2M8PA

The structure of the w184am185a mutant of the hiv-1 capsid protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
221
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structure and Dynamics of Full-Length HIV-1 Capsid Protein in Solution.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 63
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2m8pA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2m8pA02
1A43A 1EIAA 1L6NA 2ONTA 2M8LA 3DPHA 4PH0A 4U0EA 2M8PA 1M9FC 3DTJA 2L6EA 3DS3A 2GOLB 4COPA 2JYLA 4PH1A 4E92A 3NTEA 3H4EA 3P05A 3DS2A 2JO0A 1E6JP 3DS5A 2KODA 1M9XC 2PWMA 4WYMA 4E91A 2X82A 2Y4ZA 4PH3A 4HTWA 2WLVB 2XV6A 4QNBA 3G21A 4B4NA 2JYGA 3G28A 4J93A 5DCKA 2XDEA 4U0FA 4DGAC 4XFZA 1M9CC 1QRJA 4U0CA 3LRYA 5I4TG 5JPAA 4IPYA 3G29A 1D1DA 1M9EC 5HGKA 4U0DA 3MGEA 1GWPA 3G26A 3H47A 1AK4C 2PXRC 1P7NA 1AFVA 4LQWC 4XFYA 3G0VA 3DS1A 5HGLA 5HGMA 4U0BA 5HGNA 1G03A 3VRLC 4DGEC 3BP9A 1M9DC 2KGFA 3G1GA 4XROA 3G1IA 1BAJA 2X83A 4M0IA 4COCA 4NX4C 2WLVA 2BUOA 1U7KA 1A8OA 1M9YC 4U0AA 2XXMA 1AUMA 2XGYA 2V4XA 2GONA 2M8NA 2XT1A 3DS4A 2LF4A 4XRQA 2JPRA 2EIAA 5HGOA 3DS0A 2XGUA 2XGVA 1EM9A 4INBA 4PH2A 1EOQA 2X2DD 4XFXA 2PWOA
chains in the Genus database with same CATH superfamily
2FQ2A 1Q82Q 1L6NA 2LOLA 4H2WC 4QKOA 2AF8A 5BS1A 2L0QA 1HQBA 2XZ0D 2N6YA 2AFDA 4E92A 2MY5A 2MD9A 3P05A 3DS5A 1M6EX 2LIUA 2BHVA 2X82A 3CCSP 1Q81Q 4R0MA 1UNKA 1F80D 2EHSA 2JB0A 3G21A 1K9MQ 2ERHA 1FR2A 1K8AQ 4XFZA 1IMQA 5JPAA 2MR7A 4F37A 3CCMP 1D1DA 5HGKA 4U0DA 1CEIA 2PENA 2CG5B 3G26A 1DNYA 1VQ6P 3E2DA 1NJIQ 2GYKA 3G0VA 5HGLA 4U0BA 3G4SP 2L9FA 2CNRA 2GZJA 1YI2P 3CCRP 3G1IA 1BAJA 5F2NA 1KQSO 3HYBA 2CWOA 4NX4C 3CMEP 2FVFA 3WBHA 4U0AA 3G6EP 1KLPA 1VQLP 2OTJP 2JBGA 1L0IA 2PEOA 1MZ8A 2LF4A 2K93A 3CC7P 3OW2O 1M1KQ 2KGAA 2Z46A 2JGPA 4PWVB 2MF4A 2K5XA 1IUQA 5KP6B 4INBA 2P9XA 3CCUP 3CCLP 2FHSC 1QRJA 2PWOA 3EJDA 4GR2A 1EIAA 3GZLA 2M8LA 4PH0A 1VQ5P 1M9FC 2KOPA 3GKLC 4COPA 2JYLA 2JQ4A 2N6ZA 2EG5A 3NTEA 2WPTA 1GXHA 2JAZA 3DS2A 1YITP 2EFJA 2GDXA 5KP8B 1M9XC 4E91A 2Y4ZA 3I56P 4H2YC 2KGEA 1ZMBA 1K30A 