3HGYA 2JJ7A 3ZQHA 1MBKA 2R0QC 2ECCA 5F0CA 1WPKA 2EZHA 4A3IJ 3G1OA 4MFEA 2EH3A 4A3MJ 3G1MA 5EYRA 3HKZN 5IOYA 3WHBA 2E2JJ 1VNDA 2FQ4A 2L7FP 2JA6J 5J1YA 3HOUJ 2XGCA 4I76A 2G0EA 3K7AJ 4A3GJ 2AO9A 3CQZJ 4D7NA 2EZLA 2L0KA 5IYDJ 5JLWA 2XPVA 1B72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW6 A;  2VKE A;  3H3V K;  3JRE A;  2YU9 J;  2O9L A;  3MN2 A;  2ID6 A;  5K7F A;  2KT0 A;  3JRB A;  2QF7 A;  5GPC A;  2COB A;  1ETY A;  2XPU A;  5FKL A;  2LY9 A;  1VFC A;  3MVP A;  4GFB A;  1OCP A;  4MFD A;  5GP9 A;  4Y7N J;  1ORK A;  2OPT A;  1WGX A;  4BY1 J;  1HOM A;  2DA5 A;  1JT6 A;  3QQA A;  1B8I B;  2E2I J;  1JTX A;  2OF7 A;  3CMY A;  2B63 J;  1JUS A;  5K7Z A;  5IPA A;  3F0C A;  3BQY A;  1RKT A;  4C3I J;  4AYB N;  4Y52 J;  3TW7 A;  3JRH A;  1MSE C;  1UHS A;  3IH3 A;  2DMP A;  4A69 C;  2HOT A;  3RQI A;  2Y31 A;  3TP3 A;  1Y1V J;  1MH4 A;  4XID A;  4L5E A;  4XK4 A;  3G1L A;  1PUF A;  2LLK A;  2YS9 A;  2LVS A;  1B8I A;  1JKR C;  5C3E J;  1LFU P;  1GV2 A;  4D5C A;  2LK2 A;  4A3J J;  1BL0 A;  3GTG J;  2LTP A;  4HNV A;  3W6V A;  1GDT A;  4UUT A;  3BG9 A;  2X48 A;  3JRA A;  2L9R A;  2XGE A;  3LSJ A;  3BG3 A;  1I50 J;  2LFB A;  1QPI A;  1MH3 A;  3Q3S A;  1O4X A;  2XB0 X;  2Y0S N;  5FKM A;  1XC5 A;  1DU6 A;  1IUF A;  3FK6 A;  3S1N J;  1BW5 A;  4B1R A;  1ZK8 A;  1OJL A;  3BQZ A;  4BXX J;  5EEA A;  4FE4 A;  3OSF A;  1JKO C;  5J3L A;  1QRY A;  2HI3 A;  5EZH A;  3GTJ J;  1LE8 A;  3HOZ J;  2L7Z A;  3GBG A;  4JX5 A;  2NS8 A;  2ME6 A;  3FIS A;  2CJJ A;  2ZB9 A;  1XG1 A;  2EZI A;  1W0T A;  3MKL A;  1TWA J;  1ZQ3 P;  5EGO A;  3BR3 A;  4UUS B;  1FIA A;  1ETQ A;  3DEW A;  2JWT A;  5FKN A;  3RZD J;  9ANT A;  4B4C A;  1NTC A;  4IHW A;  2ME0 A;  3H0G J;  2VPR A;  4M3G A;  2R93 J;  3HOY J;  4XRS G;  4DZP A;  2K9S A;  1G2H A;  3GTQ J;  1HDD C;  3S1Q J;  4JYK A;  1X2M A;  5EDN A;  4D7M A;  2E2H J;  4DYC A;  1TWH J;  2JN6 A;  2DA2 A;  4AUX A;  3LSP A;  5IP6 A;  1JTY A;  1GVD A;  1TC3 C;  2X9D A;  5FKK A;  1IG7 A;  3ZQG A;  3PO2 J;  4DYQ A;  2W48 A;  1WCM J;  1JJ8 C;  1ETK A;  2WAQ N;  3BR1 A;  3B6A A;  1HLV A;  3S16 J;  1IGN A;  1B72 B;  4QTR A;  2JA7 J;  1F36 A;  3SDG A;  1W0U A;  3LOC A;  5DS9 A;  5F08 A;  5F0F A;  4C3J J;  2ELK A;  1U78 A;  3LSG A;  2E19 A;  5JLX A;  4JP0 A;  1NK3 P;  1X2N A;  2FJ1 A;  3RKQ A;  3UKG A;  1IJW C;  2H8R A;  2GM4 A;  1F43 A;  2Y2Z A;  2LR8 A;  3ZQL A;  4NDL A;  1WH7 A;  4QSH A;  1SAN A;  3GTO J;  3I4N J;  3PO3 J;  4IEJ A;  1D5Y A;  1BJZ A;  2IAI A;  4M6V A;  3Q0U A;  3HOX J;  1IC8 A;  3FKI J;  3L1P A;  2QCO A;  1MNM C;  1Q1V A;  1VI0 A;  4W1U A;  2CUF A;  5F27 A;  3HOW J;  2ECB A;  2HOA A;  3C2B A;  2MSY A;  1TWF J;  2Y30 A;  1ETV A;  1UMQ A;  3K2A A;  1BW6 A;  1POG A;  4XIC A;  4CYC B;  2DN0 A;  1PUF B;  4FIS A;  3FK7 A;  3HEF A;  2L7M P;  2TRT A;  1R9T J;  2M9H A;  4ABZ A;  5EG0 A;  3ZOB A;  4BBS J;  5K7H A;  4RBO A;  2HXO A;  3NAU A;  1P7J A;  1I6H J;  2DA3 A;  3S14 J;  3D1N I;  4A3F J;  5M5W J;  4A93 J;  4A3C J;  3I4M J;  4CYC A;  5FJ8 J;  4XRS A;  4M3F A;  4XRM A;  5M3F J;  3O8G A;  4M3B A;  4X6A J;  1T56 A;  3IH4 A;  4C3H J;  3JRG A;  2DA6 A;  2DJN A;  3BR0 A;  4BBR J;  3OIO A;  1ZGW A;  1ETO A;  1JT0 A;  5FLV A;  1LE8 B;  1JGG A;  3HDD A;  2AHQ A;  1HDP A;  2NVQ J;  3BTI A;  3GTK J;  2R92 J;  5M5X J;  1I3Q J;  1QVU A;  2M34 A;  5EGO B;  4A3L J;  2K9N A;  2NS7 A;  3HGG A;  1ETW A;  3HOV J;  3BTL A;  3JRD A;  2DMT A;  1H88 C;  1OCT C;  2P81 A;  1U8B A;  1IV6 A;  3A01 A;  1FEX A;  2I10 A;  2O8K A;  1IRZ A;  1Z0X A;  4MLO A;  5IYB J;  1ZTR A;  2HXI A;  2XGD A;  1UG2 A;  2DMN A;  2R5Z B;  1MBH A;  3OOU A;  1IDY A;  1HCR A;  5E3M A;  1ZR2 A;  5F0H A;  4S0H B;  2JA8 J;  2VI6 A;  4FE7 A;  2VKV A;  4FCY A;  3LNQ A;  1FIP A;  4MIM A;  2CQQ A;  5C44 J;  2NVX J;  3JRC A;  2NVT J;  1RR7 A;  3A02 A;  4B3A A;  2R5Z A;  2CUE A;  1ZR4 A;  1JJ6 C;  1H8A C;  1A5J A;  4AC0 A;  3VPR A;  3M3Y J;  4JX6 A;  2XSD C;  1AU7 A;  2RAE A;  2NVY J;  3TED A;  2O7O A;  3HM5 A;  5FKO A;  3GTM J;  4A3K J;  4J19 A;  1WI3 A;  4V2G A;  2CU7 A;  2GLO A;  3BTC A;  3CCY A;  3GTL J;  4BKX A;  2MG4 A;  5E3N A;  4C2M J;  2D5V A;  2E1O A;  1K83 J;  5FLM J;  2EBI A;  3NAR A;  4BY7 J;  5J1R A;  2R5Y A;  2K40 A;  2MW8 A;  1OFC X;  2DMQ A;  1GV5 A;  3SJM A;  3IH2 A;  3ZQI A;  1S7E A;  1TWG J;  2Y9Y A;  4A3B J;  5IYC J;  3ZQC A;  3JRI A;  1JUP A;  5EG0 B;  1AKH B;  1APL C;  3BTJ A;  4IHX A;  5EF6 A;  2JA5 J;  3DCF A;  3S1R J;  2N8G A;  3WHC A;  5IP7 J;  1GT0 C;  1Y1W J;  2YUS A;  1IDZ A;  5J1U A;  4QIW N;  2K9Q A;  3E7L A;  2LKX A;  1RKW A;  2WV1 A;  1RPW A;  3BR5 A;  1AKH A;  5IP9 J;  1HF0 A;  2VUM J;  4JX4 A;  4V2F A;  4RDU A;  4M3D A;  5F1J A;  1WH5 A;  4D5F A;  4IHV A;  3BT9 A;  2HYJ A;  2HQ5 A;  2CQX A;  3CDL A;  3ZQF A;  2FD5 A;  5EZG A;  2NOG A;  1FTT A;  3FIW A;  3A01 B;  1LFB A;  3O8H A;  5HOD A;  1TWC J;  2H1K A;  2R7Z J;  5C4X J;  1RET A;  1EF4 A;  1JUM A;  1GUU A;  5M3M J;  4IHY A;  3M4O J;  1ETX A;  1FJL A;  3BG5 A;  2IBD A;  4X1E A;  3BR6 A;  5BNG A;  3IV5 A;  4DZJ A;  3HB9 A;  3QPS A;  2LD5 A;  1MBF A;  3TW6 A;  1MBE A;  1T33 A;  1DU0 A;  3TP0 A;  5GPA