2M8PA

The structure of the w184am185a mutant of the hiv-1 capsid protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
221
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of Full-Length HIV-1 Capsid Protein in Solution.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 63
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2m8pA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2m8pA02
1A8OA 4PH1A 3G0VA 2KGFA 1D1DA 4QNBA 2LF4A 2JYLA 3DS3A 1M9CC 2JPRA 2KODA 4B4NA 4M0IA 4XFYA 4XFZA 3H4EA 4IPYA 2XXMA 5HGKA 5HGLA 4WYMA 5HGMA 2JO0A 2ONTA 1EIAA 2PWOA 3G29A 1GWPA 2X83A 2X2DD 3H47A 3DS2A 3G1GA 4PH3A 4U0EA 2M8NA 4XFXA 4COPA 1QRJA 4NX4C 1E6JP 3MGEA 3DTJA 4LQWC 2XGYA 1L6NA 2PXRC 2EIAA 2PWMA 4XROA 1M9YC 5JPAA 1BAJA 3G1IA 3P05A 1M9EC 4DGAC 3G21A 4PH2A 1A43A 4COCA 2XGUA 2L6EA 4HTWA 2GOLB 3DS1A 5HGNA 2WLVB 4U0AA 4U0DA 2JYGA 4INBA 4U0FA 4PH0A 4J93A 5DCKA 3G26A 3DPHA 5I4TG 1M9FC 2XGVA 4XRQA 4U0CA 3LRYA 1AUMA 1EOQA 4E91A 2BUOA 1AFVA 4DGEC 1U7KA 4U0BA 2Y4ZA 2GONA 5HGOA 2WLVA 3G28A 3VRLC 2XT1A 2X82A 2M8PA 1P7NA 2XV6A 1M9DC 2V4XA 2XDEA 3BP9A 1M9XC 1EM9A 3DS0A 2M8LA 4E92A 1G03A 3NTEA 3DS5A 1AK4C 3DS4A
chains in the Genus database with same CATH superfamily
1T8KA 4PH1A 2K93A 2KGFA 3GKLC 4MRTC 3GZLA 2JYLA 3DS3A 2K94A 2KGAA 2KODA 4M0IA 3H4EA 1L0IA 2LIUA 2XXMA 2EHSA 3EJDA 5HGLA 3CCMP 4WYMA 1MZ8A 1K73Q 1Q86Q 1YIJP 1VQPP 3B5IA 2CWOA 1VQ4P 3G1GA 1VQLP 2GZJA 4PH3A 2M8NA 2L4BA 4COPA 4NX4C 3CCVP 3G6EP 1YJWP 4LQWC 2PY8A 4HKGA 3CC4P 2PXRC 2OARA 1CEIA 2VLQA 1E0HA 4H2WC 2VLPA 2AF8A 1W2BO 1M9EC 3CCEP 2PEIA 4PH2A 1M1KQ 2XGUA 2L6EA 3DS1A 2JYGA 2MVVA 4INBA 3CCJP 4PWVB 4NEOA 3CMEP 4PH0A 2JGPA 2P9XA 2ERHA 1Q82Q 1M9FC 2KOOA 1VQ6P 1N8RQ 2FVFA 1EOQA 4F37A 2BUOA 2K0XA 2N5IA 7CEIA 2PEKA 5BS1A 1IMPA 3CCLP 2Y4ZA 2XT1A 1P7NA 2VSQA 2DGYA 2KG9A 2QEXP 2KGEA 2XDEA 3BP9A 1M9XC 2M8LA 1RNIA 5KP6B 3DS5A 1AK4C 1Z6MA 1D1DA 2KOSA 1M9CC 1KLPA 1HY8A 1NJIQ 2JPRA 1IUQA 3WBHA 2FQ2A 3G71P 1VQ9P 1UJZA 4QKOA 2ONTA 1GWPA 2X83A 2CG5B 2XZ1C 4DG9A 2Z46A 3HZQA 1VQMP 1GXHA 2FACA 3I55P 3CC2P 2GZEA 2PNGA 1QRJA 3EJBA 1E6JP 3MGEA 3GJNA 2N6ZA 2K2QA 2Z45A 1L6NA 