5F2OA 1QVFO 3CD6P 2K0DX 3CPWO 1M74A 1JJ2O 2FACA 1UJZA 2JYGA 3G28A 3CC4P 2PEQA 4U0FA 2X2BA 4H2XC 2VLQA 1IMPA 2KGDA 4BPHA 2KG8A 1VQOP 2MVVA 2K0XA 3MGEA 1VQ9P 2DGYA 1VQ7P 3CCJP 1AK4C 1GPJA 2OARA 2LIWA 1ACPA 2FQ1A 2Z45A 1YIJP 5HGMA 1W2BO 4XROA 1YJNP 2X83A 4M0IA 1VKUA 2LTEA 3EJEA 2FVAA 4COCA 2N5HA 2GZEA 2KG6A 1Z6MA 4NEOA 2N50A 2Z44A 1M6NA 3NY7B 1VQKP 1M9YC 2GZIA 2KR5A 2XGYA 3HZQA 2GONA 2QA4P 4XRQA 2JU2A 5EW5E 4UHPB 2M5RA 3B4QA 1L0HA 2XGVA 2PEMA 1EOQA 2VLPA 3U43A 1VHNA 1HY8A 2CGQA 1A43A 2VLNA 2MR8A 2ONTA 2K0YA 4U0EA 5EJDA 3DS3A 3CCEP 2PEIA 2PNGA 4MRTC 2GZGA 2K2QA 3RG6C 2EHTA 4PH3A 4HTWA 4HKGA 1KD1Q 2WLVB 3LMOA 2XV6A 1VQPP 2FQ0A 4QNBA 3GJNA 3RG2A 1AF8A 3B5IA 4B4NA 4J93A 2GZFA 1Q7YQ 2XDEA 2QNWA 2XZ1C 1VQ8P 2N5IA 1M9CC 3LRYA 5I4TG 4CA3A 1M9EC 1GWPA 2GDYA 1NQ4A 2K94A 3H47A 1P7NA 1AFVA 3CXCO 4LQWC 3CC2P 2CQ8A 2GDWA 3G71P 1RO2A 1VQMP 1G03A 2KWLA 1Q86Q 1M90Q 2KGFA 2DNWA 4GR6A 2AVAA 1RO0A 1T8KA 2FADA 1KC8Q 3Q20A 2WLVA 2BUOA 2QEXP 2N98A 2K92A 1RNIA 2V4XA 2AFEA 2KW2A 2XT1A 2JPRA 4PXHB 3CE7A 5HGOA 2LL8A 1BXIA 2FVEA 2OTLP 3DS0A 5F2KA 2XGUA 1EM9A 4PH2A 5BS2A 2X2DD 4XFXA 3EJBA 3CCQP 3DPHA 4IZ6A 1QVGO 2M8PA 3DTJA 2L6EA 2LPKA 2GOLB 2LMLA 2L4BA 4PH1A 2KOSA 3H4EA 2JO0A 1E6JP 2KODA 2KG9A 2PWMA 4WYMA 1ZNVA 2PEKA 1YJ9P 2VLOA 1VQNP 3I55P 5HVCA 1YHQP 4DG9A 3GZMA 5DCKA 1YJWP 3CCVP 4DGAC 1S72P 4U0CA 5KP7B 4IPYA 3G29A 5HV8A 2KORA 3M1MA 2LKIA 2PXRC 2E1MA 4XFYA 2NO8A 1X3OA 3DS1A 2PEJA 5HGNA 3VRLC 1GXGA 2KOOA 4DGEC 3BP9A 1M9DC 3G1GA 1VQ4P 1U7KA 1A8OA 2KOQA 3H0DA 2ROQA 1DV5A 2MVUA 1AYIA 2XXMA 1AUMA 2PY8A 1K73Q 5CZDB 1E0HA 1OR5A 2M8NA 3DS4A 2JU1A 1EMVA 4BPGA 2EIAA 7CEIA 2KGCA 2FAEA 2VSQA 4BPFA 1N8RQ 3CMAP 2L22A
chains in the Genus database with same CATH topology
1A43A 4GR2A 1EIAA 1L6NA 3CCQP 1Q82Q 2ONTA 2M8LA 3DPHA 4PH0A 1VQ5P 1QVGO 5BS1A 4U0EA 2M8PA 1M9FC 3DTJA 2L6EA 3DS3A 2GOLB 4COPA 3CCEP 2JYLA 2PEIA 4PH1A 4E92A 3NTEA 2EG5A 3H4EA 3P05A 3DS2A 2JO0A 1E6JP 1YITP 3DS5A 2EFJA 2KODA 1M6EX 3RG6C 1M9XC 2BHVA 2PWMA 4WYMA 4E91A 2X82A 2Y4ZA 3CCSP 3I56P 2PEKA 4PH3A 4HTWA 1YJ9P 1Q81Q 1KD1Q 2WLVB 