A;  5C4J J;  1QVT A;  1A6I A;  2DA1 A;  3A03 A;  3S1M J;  2ID3 A;  4MO7 A;  2FX0 A;  3LSR A;  3S15 J;  1JKP C;  3GTP J;  2JMW A;  3QPL A;  1SFO J;  2MGQ A;  1CQT A;  2PMZ N;  2DMU A;  5M5Y J;  3S2H J;  3JRF A;  2XRL A;  1RES A;  1ENH A;  2XB5 A;  3BR2 A;  2WB1 N;  5E3L A;  3HBL A;  2Y9Z A;  2HDD A;  2M0C A;  2M2E A;  2DA4 A;  5F04 A;  2TCT A;  1ZKG A;  2X6O A;  2HOS A;  3PM1 A;  2JK3 A;  5IOZ A;  1JKQ C;  3S2D J;  1MBJ A;  1MBG A;  3Q0W A;  5E3O A;  1MSF C;  2LP0 A;  2R5Y B;  1VF9 A;  1FTZ A;  1U9O A;  2XPW A;  2GBY A;  4G12 A;  4I6Z A;  3S17 J;  1H89 C;  1U9N A;  1YRN B;  1ITY A;  2CRG A;  5DTD A;  4DYR A;  1K61 A;  2M8G X;  3OSG A;  1BA5 A;  1AHD P;  4FTH A;  1XS9 A;  2EZK A;  3B6C A;  4LOC A;  4EEF G;  3Q0V A;  2DTZ A;  1E3O C;  4W97 A;  3SFI A;  1NK2 P;  1P7I A;  2DA7 A;  4UUS A;  3RZO J;  2KDZ A;  4A3D J;  4A3E J;  4M3E A;  2EQR A;  1X58 A;  3JR9 A;  1YRN A;  1Z77 A;  2IEK A;  3HGY A;  2JJ7 A;  3ZQH A;  1MBK A;  2R0Q C;  2ECC A;  5F0C A;  1WPK A;  2EZH A;  4A3I J;  3G1O A;  4MFE A;  2EH3 A;  4A3M J;  3G1M A;  5EYR A;  3HKZ N;  5IOY A;  3WHB A;  2E2J J;  1VND A;  2FQ4 A;  2L7F P;  2JA6 J;  5J1Y A;  3HOU J;  2XGC A;  4I76 A;  2G0E A;  3K7A J;  4A3G J;  2AO9 A;  3CQZ J;  4D7N A;  2EZL A;  2L0K A;  5IYD J;  5JLW A;  2XPV A;  1B72 A; 
#chains in the Genus database with same CATH topology
 3H9G A;  4DW6 A;  2PEX A;  3JRE A;  4PJL A;  4XN0 A;  4BHC A;  1IRG A;  2V7F A;  3S32 A;  1IXS B;  1LQ1 A;  3PIO F;  3JCU C;  2OTJ I;  2XPU A;  1YJW I;  2XKO A;  5CJ9 A;  4GFB A;  4MFD A;  2DTR A;  4DJA A;  4Y7N J;  1WGX A;  3LSI A;  4BY1 J;  1W5S A;  4LLG F;  3ZMT A;  2DA5 A;  1UST A;  1Q1H A;  3U1D A;  1JT6 A;  1BM9 A;  3QQA A;  2BY0 A;  3CMY A;  4NC8 A;  3L2U A;  2IS4 A;  1LFP A;  2PN6 A;  2WY7 Q;  4N0B A;  3LL7 A;  1WJA A;  3HSF A;  2NVU B;  3TW7 A;  4AD9 A;  1UHS A;  2PMZ A;  3IH3 A;  2V1N A;  2D2W A;  4V19 K;  3RQI A;  2UXN A;  3D5L A;  1BR4 A;  2F6C A;  3FXJ A;  1MH4 A;  2XKP A;  3MAJ A;  1E0E A;  1NH3 A;  4P9U A;  2BY2 A;  3K4M A;  5CKT A;  3GUD A;  5J40 A;  2YS9 A;  2BW3 B;  3LMM A;  2CQN A;  5C3E J;  4ZYG A;  3CCM I;  1QNT A;  3KZY A;  3G4S I;  3GTG J;  3P5J A;  3SEZ A;  3W6V A;  4GXO A;  4NQW A;  2F48 A;  4X0G A;  2BZT A;  4YG2 F;  2PX9 A;  5AIQ A;  4UUT A;  1SD7 A;  1Y6I A;  1IRF A;  3MKW B;  1XSD A;  1MH3 A;  3HC7 A;  5J8F A;  2DLL A;  1DU6 A;  4EMS A;  1IUF A;  3S1N J;  1IN8 A;  4P55 A;  2HU9 A;  1IRX A;  1T6S A;  2RV8 A;  1P9Q C;  2RN7 A;  3BQZ A;  3J81 Z;  4CCK A;  5EEA A;  2MLK A;  4EJT A;  5HNH A;  2F5C A;  2A61 A;  3PUF A;  3OR1 C;  4CO8 A;  3OS0 A;  3I55 I;  5B5E C;  1I6X A;  3CLO A;  5EZH A;  3N97 A;  2NS8 A;  3FHN A;  2O03 A;  3FIS A;  4U7B A;  2WV0 A;  3T5X A;  2EZI A;  2XF7 A;  1KON A;  5H6Q A;  4UUS B;  1FIA A;  1XPX A;  9ANT A;  1ZEL A;  1NTC A;  2ZSH B;  3IUO A;  1J2X A;  5HS9 A;  2VBZ A;  1G3S A;  4XRS G;  1W7P D;  1HDD C;  4CSW A;  2ZC2 A;  4EM1 A;  2VPL A;  1TQM A;  2VQC A;  2K7L A;  3IAM 2;  4RAZ A;  1MJA A;  5L3F A;  1HW5 A;  1I5Z A;  2IVM A;  3LSP A;  5B1B H;  1GVD A;  5CVV A;  2GIZ A;  2FXA A;  1XDU A;  2Z5U A;  4FT8 A;  2VE8 A;  1IXR C;  2WAQ N;  2VC0 A;  2P6T A;  1B72 B;  4M71 A;  1PP7 U;  1J7K A;  4E7S A;  1HST A;  2EIN H;  3SDG A;  5D5V B;  2IGN A;  1T8I A;  2DT7 B;  1CF7 A;  3E5X A;  2IW5 A;  1S9H A;  2OJE D;  1SMY F;  4A5N A;  2ELK A;  2O0Y A;  4ZH4 F;  1U78 A;  5EJC A;  3FXM A;  3WGH A;  1U0J A;  2B0L A;  1X2N A;  5HS7 A;  2L02 A;  3DBH B;  2FJ1 A;  1IJW C;  2LR8 A;  3ZQL A;  1WH7 A;  4QSH A;  3I4N J;  1ZH5 A;  1BJZ A;  1HXD A;  3F3X A;  4AYB A;  1O57 A;  3S3N A;  3OYD A;  3HOX J;  3L1P A;  1DP7 P;  4I7H A;  3T8T A;  2KIM A;  4DBQ A;  4XLP F;  4KIS A;  3HOW J;  3BCA A;  3GWZ A;  1P6R A;  2BHZ A;  2LY2 A;  1IO2 A;  1UEL B;  3BWG A;  3BZC A;  1ZG1 A;  5DCM A;  3F8N A;  2CFO A;  4RAG A;  1BW6 A;  1GLN A;  2BHY A;  2VJJ A;  3M9A A;  1ZAO A;  4ZDO A;  3ISP A;  1PUF B;  2KDO A;  4FIS A;  2XAS A;  2TRT A;  3OYG A;  1OLT A;  4ABZ A;  5HVQ C;  3ZOB A;  4RBO A;  1FSH A;  1P7J A;  4QWQ A;  5EEG A;  3FX3 A;  3CCJ I;  3ZGK A;  5E79 C;  4RM3 A;  5HLG A;  4A3C J;  5FFZ A;  3QWL A;  2ESN A;  3KYL A;  1P2F A;  2I5U A;  3TBI A;  4XRM A;  1RRJ A;  3O8G A;  4RGR A;  2KHM A;  3K6G A;  2DA6 A;  2VOO A;  4UY8 I;  1ETO A;  4LIU A;  2TDX A;  5FGM A;  4WK8 F;  3HTU A;  4GYI A;  3OL4 A;  2A6H F;  2AHQ A;  1HDP A;  2NVQ J;  3OL3 A;  4UUV A;  1YJ9 I;  5M5X J;  3I64 A;  4RMN A;  1QGP A;  3ULQ B;  4KN4 X;  2MBF A;  1QZZ A;  3BTL A;  2H6C A;  1BJA A;  3JRD A;  2VXZ A;  4YFK F;  2P81 A;  3KLO A;  5KK1 A;  1U8B A;  4ASN A;  1FZP B;  3KEO A;  1FYM A;  2NRA C;  3MZY A;  4KMU X;  2ZME C;  2STW A;  2OCC H;  3H92 A;  2OU2 A;  4LD5 A;  3WTY C;  3RKX A;  1Z0X A;  4KT5 C;  1T0F A;  3JAM Z;  1REP C;  2EFP A;  3ERE D;  4A6D A;  2M45 A;  2DMN A;  4E6K G;  1SVM A;  3VSL A;  4M74 A;  2MD0 A;  5CVR A;  4BU2 A;  3GF2 A;  2QUF A;  3CC4 I;  5AIP A;  3JSO A;  2VQG A;  4FE7 A;  2XHK A;  2VKV A;  3ABT A;  4FCY A;  3K4J A;  1FIP A;  2O5R A;  4LIT A;  5LGT A;  3G71 I;  1EV7 A;  1LKX A;  4G94 A;  2RRE A;  2VQL A;  4ZYA A;  1PDN C;  1RC9 A;  2KP6 A;  