2PWMA 2FVEA 1YJ9P 3CMAP 3CC7P 1M9YC 2PEJA 2PEOA 3G1IA 4BPGA 4BPHA 4HTWA 1GXGA 3CCSP 2MR7A 4U0FA 2XZ0D 1DNYA 4J93A 5BS2A 1VQKP 1X3OA 5DCKA 3G26A 1JJ2O 2KWLA 1RO2A 2XGVA 2PENA 4U0CA 1AUMA 1DV5A 2GDXA 5F2KA 4DGEC 1U7KA 4U0BA 3G4SP 1IMQA 5HGOA 2JBGA 2X82A 2LL8A 2PEQA 2KW2A 1K9MQ 2N5HA 3DS0A 1VKUA 2MVUA 2GYKA 5KP7B 2KGDA 1QVGO 3G0VA 2L0QA 1OR5A 2FADA 5F2OA 2KG8A 2KOQA 3CXCO 2N98A 2K0DX 4XFYA 4CA3A 1EMVA 4IPYA 5HV8A 2KG6A 5HGMA 2JO0A 4UHPB 3NY7B 5EW5E 2PWOA 3G29A 2QNWA 2FAEA 1F80D 1YHQP 3DTJA 1M6NA 1VQNP 1YI2P 2N50A 2KGCA 2K5XA 2OTJP 4GR2A 2EIAA 3CCUP 1VHNA 4XROA 4H2XC 5JPAA 2GDYA 1KD1Q 5KP8B 2JU2A 2JB0A 2LOLA 2JQ4A 5HGNA 4BPFA 1BXIA 1HQBA 4GR6A 2WLVB 4U0AA 3CPWO 1M74A 3OW2O 1AF8A 2MR8A 2BHVA 2N6YA 5I4TG 4XRQA 3LMOA 2FVAA 2VLOA 2K0YA 4E91A 3E2DA 2M5RA 3M1MA 3Q20A 2PEMA 2GZIA 3G28A 3VRLC 2DNWA 2ROQA 2MY5A 2LKIA 1RO0A 2FQ1A 1L0HA 2EHTA 4PXHB 1EM9A 1ZNVA 1K30A 2AVAA 1G03A 2LMLA 2JU1A 3HYBA 2KORA 2X2BA 3DS4A 4IZ6A 2GDWA 1A8OA 2JAZA 2LIWA 1VQ5P 1M90Q 4QNBA 2LF4A 1VQ7P 2GZGA 3CE7A 4B4NA 3EJEA 1QVFO 4XFZA 2QA4P 5HGKA 5F2NA 2OTLP 1S72P 4R0MA 1EIAA 2VLNA 2X2DD 2AFDA 3H47A 3DS2A 3CCRP 1GPJA 5EJDA 1K8AQ 4U0EA 3RG6C 4XFXA 3I56P 3CCQP 3RG2A 1VQOP 2EFJA 2XGYA 2MF4A 1UNKA 2FHSC 2L9FA 2NO8A 1ZMBA 1BAJA 1KC8Q 1VQ8P 2KR5A 3P05A 2MD9A 4DGAC 3U43A 3G21A 1A43A 4COCA 2LPKA 1NQ4A 2GOLB 1FR2A 2L22A 2EG5A 4U0DA 1Q81Q 3DPHA 2KOPA 2AFEA 3LRYA 3B4QA 5HVCA 1YJNP 3H0DA 1AFVA 2LTEA 1KQSO 5CZDB 1YITP 2CQ8A 2Z44A 1AYIA 3GZMA 2GONA 4H2YC 2WLVA 2CGQA 2M8PA 2XV6A 1Q7YQ 2WPTA 2K92A 1M9DC 2V4XA 3CD6P 1ACPA 2E1MA 4E92A 2FQ0A 1M6EX 2GZFA 3NTEA 2CNRA
chains in the Genus database with same CATH topology
1A8OA 1VQ5P 4PH1A 3G0VA 2KGFA 1D1DA 1M90Q 4QNBA 2LF4A 5F2OA 1VQ7P 2JYLA 3DS3A 1M9CC 1NJIQ 2JPRA 3CXCO 2KODA 4B4NA 4M0IA 4XFYA 1IUQA 1QVFO 4XFZA 3H4EA 3WBHA 4IPYA 2XXMA 2QA4P 5HGKA 5F2NA 5HGLA 3CCMP 3G71P 2OTLP 4WYMA 1K73Q 5HGMA 1VQ9P 2JO0A 1S72P 1Q86Q 2ONTA 1YIJP 1EIAA 2PWOA 3B5IA 3G29A 1VQPP 1GWPA 2X83A 2X2DD 2CWOA 3H47A 2Z46A 3DS2A 3HZQA 3CCRP 1VQMP 3G1GA 1VQ4P 1VQLP 1K8AQ 4PH3A 4U0EA 3RG6C 2M8NA 4XFXA 3I56P 3I55P 3CCQP 1YHQP 3CC2P 4COPA 