1ZMBA 1K30A 5F2OA 2XV6A 1QVFO 1VQPP 1VQNP 3CD6P 4QNBA 3CPWO 1M74A 3B5IA 3G21A 3I55P 1K9MQ 4B4NA 1YHQP 1JJ2O 2JYGA 3G28A 3CC4P 2PEQA 4J93A 5DCKA 1YJWP 2XDEA 4U0FA 1Q7YQ 1K8AQ 1VQ8P 3CCVP 4DGAC 4XFZA 1M9CC 1S72P 1QRJA 4U0CA 3LRYA 5I4TG 1VQOP 5JPAA 4IPYA 3G29A 3CCMP 1D1DA 1M9EC 5HGKA 4U0DA 3MGEA 3M1MA 1GWPA 2PENA 1VQ9P 2DGYA 1VQ7P 3G26A 3H47A 3CCJP 1AK4C 2PXRC 2OARA 1P7NA 1AFVA 2E1MA 1VQ6P 3CXCO 4LQWC 2Z45A 3E2DA 4XFYA 1NJIQ 3CC2P 3G0VA 1YIJP 3DS1A 2PEJA 5HGLA 5HGMA 2P9XA 1RO2A 4U0BA 5HGNA 1G03A 3VRLC 3G4SP 1VQMP 1W2BO 1Q86Q 4DGEC 1M90Q 3BP9A 1M9DC 1YI2P 3CCRP 2KGFA 3G1GA 4XROA 1YJNP 3G1IA 4GR6A 1BAJA 5F2NA 1KQSO 2X83A 3HYBA 1RO0A 2CWOA 4M0IA 4COCA 4NX4C 3CMEP 3G71P 1KC8Q 3Q20A 2WLVA 2BUOA 1VQ4P 1U7KA 3WBHA 1A8OA 2QEXP 2Z44A 3H0DA 1M6NA 1VQKP 1M9YC 1RNIA 4U0AA 3G6EP 1VQLP 2XXMA 2OTJP 1AUMA 2PY8A 2XGYA 2V4XA 1K73Q 3HZQA 2GONA 2M8NA 2XT1A 2QA4P 2PEOA 3DS4A 2LF4A 4XRQA 2JPRA 3CC7P 2EIAA 5HGOA 3OW2O 1M1KQ 2OTLP 2Z46A 3DS0A 5F2KA 2XGUA 2XGVA 2PEMA 1IUQA 1EM9A 4INBA 4PH2A 1EOQA 3CMAP 5BS2A 2X2DD 3CCUP 1N8RQ 3CCLP 4XFXA 2PWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A43 A;  1EIA A;  1L6N A;  2ONT A;  2M8L A;  3DPH A;  4PH0 A;  4U0E A;  2M8P A;  1M9F C;  3DTJ A;  2L6E A;  3DS3 A;  2GOL B;  4COP A;  2JYL A;  4PH1 A;  4E92 A;  3NTE A;  3H4E A;  3P05 A;  3DS2 A;  2JO0 A;  1E6J P;  3DS5 A;  2KOD A;  1M9X C;  2PWM A;  4WYM A;  4E91 A;  2X82 A;  2Y4Z A;  4PH3 A;  4HTW A;  2WLV B;  2XV6 A;  4QNB A;  3G21 A;  4B4N A;  2JYG A;  3G28 A;  4J93 A;  5DCK A;  2XDE A;  4U0F A;  4DGA C;  4XFZ A;  1M9C C;  1QRJ A;  4U0C A;  3LRY A;  5I4T G;  5JPA A;  4IPY A;  3G29 A;  1D1D A;  1M9E C;  5HGK A;  4U0D A;  3MGE A;  1GWP A;  3G26 A;  3H47 A;  1AK4 C;  2PXR C;  1P7N A;  1AFV A;  4LQW C;  4XFY A;  3G0V A;  3DS1 A;  5HGL A;  5HGM A;  4U0B A;  5HGN A;  1G03 A;  3VRL C;  4DGE C;  3BP9 A;  1M9D C;  2KGF A;  3G1G A;  4XRO A;  3G1I A;  1BAJ A;  2X83 A;  4M0I A;  4COC A;  4NX4 C;  2WLV A;  2BUO A;  1U7K A;  1A8O A;  1M9Y C;  4U0A A;  2XXM A;  1AUM A;  2XGY A;  2V4X A;  2GON A;  2M8N A;  2XT1 A;  3DS4 A;  2LF4 A;  4XRQ A;  2JPR A;  2EIA A;  5HGO A;  3DS0 A;  2XGU A;  2XGV A;  1EM9 A;  4INB A;  4PH2 A;  1EOQ A;  2X2D D;  4XFX A;  2PWO A; 