1SFK A;  5DV5 A;  1W1W E;  1RR7 A;  3KE2 A;  4G6D A;  3PNY A;  3G3Z A;  4I98 B;  3P9I A;  2QKL B;  5DYM A;  3J7Z I;  2XSD C;  2J5O A;  2QSG X;  2O7O A;  1S29 A;  3K4L A;  1WJF A;  4N9I A;  2EFW A;  4ZZL A;  2CU7 A;  2VBY A;  1VTN C;  1JGS A;  2KZV A;  3FXU A;  4C2M J;  2D5V A;  5J47 A;  1K83 J;  2EBI A;  2M5W A;  2F4I A;  4IOC F;  4HF1 A;  1N25 A;  5J1R A;  2K40 A;  2QQB A;  1OFC X;  1BC7 C;  2DMQ A;  3HPH A;  2DU9 A;  4KT6 A;  4IQJ A;  5DUI A;  3LST A;  1TWG J;  3HUG A;  5GAE J;  1ZG3 A;  2L9N A;  1S8N A;  4ON0 A;  3DTI A;  4A3B J;  1ONV A;  3ZQC A;  2L3D A;  1FBU A;  4HX4 A;  2ESH A;  2IS6 A;  3GLL A;  3WG9 A;  5EG0 B;  4U0Y A;  2H6B A;  4HST A;  5LD2 C;  3W2A A;  2P7V B;  3OMY A;  1APL C;  1FPQ A;  3HYI A;  3N4M A;  3DCF A;  3S1R J;  3F72 A;  2NNY A;  2M87 A;  2R7X A;  2R7Q A;  5IP7 J;  4XLF A;  5J6X A;  4BQQ A;  2LKP A;  3E7L A;  3EUA A;  2KRF A;  4L9N A;  3H5A A;  2ISZ A;  2DCE A;  4EM0 B;  2VOD A;  2KLO A;  3PNT A;  3DPU A;  2VBW A;  3BR5 A;  3H3U A;  3LWF A;  4JX4 A;  4KN7 X;  3WGI A;  2H8W A;  4RLQ A;  2WBM A;  3BT9 A;  2HQ5 A;  3CDL A;  4EGZ A;  2FD5 A;  4L0Z B;  2VE9 A;  1D3Y A;  3FIW A;  5JFR A;  1D1B A;  4IRG A;  2QZ8 A;  1EF4 A;  2H1K A;  2IRF G;  4UV9 A;  3VYU B;  3CCL I;  4MHG A;  4EJW A;  4B43 A;  1LDK B;  2RDP A;  1IN5 A;  3AG4 H;  1XGM A;  3MWM A;  4IHY A;  4WX9 A;  1KQ8 A;  5GAD J;  1IV8 A;  2ICW G;  3FMQ A;  2QBY A;  4DZJ A;  3K69 A;  1TQP A;  1MBF A;  3RKW A;  1WJE A;  2QSH X;  1X1A A;  5GPA A;  1FWZ A;  3RSN A;  3F22 A;  3LAJ A;  1Z6T A;  3HRS A;  3EUH C;  1LPQ A;  4MTD A;  3QPL A;  2CUZ A;  4ESJ A;  4M6X A;  1SFO J;  1A6Q A;  3DEE A;  3JRF A;  3ZPL A;  5JVG F;  3AL0 B;  1WJB A;  4OU0 A;  3M8F A;  1JHF A;  2Z3Y A;  1RES A;  2GIV A;  4GRI A;  2LKS A;  3GXO A;  3QPT A;  5E3L A;  4HAM A;  2XRN A;  3H36 A;  4D0P A;  2PMU A;  3FZV A;  2M0C A;  2M2E A;  4ESF A;  3HZJ A;  3TO9 A;  1R4N B;  4UB6 C;  2HOS A;  4ZTF A;  5D4S A;  4PZJ A;  3Q0W A;  4OIP F;  1MMS A;  4M72 A;  5JI6 A;  2OA4 A;  3O6B B;  2XPW A;  4Q47 A;  2A07 F;  4I6Z A;  4KYW A;  3S17 J;  1P4A A;  2HNH A;  2V1U A;  2ZXH A;  1DGW Y;  4L5J A;  3J80 Z;  5CPR B;  1ITY A;  2ZCW A;  2ZJQ F;  4QLC U;  3G73 A;  2ZXI A;  2XF5 A;  1VQ7 I;  3TDU C;  3OSG A;  2WC2 A;  1AHD P;  1MZB A;  3VB2 A;  1Z7U A;  3B6C A;  3C1D A;  3K10 A;  4XKC A;  3Q0V A;  2W1O A;  2PJR A;  3QOP A;  1CGP A;  3L2V A;  1FNN A;  2V1D A;  2DI3 A;  3RZO J;  2KDZ A;  3QPH A;  4F55 A;  2ZJR F;  1T0F C;  1AOY A;  2VL8 A;  3HGY A;  3CJN A;  1WPK A;  4A3I J;  3CCQ I;  4KDP A;  5EEH A;  4AVP A;  5F6F A;  3RYR A;  1WWX A;  3ZR8 X;  3I9V 2;  1I27 A;  2EH3 A;  3ASO H;  1OCZ H;  3HKZ N;  4G7O F;  1FLI A;  2MAB A;  1STZ A;  3KX2 A;  2FQ4 A;  1S7A A;  1G8X A;  2G0E A;  2AO9 A;  4RA2 A;  4XBF A;  4C2U A;  1KA8 A;  1XGS A;  2KPM A;  2XPV A;  5JLW A;  4YFN F;  2KMU A;  3OR2 C;  5F1R A;  3V8J A;  3ZP5 A;  1R36 A;  1YHQ I;  1KQ0 A;  2KT0 A;  3JRB A;  1UZC A;  3CC7 I;  3HOS A;  2R7O A;  1KU7 A;  1IN7 A;  2COB A;  1ETY A;  2F5D A;  2MD5 A;  2Q2E B;  4CYD A;  3HHG A;  5FKL A;  1VFC A;  4UVC A;  1OCP A;  2VT2 A;  2GQQ A;  3PUB A;  2XAF A;  1RUO A;  2WAD A;  5GP9 A;  1HOM A;  4D1Q A;  1XD7 A;  3QRF F;  2OC6 A;  4XLC A;  1R1T A;  2JA2 A;  3FKJ A;  2CGP A;  2R7U A;  2JTV A;  3JW4 A;  1EKE A;  2E2I J;  4YFX F;  5LGU A;  3F8C A;  2B63 J;  1IUY A;  2JSP A;  3K1N A;  4BGD A;  5K5O A;  1JUS A;  4FET A;  1RR8 C;  3WOD F;  3F0C A;  4C3I J;  1R5G A;  1WRJ A;  2DMP A;  3S3M A;  2HOT A;  1XX5 A;  3WG7 H;  2Z1D A;  3HOT A;  4F52 A;  1Y1V J;  4LLN A;  2WB1 A;  1G3T A;  4XID A;  4L5E A;  4J00 A;  1Z21 A;  1GXQ A;  4QPQ A;  4XQF A;  2LLK A;  1IAW A;  1BN5 A;  1FX7 A;  4BJ6 C;  1LFU P;  4D5C A;  3HL2 A;  1X19 A;  5CLS A;  1KU9 A;  1YFH A;  1K6Y A;  2HGC A;  1WHU A;  2F4O B;  2ZXJ A;  4YEJ A;  4CA0 A;  2IGM A;  2DK5 A;  3FXQ A;  3CLQ A;  2X48 A;  2ZJ2 A;  2P5L C;  2DPU A;  4I99 C;  2DW4 A;  3VOE A;  2L9R A;  2R7T A;  1I50 J;  4YIR X;  3DEU A;  1Z3X A;  1O4X A;  5LRR A;  3FK6 A;  3GME A;  2STT A;  2Z2S B;  1D0Z A;  1MD0 A;  4BXX J;  4BAC A;  1JKO C;  4FE4 A;  3A0H C;  4XSZ F;  5D6E A;  1R23 A;  1RIO H;  1HKQ A;  1SAU A;  2CQK A;  2FEZ A;  2HI3 A;  1LE8 A;  1WFX A;  2A6T A;  4HDU A;  3GBG A;  2LC2 A;  4I0B A;  2W85 A;  1R58 A;  1W7P A;  1XG1 A;  3MKL A;  5EGO A;  2XC7 A;  1O3Q A;  1ETQ A;  2WAF A;  2K9L A;  3RZD J;  3ROU A;  4CZC A;  3SYT A;  4U7D A;  2M8E A;  4M3G A;  4AIJ A;  3MMY B;  3HSR A;  2K9S A;  4L9T A;  3ABK H;  5CVU A;  3O2P E;  4DZP A;  1VQ9 I;  3S1Q J;  1G2H A;  1X2M A;  4MGR A;  1Z7L A;  3LSK A;  2Q8K A;  5EDN A;  2E2H J;  4HNT A;  5TIS C;  1TWH J;  1HA8 A;  5LRS A;  4EV0 A;  1QZE A;  3TO7 A;  4D9J A;  3K9T A;  3RI4 A;  5ERI A;  4HA8 A;  5FKK A;  5J8C A;  5K1Y A;  2CW0 F;  4HW0 A;  1JJ8 C;  1WCM J;  3CUQ A;  3CZ6 A;  3BR1 A;  3B6A A;  1HLV A;  2VJ4 A;  1IGN A;  1R5H A;  3L2R A;  2JA7 J;  3PL8 A;  1JXS A;  2PQ8 A;  2WTE A;  2P5V A;  3EUK L;  2HPM A;  2ELH A;  2KQR A;  2WAE A;  2JUC A;  2E19 A;  3BG6 A;  4PJ0 C;  2GZW A;  5D8L B;  4OIR F;  3I59 A;  3K4N A;  2EFN A;  4BQA A;  2HS5 A;  4HBL A;  1YW7 A;  2H8R A;  2GM4 