1QRJA 4NX4C 3CCVP 1E6JP 3MGEA 2EFJA 3DTJA 1VQOP 3G6EP 1YJWP 4LQWC 2XGYA 1M6NA 2PY8A 1VQNP 1YI2P 2Z45A 1L6NA 2PXRC 3CC4P 2OTJP 4GR2A 2EIAA 3CCUP 2PWMA 2OARA 4XROA 1YJ9P 3CMAP 3CC7P 1M9YC 2PEJA 5JPAA 1ZMBA 2PEOA 1BAJA 1KC8Q 3G1IA 1KD1Q 1VQ8P 1W2BO 3P05A 1M9EC 4DGAC 3CCEP 3G21A 2PEIA 4PH2A 1A43A 4COCA 1M1KQ 2XGUA 2L6EA 4HTWA 2GOLB 3DS1A 5HGNA 4GR6A 3CCSP 2WLVB 2EG5A 4U0AA 4U0DA 2JYGA 4INBA 3CCJP 3CPWO 4U0FA 1M74A 1Q81Q 3OW2O 3CMEP 4PH0A 4J93A 5BS2A 1VQKP 2P9XA 5DCKA 3G26A 1Q82Q 1JJ2O 3DPHA 2BHVA 1RO2A 1M9FC 2XGVA 5I4TG 4XRQA 1VQ6P 1N8RQ 2PENA 4U0CA 3LRYA 1AUMA 1EOQA 4E91A 2BUOA 3E2DA 3H0DA 1YJNP 1AFVA 5F2KA 4DGEC 1U7KA 1KQSO 1YITP 2PEKA 5BS1A 2Z44A 4U0BA 3M1MA 3Q20A 3G4SP 2Y4ZA 2PEMA 3CCLP 2GONA 5HGOA 2WLVA 3G28A 3VRLC 2XT1A 2X82A 2M8PA 1P7NA 2XV6A 1Q7YQ 2PEQA 2DGYA 2QEXP 1M9DC 1RO0A 1K9MQ 2V4XA 2XDEA 3CD6P 3BP9A 1M9XC 1EM9A 3DS0A 1K30A 2E1MA 2M8LA 4E92A 1G03A 1M6EX 1RNIA 3NTEA 3DS5A 3HYBA 1AK4C 3DS4A 1QVGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8O A;  4PH1 A;  3G0V A;  2KGF A;  1D1D A;  4QNB A;  2LF4 A;  2JYL A;  3DS3 A;  1M9C C;  2JPR A;  2KOD A;  4B4N A;  4M0I A;  4XFY A;  4XFZ A;  3H4E A;  4IPY A;  2XXM A;  5HGK A;  5HGL A;  4WYM A;  5HGM A;  2JO0 A;  2ONT A;  1EIA A;  2PWO A;  3G29 A;  1GWP A;  2X83 A;  2X2D D;  3H47 A;  3DS2 A;  3G1G A;  4PH3 A;  4U0E A;  2M8N A;  4XFX A;  4COP A;  1QRJ A;  4NX4 C;  1E6J P;  3MGE A;  3DTJ A;  4LQW C;  2XGY A;  1L6N A;  2PXR C;  2EIA A;  2PWM A;  4XRO A;  1M9Y C;  5JPA A;  1BAJ A;  3G1I A;  3P05 A;  1M9E C;  4DGA C;  3G21 A;  4PH2 A;  1A43 A;  4COC A;  2XGU A;  2L6E A;  4HTW A;  2GOL B;  3DS1 A;  5HGN A;  2WLV B;  4U0A A;  4U0D A;  2JYG A;  4INB A;  4U0F A;  4PH0 A;  4J93 A;  5DCK A;  3G26 A;  3DPH A;  5I4T G;  1M9F C;  2XGV A;  4XRQ A;  4U0C A;  3LRY A;  1AUM A;  1EOQ A;  4E91 A;  2BUO A;  1AFV A;  4DGE C;  1U7K A;  4U0B A;  2Y4Z A;  2GON A;  5HGO A;  2WLV A;  3G28 A;  3VRL C;  2XT1 A;  2X82 A;  2M8P A;  1P7N A;  2XV6 A;  1M9D C;  2V4X A;  2XDE A;  3BP9 A;  1M9X C;  1EM9 A;  3DS0 A;  2M8L A;  4E92 A;  1G03 A;  3NTE A;  3DS5 A;  1AK4 C;  3DS4 A; 