#chains in the Genus database with same CATH topology
 2FQ2 A;  1Q82 Q;  1L6N A;  2LOL A;  4H2W C;  4QKO A;  2AF8 A;  5BS1 A;  2L0Q A;  1HQB A;  2XZ0 D;  2N6Y A;  2AFD A;  4E92 A;  2MY5 A;  2MD9 A;  3P05 A;  3DS5 A;  1M6E X;  2LIU A;  2BHV A;  2X82 A;  3CCS P;  1Q81 Q;  4R0M A;  1UNK A;  1F80 D;  2EHS A;  2JB0 A;  3G21 A;  1K9M Q;  2ERH A;  1FR2 A;  1K8A Q;  4XFZ A;  1IMQ A;  5JPA A;  2MR7 A;  4F37 A;  3CCM P;  1D1D A;  5HGK A;  4U0D A;  1CEI A;  2PEN A;  2CG5 B;  3G26 A;  1DNY A;  1VQ6 P;  3E2D A;  1NJI Q;  2GYK A;  3G0V A;  5HGL A;  4U0B A;  3G4S P;  2L9F A;  2CNR A;  2GZJ A;  1YI2 P;  3CCR P;  3G1I A;  1BAJ A;  5F2N A;  1KQS O;  3HYB A;  2CWO A;  4NX4 C;  3CME P;  2FVF A;  3WBH A;  4U0A A;  3G6E P;  1KLP A;  1VQL P;  2OTJ P;  2JBG A;  1L0I A;  2PEO A;  1MZ8 A;  2LF4 A;  2K93 A;  3CC7 P;  3OW2 O;  1M1K Q;  2KGA A;  2Z46 A;  2JGP A;  4PWV B;  2MF4 A;  2K5X A;  1IUQ A;  5KP6 B;  4INB A;  2P9X A;  3CCU P;  3CCL P;  2FHS C;  1QRJ A;  2PWO A;  3EJD A;  4GR2 A;  1EIA A;  3GZL A;  2M8L A;  4PH0 A;  1VQ5 P;  1M9F C;  2KOP A;  3GKL C;  4COP A;  2JYL A;  2JQ4 A;  2N6Z A;  2EG5 A;  3NTE A;  2WPT A;  1GXH A;  2JAZ A;  3DS2 A;  1YIT P;  2EFJ A;  2GDX A;  5KP8 B;  1M9X C;  4E91 A;  2Y4Z A;  3I56 P;  4H2Y C;  2KGE A;  1ZMB A;  1K30 A;  5F2O A;  1QVF O;  3CD6 P;  2K0D X;  3CPW O;  1M74 A;  1JJ2 O;  2FAC A;  1UJZ A;  2JYG A;  3G28 A;  3CC4 P;  2PEQ A;  4U0F A;  2X2B A;  4H2X C;  2VLQ A;  1IMP A;  2KGD A;  4BPH A;  2KG8 A;  1VQO P;  2MVV A;  2K0X A;  3MGE A;  1VQ9 P;  2DGY A;  1VQ7 P;  3CCJ P;  1AK4 C;  1GPJ A;  2OAR A;  2LIW A;  1ACP A;  2FQ1 A;  2Z45 A;  1YIJ P;  5HGM A;  1W2B O;  4XRO A;  1YJN P;  2X83 A;  4M0I A;  1VKU A;  2LTE A;  3EJE A;  2FVA A;  4COC A;  2N5H A;  2GZE A;  2KG6 A;  1Z6M A;  4NEO A;  2N50 A;  2Z44 A;  1M6N A;  3NY7 B;  1VQK P;  1M9Y C;  2GZI A;  2KR5 A;  2XGY A;  3HZQ A;  2GON A;  2QA4 