A;  1I39 A;  1F43 A;  3DBR B;  1B9N A;  2KJC A;  3A0B C;  1V55 H;  5A2Q Z;  4HSR A;  2ZME B;  1W5C C;  2VIX A;  4CCO A;  1D5Y A;  2IAI A;  4PGG A;  1G6N A;  2LY1 A;  1USS A;  3CCE I;  1TTY A;  2GA1 A;  5HNF A;  2P0W A;  3F8B A;  3GZ6 A;  4M6Y A;  2Z9O A;  3WTU C;  2KKO A;  3CO6 C;  3M8J A;  4KA4 A;  3LSH A;  2VLA A;  1YIJ I;  1ON1 A;  3LAP A;  2OUM A;  2XIG A;  4WF2 A;  1PP8 F;  3ABM H;  3F21 A;  1J5Y A;  4HNU A;  3K2A A;  1H9T A;  4CYC B;  1F1Z A;  2XSJ C;  2ZME A;  2VT3 A;  5LLQ A;  1XTA A;  4ZYD A;  3HEF A;  2EV0 A;  1T95 A;  2LRE A;  1LNW A;  1SD6 A;  2R7S A;  2E1C A;  4NQW B;  3U2R A;  1XCB A;  2HXO A;  4BXF A;  5TRD A;  2ZNY A;  3NAU A;  3ZN1 A;  1I6H J;  4IL6 C;  1T2K A;  1SFU A;  5M5W J;  4CYC A;  3W2W A;  2IS1 A;  2DOE A;  1MMA A;  5M3F J;  4H0E A;  4M3B A;  1LJ9 A;  4X6A J;  4GGG A;  1V5E A;  4H4K C;  3M7G A;  3IH4 A;  1XMA A;  1OCO H;  4M9X A;  4C3H J;  3J80 K;  3SXY A;  3BR0 A;  4E7I A;  3PQK A;  2X0L A;  4XKW A;  1LVA A;  4BJT A;  1WQ2 A;  4DQ2 A;  4RGX A;  3D0S A;  4F7Z A;  5BOX A;  2HDC A;  4A3L J;  2HKO A;  1YW8 A;  4NHJ A;  1WJ5 A;  2K9N A;  1ETW A;  1Z67 A;  3OWT A;  3Q9S A;  3IKV A;  2IGK A;  3QAH A;  3RPU A;  2COM A;  3WU1 B;  2FF4 A;  2F5F A;  1IV6 A;  2DOD A;  1N77 A;  2EFO A;  2K27 A;  2RVC A;  3DLA A;  2XV4 S;  5E18 F;  3AKZ A;  4MLO A;  3GZ5 A;  2M4K A;  3MZ8 A;  5IYB J;  2HXI A;  1XCV A;  2XGD A;  1YYV A;  1UG2 A;  1FY7 A;  3GO5 A;  2DOA A;  3GZN B;  2C6Y A;  1LEB A;  1D0Y A;  2QEX I;  2H27 A;  1OYY A;  1IDY A;  3OOU A;  1O7L A;  1RNL A;  4XM3 A;  1UHW A;  3ERM A;  2JA8 J;  4JOM A;  3ZMV A;  2QEN A;  1O7F A;  3LNQ A;  4MIM A;  5HDN A;  4P96 A;  4BH9 A;  2E7X A;  1VQ6 I;  2A69 F;  1OIS A;  1CF7 B;  5IY5 H;  4Y4R A;  2L5Q A;  3OYF A;  4LGW A;  1A5J A;  4AC0 A;  1YQA A;  4ITV A;  3GYH X;  3M3Y J;  1SMT A;  2PFB A;  4BNC A;  3IP4 B;  4KUM A;  1YJN I;  2NVY J;  2K4J A;  3GTM J;  3HM5 A;  3DQV C;  3K1M A;  5JVT A;  3M1C A;  2KIU A;  3BTC A;  3CCY A;  3GFL A;  1FYK A;  1MJ9 A;  3CJT B;  2MG4 A;  4EQQ A;  5E3N A;  2BGC A;  2E1M C;  5FLM J;  1V54 H;  3BRO A;  2DQL A;  4FX0 A;  4RS8 A;  4BY7 J;  1EH6 A;  4IX7 A;  5DCM B;  2L01 A;  2Z99 A;  5FLX K;  2EIK H;  5KAI C;  3AG1 H;  3NWT A;  3OS2 A;  1U5T A;  2O8X A;  4UXN A;  3BZ6 A;  3L2Q A;  1T38 A;  4DBR A;  3H0D A;  1QHG A;  3ABL H;  1HW2 A;  5BQT A;  2B7E A;  2ZSI B;  5HLH A;  3BY6 A;  4R79 A;  2RQQ A;  1M1E B;  4KFC A;  3WGG A;  2V6E A;  3OV8 A;  4IHX A;  2MH2 A;  1FC3 A;  5EF6 A;  2LF8 A;  3IC7 A;  1SEU A;  2JA5 J;  4N4O B;  2MC4 A;  3DP7 A;  2FA5 A;  4A0X A;  3WHC A;  4PCQ A;  1Y1W J;  3ZMU A;  3CUQ C;  3H5N A;  3EUH A;  1TNS A;  1X1P A;  4WXH A;  2ZFU A;  2P8T A;  5H6R A;  1JE8 A;  1ZN2 A;  3DXJ F;  5IP9 J;  1UFM A;  4CXF A;  3TL4 X;  2FNP A;  2VXD A;  2Y0S A;  4U88 A;  4V2F A;  4M3D A;  3LQR A;  3VDX A;  1F4K A;  5F1J A;  1R7J A;  1ZRE A;  2NXN B;  3K0L A;  2CSO A;  2HQN A;  2XAU A;  4C30 A;  1WJD A;  4UB8 C;  3I56 I;  3V7R A;  1D1A A;  2K4B A;  5EZG A;  4RB3 C;  4K2E A;  3I0T A;  3FMS A;  3JTG A;  2BY1 A;  3KFW X;  4S05 A;  2WWY A;  1HBX G;  3OYE A;  2V9V A;  5C4X J;  1MMD A;  5FRN A;  1VQO I;  3B73 A;  2BXZ A;  3QYB A;  1OCC H;  3OYK A;  1VQ4 I;  3BG7 A;  1GUU A;  3O3K A;  4A0Z A;  2V79 A;  4P5O A;  1ETX A;  1FJL A;  4BDY A;  5ILU A;  3BR6 A;  1NG6 A;  3H3Z A;  2JQ7 A;  2QQ9 A;  2W84 A;  4LIV A;  3BZK A;  3RCO A;  4IQ4 A;  1Z6R A;  1SVO A;  5BPD A;  2M4G A;  4PSW A;  2QYO A;  3TW6 A;  1MBE A;  1ZGA A;  1DU0 A;  3EYY A;  3KEY A;  3MD2 A;  2JVH A;  5C4J J;  1OYI A;  3A03 A;  4IHS A;  4MO7 A;  1YTY A;  3WU2 C;  4DGW B;  2FX0 A;  3S15 J;  2MLG A;  2JMW A;  1R5I D;  2HZD A;  3RPU D;  2EB7 A;  5M5Y J;  3S2H J;  2A5W A;  2JPB A;  2R7R A;  2NS0 A;  3BR2 A;  1VQL I;  3BLY A;  3HBL A;  2Y9Z A;  2HDD A;  2CW8 A;  4TV7 A;  3E5Q A;  3U1K A;  2IJL A;  1E17 A;  2W82 A;  2DA4 A;  4DOZ A;  5F04 A;  5K5R A;  2X1E A;  3CJR B;  1ZKG A;  4FAS D;  2X6O A;  2PLY A;  2CFX A;  5A2Q K;  1HC8 A;  1YS6 A;  2R4G A;  3ABU A;  2JK3 A;  2YX7 A;  2Y75 A;  4OIN F;  1E2X A;  4LG0 A;  1JKQ C;  3S2D J;  2A6E F;  4G6Q A;  2QM3 A;  3G2B A;  2LP0 A;  3V8K A;  3K70 D;  4B48 A;  1X3Z B;  1GXP A;  1VF9 A;  1FTZ A;  5D6F A;  1BC8 C;  2LG4 A;  2CV0 A;  2DQR A;  1KYZ A;  1BI3 A;  1ON2 A;  2AXT C;  2GBY A;  2VKD A;  4Y15 A;  2Z16 A;  2NYX A;  3I54 A;  4ESB A;  2OQR A;  1YRN B;  1HW1 A;  3HUG B;  2CH0 A;  3R0J A;  3A4C A;  1AWC A;  1KQ9 A;  1FOK A;  3GEZ A;  2ELJ A;  1ZYR F;  4MTE A;  1I1S A;  2V9P A;  4M9S A;  3SFI A;  1P7I A;  3ZQ7 A;  2CMP A;  2V26 A;  1PJR A;  2X6X A;  4O5V A;  2GXB A;  3MEX A;  5L3D A;  2K3F A;  4CZZ A;  3JR9 A;  3W3C A;  1YRN A;  1PUE E;  2IEK A;  1MBK A;  2ECC A;  5F0C A;  3AG2 H;  1EJ9 A;  2DYS H;  2DK8 A;  4MFE A;  2JT1 A;  4FX4 A;  4LK0 F;  3HRT A;  3K70 C;  4E7K A;  2RKH A;  1D5V A;  2E2J J;  3HTS B;  2L7F P;  5FRM A;  1EH7 A;  4XRF A;  3SEQ A;  3HOU J;  4EVI A;  3PQJ A;  3CQZ J;  1FP2 A;  2H94 A;  3IWF A;  2VJI A;  5LGN A;  2CYY A;  1TNT A;  1ZLJ A;  2VKE A;  3H3V K;  2YU9 J;  2O9L A;  2Y0M A;  3M8E A;  4L18 B;  1R49 A;  3E0J B;  1T08 B;  1WI9 A;  2ID6 A;  3CP2 A;  5E8I A;  3J81 K;  3FWE A;  1U6G A;  4HG2 A;  5K5Q A;  2VBX A;  2HVR A;  2QF7 A;  5GPC A;  4BAY A;  4L5I A;  3PIP F;  5KNL A;  2KZG A;  1ZRC A;  1Y8Q B;  2X51 A;  2OPT A;  4PDK A;  5D4R A;  3DU5 A;  2QBY B;  3ZMZ A;  1AA7 A;  1XB4 A;  2HR3 A;  3CMM A;  4EJV A;  1UHM A;  4HF0 A;  3SDB A;  1B8I B;  1JTX A;  2OF7 A;  3KYD B;  4O6J A;  1C0W A;  1LDJ A;  1B6A A;  2K86 A;  4I02 A;  5K7Z A;  2XAG A;  3BJA A;  1MND A;  1U5T C;  1BI0 A;  1RKT A;  2K9M A;  5DM7 F;  4Y52 J;  3JRH A;  4N9H A;  1MSE C;  4HYE A;  4IRH A;  3K4K A;  3OYC A;  3AFH A;  2HYG D;  2RNG A;  2CWE A;  3E6C C;  2OCE A;  4BQO A;  2LVS A;  1ZG5 A;  1B8I A;  1JKR C;  4BXU A;  1GV2 A;  4A3J J;  1LVK A;  2LK2 A;  1BL0 A;  1G3W A;  5KVR A;  2HVS A;  2G9W A;  2DBB A;  4HNV A;  1S3J A;  1RI7 A;  4OWR B;  3ZN0 A;  1N78 A;  2LRD A;  1GDT A;  2XUB A;  3BG9 A;  3EPZ A;  1B4A A;  1VQ8 I;  4LFU A;  3LSJ A;  3BG3 A;  2H09 A;  1QPI A;  4EJO A;  3Q3S A;  2X1C A;  2EA4 A;  2FBI A;  3LFK A;  5FKM A;  1NG7 A;  1XC5 A;  3PFY A;  3GW2 A;  3ZXS A;  3ASN H;  4B1R A;  1LDD A;  1LUJ B;  1OJL A;  2BVM A;  3L00 A;  2FOW A;  3OSF A;  4FHT A;  1B9M A;  1ODD A;  3DPT A;  4DNC A;  2XAQ A;  4L9J A;  3KYC B;  3HOZ J;  2HQR A;  3TMO A;  2OBP A;  4L9V A;  3BCB A;  1R22 A;  3AAF A;  2PJR B;  2ZB9 A;  2AQF A;  4HLY A;  3KCC A;  1W0T A;  5L3E A;  2MH9 A;  3DEW A;  2JWT A;  3KZI C;  3M1E A;  4B4C A;  1R71 A;  1P4X A;  4IHW A;  1MMG A;  2G7U A;  2ME0 A;  3H0G J;  2IPQ X;  2VPR A;  3DBL B;  2PI0 A;  4U87 A;  4CIC A;  4A2U A;  1A04 A;  4B44 A;  3GTQ J;  3KP5 A;  4XOT A;  1HQC A;  1IXC A;  4D7M A;  3MZH A;  1W4M A;  2JN6 A;  4J01 A;  2DO7 A;  3KP7 A;  3F23 A;  3CCS I;  4AUX A;  3KIO A;  5IP6 A;  3ML6 A;  4MEY F;  2MA3 A;  3COA C;  1IG7 A;  4KNY A;  3PO2 J;  2FQ3 A;  3OYA A;  4DYQ A;  1WSU A;  4XR6 A;  2A5Y B;  2LMD A;  4A5M A;  5LHG A;  3F8F A;  4IF4 A;  1SD5 A;  4LMY A;  5FRO A;  5ED4 A;  2HTJ A;  5FO5 A;  1SC7 A;  3LFU A;  2M0M A;  5KCM A;  5HDG A;  2M1B A;  1BOA A;  3JTH A;  2JSC A;  1G4D A;  3WU0 A;  4CCN A;  4OIO F;  4JP0 A;  4BEH A;  2X4H A;  2Q0O A;  4EAT A;  2VN2 A;  3DTE A;  3UKG A;  4YRV A;  2Y2Z A;  3TDZ C;  2QSF X;  4NDL A;  3GTO J;  4XL9 A;  2J5P A;  5L3G A;  4XNF A;  5L3C A;  2ADU A;  3FKI J;  1Q1V A;  4BL0 B;  5ILV A;  3CC2 I;  1VI0 A;  1KU2 A;  2CUF A;  3QU6 A;  5F27 A;  1DUX C;  1WZ2 A;  3J7A O;  2ECB A;  1X4O A;  5D5U B;  3VYT B;  2A68 F;  3R0A A;  4XLA A;  4XSX F;  4BYY A;  1TWF J;  3JAM K;  3T1B A;  1ETV A;  3SZP A;  1LB2 A;  1UMQ A;  2K85 A;  1POG A;  2QVO A;  3UNG C;  1QA6 A;  5B3S H;  3NQO A;  5E20 A;  3OYN A;  2PBI A;  1VQP I;  3CJQ B;  2ZBK A;  1R9T J;  4RB1 A;  2ACJ A;  1OR7 C;  2FU4 A;  3OY9 A;  5K7H A;  1BR1 A;  5FFX A;  3GFJ A;  2DA3 A;  3H5R A;  4G6T B;  3KLN A;  3D1N I;  4B3X A;  2HWV A;  3CF5 F;  3K2Z A;  2R7F A;  3I4M J;  5FJ8 J;  3OOP A;  2QKM B;  1F9N A;  2I8D A;  4XRS A;  4XKV A;  4LG3 A;  1TT5 B;  3E5U A;  4EGY A;  5KHD A;  2E1M B;  3JRG A;  4ZDL A;  2VON A;  1MIJ A;  4BBR J;  1ZGW A;  1JT0 A;  1TW3 A;  5CVI A;  2E7W A;  1LE8 B;  4ETS A;  3HDD A;  1YX5 A;  3KZZ A;  1MDM A;  1ZRD A;  4B09 A;  2PG4 A;  2R92 J;  4QPO A;  1W7P B;  3R4K A;  3BP8 A;  4F92 B;  3C18 A;  1QVU A;  4UHT A;  2M34 A;  5EGO B;  3HGG A;  4RM2 A;  3V8L A;  2P5K A;  1MW7 A;  3WTS C;  1OCT C;  3A01 A;  4ZTJ A;  1TQI A;  1T39 A;  5CYV A;  1OYW A;  1BR2 A;  2I10 A;  3RYP A;  5IT3 A;  1OKR A;  1ZAR A;  4NNJ A;  4B47 A;  2O8K A;  3FBN B;  3VFZ A;  2E34 A;  4HLX A;  1RUN A;  2PMH A;  4XOR A;  4MQV A;  4CCM A;  1ZTR A;  1X4P A;  2AXL A;  2R5Z B;  1FOW A;  4E7L A;  4S04 A;  5LEJ A;  1FBQ A;  5ICF A;  3HXL A;  2JUG A;  3CME I;  1K78 A;  5E3M A;  1Z91 A;  1G59 A;  3GLX A;  3CUQ B;  4YIF A;  5F0H A;  1D1C A;  2R3S A;  4RB2 C;  3JRC A;  1YO5 C;  3M07 A;  3DLL F;  3A02 A;  3DFG A;  4B3A A;  2R5Z A;  2ZKZ A;  1Z9C A;  1ZR4 A;  1JJ6 C;  1H8A C;  4LK1 F;  3H9J A;  3ELK A;  4KIT B;  3IAS 2;  3VPR A;  3X2Q H;  5E17 F;  3I59 B;  3DV8 A;  1XMK A;  5FD6 A;  2HTS A;  3TED A;  3GFM A;  2YPR A;  5FKO A;  3BJO A;  2GOX B;  3IL2 A;  4L0Y B;  3FXR A;  4A3K J;  1Z3Y A;  4J19 A;  2FSW A;  1T98 A;  3LQQ A;  1ACI A;  2WY8 Q;  2GLO A;  4P9F A;  2UXX A;  1MMN A;  2RC4 A;  2E35 A;  4CGZ A;  2EPF A;  3L2C A;  4BKX A;  2E1O A;  1JI8 A;  4YEL A;  5GTI C;  1FT9 A;  2UZK A;  2R5Y A;  4Y3O A;  4OAY A;  2MW8 A;  3SFZ A;  1F5T A;  3BOQ A;  3HG9 A;  3K1P A;  3SJM A;  1ERD A;  3ZQI A;  1S7E A;  4IZZ A;  2L9V A;  2EV6 A;  2DAO A;  4AIH A;  2LH9 A;  4G7Z F;  1J09 A;  2Y9Y A;  2XVC A;  1BBY A;  5IYC J;  3OIP A;  3JRI A;  3P9K A;  1RZ4 A;  2M30 A;  1O3S A;  1JUP A;  3LA3 A;  1AKH B;  2X6Y A;  3F9K A;  3ZCO A;  1R6R A;  3RQ4 A;  5F64 A;  4ZYH A;  1YX3 A;  2F2E A;  3NWS A;  5E8G A;  1Y39 A;  2M7A A;  2XGX A;  3AL0 C;  2D1V A;  1P4W A;  2K3P A;  2UWM A;  2K9Q A;  3NEU A;  2FUG 2;  4HEA 2;  4AWX B;  3TKY A;  2VC1 A;  2OTL I;  4UVB A;  5J4Y A;  4PK4 A;  4Q5S F;  1RPW A;  1AKH A;  4RLF A;  4ENN A;  5DCF A;  4XMY A;  4RDU A;  4LB5 A;  1D8J A;  1YIO A;  2DJI A;  1UJ8 A;  4D5F A;  4I09 A;  4HX8 A;  4IHV A;  2HYJ A;  4PUS A;  5B1A H;  3OIQ A;  2CQX A;  1VQM I;  