P;  4XRQ A;  2JU2 A;  5EW5 E;  4UHP B;  2M5R A;  3B4Q A;  1L0H A;  2XGV A;  2PEM A;  1EOQ A;  2VLP A;  3U43 A;  1VHN A;  1HY8 A;  2CGQ A;  1A43 A;  2VLN A;  2MR8 A;  2ONT A;  2K0Y A;  4U0E A;  5EJD A;  3DS3 A;  3CCE P;  2PEI A;  2PNG A;  4MRT C;  2GZG A;  2K2Q A;  3RG6 C;  2EHT A;  4PH3 A;  4HTW A;  4HKG A;  1KD1 Q;  2WLV B;  3LMO A;  2XV6 A;  1VQP P;  2FQ0 A;  4QNB A;  3GJN A;  3RG2 A;  1AF8 A;  3B5I A;  4B4N A;  4J93 A;  2GZF A;  1Q7Y Q;  2XDE A;  2QNW A;  2XZ1 C;  1VQ8 P;  2N5I A;  1M9C C;  3LRY A;  5I4T G;  4CA3 A;  1M9E C;  1GWP A;  2GDY A;  1NQ4 A;  2K94 A;  3H47 A;  1P7N A;  1AFV A;  3CXC O;  4LQW C;  3CC2 P;  2CQ8 A;  2GDW A;  3G71 P;  1RO2 A;  1VQM P;  1G03 A;  2KWL A;  1Q86 Q;  1M90 Q;  2KGF A;  2DNW A;  4GR6 A;  2AVA A;  1RO0 A;  1T8K A;  2FAD A;  1KC8 Q;  3Q20 A;  2WLV A;  2BUO A;  2QEX P;  2N98 A;  2K92 A;  1RNI A;  2V4X A;  2AFE A;  2KW2 A;  2XT1 A;  2JPR A;  4PXH B;  3CE7 A;  5HGO A;  2LL8 A;  1BXI A;  2FVE A;  2OTL P;  3DS0 A;  5F2K A;  2XGU A;  1EM9 A;  4PH2 A;  5BS2 A;  2X2D D;  4XFX A;  3EJB A;  3CCQ P;  3DPH A;  4IZ6 A;  1QVG O;  2M8P A;  3DTJ A;  2L6E A;  2LPK A;  2GOL B;  2LML A;  2L4B A;  4PH1 A;  2KOS A;  3H4E A;  2JO0 A;  1E6J P;  2KOD A;  2KG9 A;  2PWM A;  4WYM A;  1ZNV A;  2PEK A;  1YJ9 P;  2VLO A;  1VQN P;  3I55 P;  5HVC A;  1YHQ P;  4DG9 A;  3GZM A;  5DCK A;  1YJW P;  3CCV P;  4DGA C;  1S72 P;  4U0C A;  5KP7 B;  4IPY A;  3G29 A;  5HV8 A;  2KOR A;  3M1M A;  2LKI A;  2PXR C;  2E1M A;  4XFY A;  2NO8 A;  1X3O A;  3DS1 A;  2PEJ A;  5HGN A;  3VRL C;  1GXG A;  2KOO A;  4DGE C;  3BP9 A;  1M9D C;  3G1G A;  1VQ4 P;  1U7K A;  1A8O A;  2KOQ A;  3H0D A;  2ROQ A;  1DV5 A;  2MVU A;  1AYI A;  2XXM A;  1AUM A;  2PY8 A;  1K73 Q;  5CZD B;  1E0H A;  1OR5 A;  2M8N A;  3DS4 A;  2JU1 A;  1EMV A;  4BPG A;  2EIA A;  7CEI A;  2KGC A;  2FAE A;  2VSQ A;  4BPF A;  1N8R Q;  3CMA P;  2L22 A; 
#chains in the Genus database with same CATH homology