1QPM A;  5LEK A;  4HOB A;  5AON A;  2NOG A;  1FTT A;  3EQL F;  3CUO A;  3O8H A;  4WWC A;  1TWC J;  3IRQ A;  2R7Z J;  4GO1 A;  4HV6 A;  1A35 A;  2NNN A;  4M9Z A;  2DFI A;  3RPQ A;  3BG5 A;  1J0R A;  2IBD A;  4X1E A;  1HSJ A;  1MJB A;  4IOA F;  5BNG A;  2IA2 A;  3VEP A;  2P4W A;  2P6S A;  2R7W A;  2RQP A;  3QPS A;  2HZT A;  4LLL A;  5LFA A;  4IPA A;  3E6B A;  3PSI A;  5LBQ A;  2GXA A;  4WXC A;  3TP0 A;  4CDG A;  3IHU A;  5JHF A;  2HDW A;  1A6I A;  2DA1 A;  4OAZ A;  2ID3 A;  4NC7 A;  3LSR A;  4RAF A;  5DDG A;  1IZ1 A;  1JKP C;  2BYV E;  1FSE A;  3GTP J;  5FB2 A;  3U9G A;  2MGQ A;  3BPV A;  2PMZ N;  1CQT A;  2R7V A;  2WAQ A;  2XRL A;  1X3U A;  1FBS A;  3J7A Y;  4I01 A;  2XB5 A;  3L9F A;  2BW3 A;  3CCU I;  3T0Y A;  4C9Y A;  2OQG A;  2GAU A;  4F3Q A;  5D5X B;  1WJC A;  2HKX A;  3A1Y A;  3DKX A;  5JHU A;  2TCT A;  3QU3 A;  3CDI A;  3PM1 A;  3C2G A;  3C2H A;  2L4A A;  2W25 A;  2HVQ A;  2YSR A;  4E70 A;  1KYW A;  2JVG A;  1YS7 A;  2F4M B;  5H2F C;  1MBJ A;  1MBG A;  5E3O A;  4MNU A;  2GOM A;  1XN7 A;  4G8X A;  2YX4 A;  3DF8 A;  3HPG A;  4G12 A;  2EIM H;  2Y69 H;  3VYR B;  1FMV A;  4LB6 B;  4GYG A;  5DD4 A;  3S3O A;  2MYS A;  2DFH A;  1U5T B;  2O3F A;  4DYR A;  1K61 A;  4WCG A;  1V5G A;  1J9I A;  3FBI B;  4FTH A;  4LJZ F;  2EZK A;  4LOC A;  4Z6Y A;  2O6G E;  2DTZ A;  1E3O C;  2GXG A;  3HRM A;  4RGS A;  3SQN A;  1VQ5 I;  1NK2 P;  2B9S A;  2DA7 A;  4UUS A;  4CHU A;  4BE2 A;  4A3E J;  3OYI A;  1X58 A;  4ENK A;  3I4P A;  1TLH B;  1BI2 A;  1Z77 A;  2JJ7 A;  2V4J C;  2YR2 A;  3MFK A;  2EZH A;  3KEQ A;  1QBJ A;  2EJR A;  1U2W A;  4E7J A;  2CO5 A;  4PJM A;  2LF7 A;  2XDV A;  4A3M J;  1DDN A;  3S2W A;  3CES A;  1UG0 A;  3G1M A;  3ZQQ A;  2QA4 I;  5IOY A;  3WHB A;  3OYJ A;  2IP2 A;  1VND A;  2JA6 J;  3CD6 I;  2BXY A;  2GWR A;  1D8K A;  4RB0 A;  3A2K A;  4D7N A;  4AM3 A;  4F93 B;  2Y48 A;  1X1B A;  4E4H A;  2IT0 A;  2EZL A;  3WE3 A;  4W1U A;  5DD8 A;  1B72 A;  1U8R A;  3MCZ A;  5CVJ A;  2NAZ A;  4ZJZ A;  1K4S A;  3CMA I;  1ZGJ A;  3MN2 A;  1BIA A;  3L09 A;  5B66 C;  3JSP A;  1J59 A;  5K7F A;  2RNJ A;  2DDB A;  4ZDP A;  3E6D A;  2UV1 A;  2LY9 A;  3CDH A;  5ICE A;  3MVP A;  3V42 A;  1XGN A;  5FD5 A;  3TOB A;  1ORK A;  2UUZ A;  2CUJ A;  3BPX A;  3PNV A;  3ESW B;  1ULY A;  3L2W A;  4WXD A;  1O3T A;  1V3F A;  3CP8 A;  5HLI A;  3WTW C;  4U0V A;  2E5N A;  1DP3 A;  3EDP A;  4BUP A;  5IPA A;  2JPC A;  3IRR A;  3BQY A;  4AYB N;  2E5Z A;  4XLE A;  2DOF A;  4A69 C;  1SD4 A;  4M73 A;  4IVN A;  3EYI A;  2L4M A;  2Y31 A;  1SFE A;  1P92 A;  3TP3 A;  1B59 A;  1L3L A;  3EET A;  5CQE A;  1DPR A;  5KAF C;  4XK4 A;  3G1L A;  2Q1Z B;  1PUF A;  1ZLK A;  1NHA A;  2QQA A;  3F6O A;  4CUG A;  1S7O A;  2EA2 A;  4E7Z A;  2LTP A;  2KRC A;  4AVZ A;  3F8M A;  3TQN A;  4I0A A;  2XRO A;  3HSE A;  1Y0U A;  5TGT A;  3JRA A;  1ZHF A;  4LG0 B;  2XGE A;  1YLF A;  4BHB A;  2LFB A;  2EK5 A;  3Q9V A;  2DT5 A;  3Q5F A;  2XB0 X;  2Y0S N;  4C2T A;  1QZY A;  1BW5 A;  4PGH A;  2V6C A;  3RDI A;  2BOL A;  1ZK8 A;  3HIF A;  3REO A;  3WTX C;  2CV2 A;  2JRT A;  2FBK A;  3BC8 A;  4XON A;  5E1W A;  3OYH A;  2DDA A;  2CG4 A;  5J3L A;  1QRY A;  3GTJ J;  4IJA A;  3P7N A;  2L7Z A;  2IS2 A;  4JX5 A;  2ME6 A;  1YI2 I;  2CJJ A;  2XF6 A;  1ZQ3 P;  1TWA J;  1BI1 A;  3BR3 A;  1UCR A;  2FNA A;  3E6M A;  4GDF A;  1MKM A;  5FKN A;  4I2O A;  4GCV A;  3VYS B;  3MKZ A;  4HZF A;  2VB6 A;  2R93 J;  2V9K A;  3HOY J;  1TBX A;  3WTV C;  1I1G A;  4JYK A;  4MEX F;  4DYC A;  4PSX A;  1TP4 A;  1A36 A;  4HF2 A;  4IHT A;  2DA2 A;  1XMX A;  4OMZ A;  2DPD A;  2DFE A;  3FXL A;  1YW9 A;  4RGU A;  4UNO A;  1FMW A;  1SAX A;  4II2 A;  1JTY A;  2LBF B;  2LYC A;  1XGO A;  1TC3 C;  2X9D A;  2KIS A;  3ZQG A;  3HHH A;  1IF1 A;  2W48 A;  5HLT A;  1ETK A;  5BMZ A;  1E3H A;  2FBH A;  1O3R A;  2W00 A;  1TW2 A;  4A0Y A;  2OV7 A;  1OR7 A;  3S16 J;  2X85 A;  2R7D A;  4QTR A;  4R1H A;  4F91 B;  1F36 A;  3V7S A;  4HPQ A;  2OAZ A;  5JR3 A;  1FOX A;  4ENJ A;  1W0U A;  1BOB A;  2LSO A;  3E3V A;  3LOC A;  3CCR I;  5ILS A;  4NUB A;  5DS9 A;  5F08 A;  5F0F A;  4C3J J;  4KIC A;  1U3E M;  2E71 A;  2QQ8 A;  2LBF A;  3LSG A;  1TT0 A;  5JLX A;  2P7C B;  4NB5 A;  3QP6 A;  4BDZ A;  1NK3 P;  3DWL E;  5GAH J;  2VJ5 A;  5D5W B;  4IRI A;  3RKQ A;  1R00 A;  3LSM A;  3TGN A;  4CCJ A;  3I3L A;  1SAN A;  2VOP A;  2D1H A;  3MQ0 A;  3PO3 J;  2OD5 A;  4IEJ A;  2Z33 A;  2ZXW H;  3GFI A;  2W24 A;  2E36 A;  4M6V A;  2OZU A;  1LEA A;  3Q0U A;  3RTR A;  1IC8 A;  4G9Y A;  2VKH A;  2QCO A;  4II3 A;  4U0W A;  1MNM C;  3ECO A;  3HRU A;  1QQI A;  1R1U A;  5E1Z B;  3CTA A;  2HOA A;  5D8K B;  3C2B A;  1IN4 A;  2MSY A;  4NBQ A;  4UV8 A;  5TJJ A;  2Y30 A;  3NRV A;  4XLN F;  5ICG A;  2AS5 F;  4ANJ A;  4XIC A;  2FML A;  1PVE A;  2DN0 A;  2A3S A;  1OPC A;  3MKY B;  4YII A;  3FK7 A;  3ZMD A;  4HV5 A;  4Y17 A;  2L7M P;  2VQH A;  4BJ5 C;  4BS9 A;  5BS6 A;  5DM6 F;  1DPU A;  4CH7 A;  2M9H A;  5LHI A;  5EG0 A;  4BBS J;  2MC3 A;  3S14 J;  3I58 A;  2XAH A;  5IT9 Z;  4A3F J;  2BVL A;  2DFF A;  3SZT A;  5LHH A;  4A93 J;  4XOP A;  3H1C A;  1QO0 D;  1XSX A;  4M3F A;  2XAJ A;  3KET A;  2JRM A;  1T56 A;  1V5F A;  5H20 A;  1TZL A;  2DJN A;  1B1B A;  3TO6 A;  3OIO A;  5FLV A;  2YU3 A;  1JGG A;  1E3P A;  2BE5 F;  2L54 A;  4OMY A;  2LDU A;  3BTI A;  3GTK J;  3PFI A;  1X1D A;  2QLZ A;  1I3Q J;  3V4G A;  1YE9 A;  2GA2 A;  3FXO A;  3W2V A;  5DUK A;  2NS7 A;  4CCL A;  3HOV J;  3DTK A;  1EA3 A;  1OMI A;  2QWW A;  2DMT A;  1H88 C;  2JZY A;  4Z2Y A;  3DKW A;  3W6J B;  3S8P A;  3GX4 X;  2EWN A;  1FEX A;  1X3W B;  2CS3 A;  3WTT C;  3G6E I;  2NOJ B;  5CQG A;  1IRZ A;  5ICC A;  3S93 A;  3U21 A;  1MBH A;  1HCR A;  1G3Y A;  3DPL C;  3PJR A;  4O3M A;  1ZR2 A;  5J4V A;  2W57 A;  4S0H B;  3OYB A;  2VI6 A;  1FP1 D;  2FOK A;  4B8X A;  3DU6 A;  3HKZ A;  2CQQ A;  3GCM A;  4XKB A;  2EIJ H;  5DEQ A;  4A12 A;  5C44 J;  2IXS A;  3RIR A;  1K7A A;  2NVX J;  3IWZ A;  2LOO A;  2NVT J;  3ECH A;  1H9G A;  2WA0 A;  3QOD A;  2CUE A;  4BE1 A;  1SVL A;  1R1V A;  1X1C A;  4BEH B;  4JX6 A;  4KIG A;  5BPI A;  1AU7 A;  2E1N A;  2RAE A;  3QOE A;  3CF2 A;  3P9C A;  3KP2 A;  2AQE A;  1WI3 A;  2VAS A;  4V2G A;  3FXK A;  4BHP A;  4JK1 X;  3GTL J;  2RGV A;  1QHH D;  3NAR A;  1H0M A;  3I5U A;  2O61 A;  3KP4 A;  4ZC3 A;  4KIB A;  4P1W A;  2BV6 A;  3KP6 A;  4PJJ A;  3UR3 C;  4G7H F;  1OCR H;  1GV5 A;  2L2O A;  4HDV A;  3IH2 A;  3QYE A;  3SZG A;  6PAX A;  1VQK I;  2DT6 A;  1GVJ A;  5HOO A;  2OZ6 A;  3KP3 A;  2BEO A;  3I53 A;  3LA7 A;  3N05 A;  4ZYE A;  3FHZ A;  1QU3 A;  5GAG J;  1TL8 A;  1JHH A;  3BTJ A;  3H9Q A;  3CO7 C;  2L7K A;  5HDK A;  1S6L A;  3TOA A;  2N8G A;  2CV1 A;  4JQF A;  1GT0 C;  2YUS A;  3QP5 A;  1IDZ A;  5J1U A;  4QIW N;  1KGS A;  2LKX A;  2ZJP F;  2QGU A;  4PFO A;  4RAY A;  3BJ6 A;  3FM3 A;  1RKW A;  2WV1 A;  4DIQ A;  3VOD A;  3K4C A;  3WTZ A;  3FF5 A;  3OYM A;  1HF0 A;  2VUM J;  3L7W A;  1Y56 A;  1L0O C;  1WKM A;  1MDM B;  2FRH A;  3FM5 A;  2L9S A;  3C7J A;  2KIQ A;  1N75 A;  4MQ9 F;  3B02 A;  4BE0 A;  1WH5 A;  3OYL A;  1IW7 F;  1IN6 A;  3ZRG A;  3ZQF A;  3VSK A;  1W36 D;  2CW7 A;  1FOY A;  2HYF A;  5HS8 A;  4AU7 A;  3A01 B;  4NC6 A;  1LFB A;  4JBA A;  3FDY A;  5HOD A;  4R8H A;  1RET A;  4IKF A;  2Q2E A;  1JUM A;  3RKY A;  2DYR H;  3QYF A;  1R4M B;  2F5V A;  3E97 A;  5M3M J;  2M3A A;  5FLX Z;  3M4O J;  3RJP A;  1XSV A;  2FE3 A;  4BQN A;  1K6O A;  4KMF A;  4ENM A;  4IO9 F;  2PJP A;  3IV5 A;  4EM2 A;  2W7N A;  5E1X A;  4Q4Z F;  4AIK A;  2HEO A;  1VQN I;  1K78 B;  1YIT I;  3HB9 A;  4Q48 A;  2LD5 A;  1KU3 A;  2EFQ A;  2X1D A;  1FYL A;  1T33 A;  4UVA A;  3K4B A;  1OQY A;  2HOE A;  2KRH A;  1S72 I;  1K79 A;  1J75 A;  1QVT A;  3S1M J;  2H1L A;  4FQG A;  1DGR M;  2X6W A;  4Y13 A;  1Y8R B;  2W4S A;  4HRI A;  1W36 C;  4A6E A;  2DMU A;  4XLH A;  1K4T A;  2KFD A;  4HQE A;  1MGT A;  1DQU A;  1ENH A;  3IKT A;  1EH8 A;  2K5C A;  4OIQ F;  1VZ0 A;  2WB1 N;  3AG3 H;  4HX7 A;  3D5S C;  3DKY A;  3R60 A;  4XN3 A;  3T8R A;  3CCV I;  4AID A;  1Y0N A;  3SHF A;  1I3A A;  1YOV B;  5IOZ A;  2A05 A;  3I71 A;  1D0X A;  3J7Y J;  3OS1 A;  1ZRF A;  4EJU A;  4PFP A;  3F6V A;  1S5L C;  1SFX A;  4IXA A;  1UB9 A;  1MSF C;  1XDS A;  3HJE A;  2R5Y B;  3H35 A;  1U9O A;  1Z1D A;  4E7H A;  2ETH A;  1W5T A;  1H89 C;  3D5R C;  1U9N A;  2MFZ A;  1UAA A;  1BIB A;  1MNE A;  1Z05 A;  1KZH A;  2CRG A;  5DTD A;  3LA2 A;  1YG2 A;  2M8G X;  1BA5 A;  4KIF A;  2EIL H;  2KJB A;  2HFH A;  3FMR A;  1XS9 A;  4EEF G;  2ISY A;  2V1X A;  4OOI A;  4W97 A;  2KL4 A;  1GHC A;  3V7C A;  4A3D J;  3VWB A;  4HQM A;  4M3E A;  2E60 A;  2IA0 A;  2EQR A;  2M7B A;  3R6S A;  2G7H A;  3GVA A;  1PYV A;  2LNB A;  5IT9 K;  2CQ7 A;  2R0Q C;  2BY3 A;  4N4N B;  3ZQH A;  2ZNZ A;  5GTH C;  3ZMS A;  2ZO4 A;  1A31 A;  4PJN A;  2D45 A;  2DXI A;  3G1O A;  2IGO A;  4KJZ A;  5L3B A;  3ONQ A;  2FMY A;  2IA1 A;  2HPI A;  1WVR A;  5EYR A;  2BBY A;  1V4R A;  3R61 A;  3KPH A;  3PSF A;  4Y33 A;  4ZZD A;  1HKT A;  5J1Y A;  3WE2 A;  2F5E A;  3W6K B;  2XGC A;  4I76 A;  2ZFW A;  3K7A J;  4A3G J;  3E1S A;  2KIF A;  3C3W A;  2HQA A;  3BDD A;  2EV5 A;  1HKS A;  2L0K A;  5IYD J;  2K02 A; 
#chains in the Genus database with same CATH homology
 4DW6 A;  2VKE A;  3H3V K;  3JRE A;  2YU9 J;  2O9L A;  3MN2 A;  2ID6 A;  5K7F A;  2KT0 A;  3JRB A;  2QF7 A;  5GPC A;  2COB A;  1ETY A;  2XPU A;  5FKL A;  2LY9 A;  1VFC A;  3MVP A;  4GFB A;  1OCP A;  4MFD A;  5GP9 A;  4Y7N J;  1ORK A;  2OPT A;  1WGX A;  4BY1 J;  1HOM A;  2DA5 A;  1JT6 A;  3QQA A;  1B8I B;  2E2I J;  1JTX A;  2OF7 A;  3CMY A;  2B63 J;  1JUS A;  5K7Z A;  5IPA A;  3F0C A;  3BQY A;  1RKT A;  4C3I J;  4AYB N;  4Y52 J;  3TW7 A;  3JRH A;  1MSE C;  1UHS A;  3IH3 A;  2DMP A;  4A69 C;  2HOT A;  3RQI A;  2Y31 A;  3TP3 A;  1Y1V J;  1MH4 A;  4XID A;  4L5E A;  4XK4 A;  3G1L A;  1PUF A;  2LLK A;  2YS9 A;  2LVS A;  1B8I A;  1JKR C;  5C3E J;  1LFU P;  1GV2 A;  4D5C A;  2LK2 A;  4A3J J;  1BL0 A;  3GTG J;  2LTP A;  4HNV A;  3W6V A;  1GDT A;  4UUT A;  3BG9 A;  2X48 A;  3JRA A;  2L9R A;  2XGE A;  3LSJ A;  3BG3 A;  1I50 J;  2LFB A;  1QPI A;  1MH3 A;  3Q3S A;  1O4X A;  2XB0 X;  2Y0S N;  5FKM A;  1XC5 A;  1DU6 A;  1IUF A;  3FK6 A;  3S1N J;  1BW5 A;  4B1R A;  1ZK8 A;  1OJL A;  3BQZ A;  4BXX J;  5EEA A;  4FE4 A;  