 1A43 A;  4GR2 A;  1EIA A;  1L6N A;  3CCQ P;  1Q82 Q;  2ONT A;  2M8L A;  3DPH A;  4PH0 A;  1VQ5 P;  1QVG O;  5BS1 A;  4U0E A;  2M8P A;  1M9F C;  3DTJ A;  2L6E A;  3DS3 A;  2GOL B;  4COP A;  3CCE P;  2JYL A;  2PEI A;  4PH1 A;  4E92 A;  3NTE A;  2EG5 A;  3H4E A;  3P05 A;  3DS2 A;  2JO0 A;  1E6J P;  1YIT P;  3DS5 A;  2EFJ A;  2KOD A;  1M6E X;  3RG6 C;  1M9X C;  2BHV A;  2PWM A;  4WYM A;  4E91 A;  2X82 A;  2Y4Z A;  3CCS P;  3I56 P;  2PEK A;  4PH3 A;  4HTW A;  1YJ9 P;  1Q81 Q;  1KD1 Q;  2WLV B;  1ZMB A;  1K30 A;  5F2O A;  2XV6 A;  1QVF O;  1VQP P;  1VQN P;  3CD6 P;  4QNB A;  3CPW O;  1M74 A;  3B5I A;  3G21 A;  3I55 P;  1K9M Q;  4B4N A;  1YHQ P;  1JJ2 O;  2JYG A;  3G28 A;  3CC4 P;  2PEQ A;  4J93 A;  5DCK A;  1YJW P;  2XDE A;  4U0F A;  1Q7Y Q;  1K8A Q;  1VQ8 P;  3CCV P;  4DGA C;  4XFZ A;  1M9C C;  1S72 P;  1QRJ A;  4U0C A;  3LRY A;  5I4T G;  1VQO P;  5JPA A;  4IPY A;  3G29 A;  3CCM P;  1D1D A;  1M9E C;  5HGK A;  4U0D A;  3MGE A;  3M1M A;  1GWP A;  2PEN A;  1VQ9 P;  2DGY A;  1VQ7 P;  3G26 A;  3H47 A;  3CCJ P;  1AK4 C;  2PXR C;  2OAR A;  1P7N A;  1AFV A;  2E1M A;  1VQ6 P;  3CXC O;  4LQW C;  2Z45 A;  3E2D A;  4XFY A;  1NJI Q;  3CC2 P;  3G0V A;  1YIJ P;  3DS1 A;  2PEJ A;  5HGL A;  5HGM A;  2P9X A;  1RO2 A;  4U0B A;  5HGN A;  1G03 A;  3VRL C;  3G4S P;  1VQM P;  1W2B O;  1Q86 Q;  4DGE C;  1M90 Q;  3BP9 A;  1M9D C;  1YI2 P;  3CCR P;  2KGF A;  3G1G A;  4XRO A;  1YJN P;  3G1I A;  4GR6 A;  1BAJ A;  5F2N A;  1KQS O;  2X83 A;  3HYB A;  1RO0 A;  2CWO A;  4M0I A;  4COC A;  4NX4 C;  3CME P;  3G71 P;  1KC8 Q;  3Q20 A;  2WLV A;  2BUO A;  1VQ4 P;  1U7K A;  3WBH A;  1A8O A;  2QEX P;  2Z44 A;  3H0D A;  1M6N A;  1VQK P;  1M9Y C;  1RNI A;  4U0A A;  3G6E P;  1VQL P;  2XXM A;  2OTJ P;  1AUM A;  2PY8 A;  2XGY A;  2V4X A;  1K73 Q;  3HZQ A;  2GON A;  2M8N A;  2XT1 A;  2QA4 P;  2PEO A;  3DS4 A;  2LF4 A;  4XRQ A;  2JPR A;  3CC7 P;  2EIA A;  5HGO A;  3OW2 O;  1M1K Q;  2OTL P;  2Z46 A;  3DS0 A;  5F2K A;  2XGU A;  2XGV A;  2PEM A;  1IUQ A;  1EM9 A;  4INB A;  4PH2 A;  1EOQ A;  3CMA P;  5BS2 A;  2X2D D;  3CCU P;  1N8R Q;  3CCL P;  4XFX A;  2PWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...