3OSF A;  1JKO C;  5J3L A;  1QRY A;  2HI3 A;  5EZH A;  3GTJ J;  1LE8 A;  3HOZ J;  2L7Z A;  3GBG A;  4JX5 A;  2NS8 A;  2ME6 A;  3FIS A;  2CJJ A;  2ZB9 A;  1XG1 A;  2EZI A;  1W0T A;  3MKL A;  1TWA J;  1ZQ3 P;  5EGO A;  3BR3 A;  4UUS B;  1FIA A;  1ETQ A;  3DEW A;  2JWT A;  5FKN A;  3RZD J;  9ANT A;  4B4C A;  1NTC A;  4IHW A;  2ME0 A;  3H0G J;  2VPR A;  4M3G A;  2R93 J;  3HOY J;  4XRS G;  4DZP A;  2K9S A;  1G2H A;  3GTQ J;  1HDD C;  3S1Q J;  4JYK A;  1X2M A;  5EDN A;  4D7M A;  2E2H J;  4DYC A;  1TWH J;  2JN6 A;  2DA2 A;  4AUX A;  3LSP A;  5IP6 A;  1JTY A;  1GVD A;  1TC3 C;  2X9D A;  5FKK A;  1IG7 A;  3ZQG A;  3PO2 J;  4DYQ A;  2W48 A;  1WCM J;  1JJ8 C;  1ETK A;  2WAQ N;  3BR1 A;  3B6A A;  1HLV A;  3S16 J;  1IGN A;  1B72 B;  4QTR A;  2JA7 J;  1F36 A;  3SDG A;  1W0U A;  3LOC A;  5DS9 A;  5F08 A;  5F0F A;  4C3J J;  2ELK A;  1U78 A;  3LSG A;  2E19 A;  5JLX A;  4JP0 A;  1NK3 P;  1X2N A;  2FJ1 A;  3RKQ A;  3UKG A;  1IJW C;  2H8R A;  2GM4 A;  1F43 A;  2Y2Z A;  2LR8 A;  3ZQL A;  4NDL A;  1WH7 A;  4QSH A;  1SAN A;  3GTO J;  3I4N J;  3PO3 J;  4IEJ A;  1D5Y A;  1BJZ A;  2IAI A;  4M6V A;  3Q0U A;  3HOX J;  1IC8 A;  3FKI J;  3L1P A;  2QCO A;  1MNM C;  1Q1V A;  1VI0 A;  4W1U A;  2CUF A;  5F27 A;  3HOW J;  2ECB A;  2HOA A;  3C2B A;  2MSY A;  1TWF J;  2Y30 A;  1ETV A;  1UMQ A;  3K2A A;  1BW6 A;  1POG A;  4XIC A;  4CYC B;  2DN0 A;  1PUF B;  4FIS A;  3FK7 A;  3HEF A;  2L7M P;  2TRT A;  1R9T J;  2M9H A;  4ABZ A;  5EG0 A;  3ZOB A;  4BBS J;  5K7H A;  4RBO A;  2HXO A;  3NAU A;  1P7J A;  1I6H J;  2DA3 A;  3S14 J;  3D1N I;  4A3F J;  5M5W J;  4A93 J;  4A3C J;  3I4M J;  4CYC A;  5FJ8 J;  4XRS A;  4M3F A;  4XRM A;  5M3F J;  3O8G A;  4M3B A;  4X6A J;  1T56 A;  3IH4 A;  4C3H J;  3JRG A;  2DA6 A;  2DJN A;  3BR0 A;  4BBR J;  3OIO A;  1ZGW A;  1ETO A;  1JT0 A;  5FLV A;  1LE8 B;  1JGG A;  3HDD A;  2AHQ A;  1HDP A;  2NVQ J;  3BTI A;  3GTK J;  2R92 J;  5M5X J;  1I3Q J;  1QVU A;  2M34 A;  5EGO B;  4A3L J;  2K9N A;  2NS7 A;  3HGG A;  1ETW A;  3HOV J;  3BTL A;  3JRD A;  2DMT A;  1H88 C;  1OCT C;  2P81 A;  1U8B A;  1IV6 A;  3A01 A;  1FEX A;  2I10 A;  2O8K A;  1IRZ A;  1Z0X A;  4MLO A;  5IYB J;  1ZTR A;  2HXI A;  2XGD A;  1UG2 A;  2DMN A;  2R5Z B;  1MBH A;  3OOU A;  1IDY A;  1HCR A;  5E3M A;  1ZR2 A;  5F0H A;  4S0H B;  2JA8 J;  2VI6 A;  4FE7 A;  2VKV A;  4FCY A;  3LNQ A;  1FIP A;  4MIM A;  2CQQ A;  5C44 J;  2NVX J;  3JRC A;  2NVT J;  1RR7 A;  3A02 A;  4B3A A;  2R5Z A;  2CUE A;  1ZR4 A;  1JJ6 C;  1H8A C;  1A5J A;  4AC0 A;  3VPR A;  3M3Y J;  4JX6 A;  2XSD C;  1AU7 A;  2RAE A;  2NVY J;  3TED A;  2O7O A;  3HM5 A;  5FKO A;  3GTM J;  4A3K J;  4J19 A;  1WI3 A;  4V2G A;  2CU7 A;  2GLO A;  3BTC A;  3CCY A;  3GTL J;  4BKX A;  2MG4 A;  5E3N A;  4C2M J;  2D5V A;  2E1O A;  1K83 J;  5FLM J;  2EBI A;  3NAR A;  4BY7 J;  5J1R A;  2R5Y A;  2K40 A;  2MW8 A;  1OFC X;  2DMQ A;  1GV5 A;  3SJM A;  3IH2 A;  3ZQI A;  1S7E A;  1TWG J;  2Y9Y A;  4A3B J;  5IYC J;  3ZQC A;  3JRI A;  1JUP A;  5EG0 B;  1AKH B;  1APL C;  3BTJ A;  4IHX A;  5EF6 A;  2JA5 J;  3DCF A;  3S1R J;  2N8G A;  3WHC A;  5IP7 J;  1GT0 C;  1Y1W J;  2YUS A;  1IDZ A;  5J1U A;  4QIW N;  2K9Q A;  3E7L A;  2LKX A;  1RKW A;  2WV1 A;  1RPW A;  3BR5 A;  1AKH A;  5IP9 J;  1HF0 A;  2VUM J;  4JX4 A;  4V2F A;  4RDU A;  4M3D A;  5F1J A;  1WH5 A;  4D5F A;  4IHV A;  3BT9 A;  2HYJ A;  2HQ5 A;  2CQX A;  3CDL A;  3ZQF A;  2FD5 A;  5EZG A;  2NOG A;  1FTT A;  3FIW A;  3A01 B;  1LFB A;  3O8H A;  5HOD A;  1TWC J;  2H1K A;  2R7Z J;  5C4X J;  1RET A;  1EF4 A;  1JUM A;  1GUU A;  5M3M J;  4IHY A;  3M4O J;  1ETX A;  1FJL A;  3BG5 A;  2IBD A;  4X1E A;  3BR6 A;  5BNG A;  3IV5 A;  4DZJ A;  3HB9 A;  3QPS A;  2LD5 A;  1MBF A;  3TW6 A;  1MBE A;  1T33 A;  1DU0 A;  3TP0 A;  5GPA A;  5C4J J;  1QVT A;  1A6I A;  2DA1 A;  3A03 A;  3S1M J;  2ID3 A;  4MO7 A;  2FX0 A;  3LSR A;  3S15 J;  1JKP C;  3GTP J;  2JMW A;  3QPL A;  1SFO J;  2MGQ A;  1CQT A;  2PMZ N;  2DMU A;  5M5Y J;  3S2H J;  3JRF A;  2XRL A;  1RES A;  1ENH A;  2XB5 A;  3BR2 A;  2WB1 N;  5E3L A;  3HBL A;  2Y9Z A;  2HDD A;  2M0C A;  2M2E A;  2DA4 A;  5F04 A;  2TCT A;  1ZKG A;  2X6O A;  2HOS A;  3PM1 A;  2JK3 A;  5IOZ A;  1JKQ C;  3S2D J;  1MBJ A;  1MBG A;  3Q0W A;  5E3O A;  1MSF C;  2LP0 A;  2R5Y B;  1VF9 A;  1FTZ A;  1U9O A;  2XPW A;  2GBY A;  4G12 A;  4I6Z A;  3S17 J;  1H89 C;  1U9N A;  1YRN B;  1ITY A;  2CRG A;  5DTD A;  4DYR A;  1K61 A;  2M8G X;  3OSG A;  1BA5 A;  1AHD P;  4FTH A;  1XS9 A;  2EZK A;  3B6C A;  4LOC A;  4EEF G;  3Q0V A;  2DTZ A;  1E3O C;  4W97 A;  3SFI A;  1NK2 P;  1P7I A;  2DA7 A;  4UUS A;  3RZO J;  2KDZ A;  4A3D J;  4A3E J;  4M3E A;  2EQR A;  1X58 A;  3JR9 A;  1YRN A;  1Z77 A;  2IEK A;  3HGY A;  2JJ7 A;  3ZQH A;  1MBK A;  2R0Q C;  2ECC A;  5F0C A;  1WPK A;  2EZH A;  4A3I J;  3G1O A;  4MFE A;  2EH3 A;  4A3M J;  3G1M A;  5EYR A;  3HKZ N;  5IOY A;  3WHB A;  2E2J J;  1VND A;  2FQ4 A;  2L7F P;  2JA6 J;  5J1Y A;  3HOU J;  2XGC A;  4I76 A;  2G0E A;  3K7A J;  4A3G J;  2AO9 A;  3CQZ J;  4D7N A;  2EZL A;  2L0K A;  5IYD J;  5JLW A;  2XPV A;  1B72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...