#chains in the Genus database with same CATH topology
 1T8K A;  4PH1 A;  2K93 A;  2KGF A;  3GKL C;  4MRT C;  3GZL A;  2JYL A;  3DS3 A;  2K94 A;  2KGA A;  2KOD A;  4M0I A;  3H4E A;  1L0I A;  2LIU A;  2XXM A;  2EHS A;  3EJD A;  5HGL A;  3CCM P;  4WYM A;  1MZ8 A;  1K73 Q;  1Q86 Q;  1YIJ P;  1VQP P;  3B5I A;  2CWO A;  1VQ4 P;  3G1G A;  1VQL P;  2GZJ A;  4PH3 A;  2M8N A;  2L4B A;  4COP A;  4NX4 C;  3CCV P;  3G6E P;  1YJW P;  4LQW C;  2PY8 A;  4HKG A;  3CC4 P;  2PXR C;  2OAR A;  1CEI A;  2VLQ A;  1E0H A;  4H2W C;  2VLP A;  2AF8 A;  1W2B O;  1M9E C;  3CCE P;  2PEI A;  4PH2 A;  1M1K Q;  2XGU A;  2L6E A;  3DS1 A;  2JYG A;  2MVV A;  4INB A;  3CCJ P;  4PWV B;  4NEO A;  3CME P;  4PH0 A;  2JGP A;  2P9X A;  2ERH A;  1Q82 Q;  1M9F C;  2KOO A;  1VQ6 P;  1N8R Q;  2FVF A;  1EOQ A;  4F37 A;  2BUO A;  2K0X A;  2N5I A;  7CEI A;  2PEK A;  5BS1 A;  1IMP A;  3CCL P;  2Y4Z A;  2XT1 A;  1P7N A;  2VSQ A;  2DGY A;  2KG9 A;  2QEX P;  2KGE A;  2XDE A;  3BP9 A;  1M9X C;  2M8L A;  1RNI A;  5KP6 B;  3DS5 A;  1AK4 C;  1Z6M A;  1D1D A;  2KOS A;  1M9C C;  1KLP A;  1HY8 A;  1NJI Q;  2JPR A;  1IUQ A;  3WBH A;  2FQ2 A;  3G71 P;  1VQ9 P;  1UJZ A;  4QKO A;  2ONT A;  1GWP A;  2X83 A;  2CG5 B;  2XZ1 C;  4DG9 A;  2Z46 A;  3HZQ A;  1VQM P;  1GXH A;  2FAC A;  3I55 P;  3CC2 P;  2GZE A;  2PNG A;  1QRJ A;  3EJB A;  1E6J P;  3MGE A;  3GJN A;  2N6Z A;  2K2Q A;  2Z45 A;  1L6N A;  2PWM A;  2FVE A;  1YJ9 P;  3CMA P;  3CC7 P;  1M9Y C;  2PEJ A;  2PEO A;  3G1I A;  4BPG A;  4BPH A;  4HTW A;  1GXG A;  3CCS P;  2MR7 A;  4U0F A;  2XZ0 D;  1DNY A;  4J93 A;  5BS2 A;  1VQK P;  1X3O A;  5DCK A;  3G26 A;  1JJ2 O;  2KWL A;  1RO2 A;  2XGV A;  2PEN A;  4U0C A;  1AUM A;  1DV5 A;  2GDX A;  5F2K A;  4DGE C;  1U7K A;  4U0B A;  3G4S P;  1IMQ A;  5HGO A;  2JBG A;  2X82 A;  2LL8 A;  2PEQ A;  2KW2 A;  1K9M Q;  2N5H A;  3DS0 A;  1VKU A;  2MVU A;  2GYK A;  5KP7 B;  2KGD A;  1QVG O;  3G0V A;  2L0Q A;  1OR5 A;  2FAD A;  5F2O A;  2KG8 A;  2KOQ A;  3CXC O;  2N98 A;  2K0D X;  4XFY A;  4CA3 A;  1EMV A;  4IPY A;  5HV8 A;  2KG6 A;  5HGM A;  2JO0 A;  4UHP B;  3NY7 B;  5EW5 E;  2PWO A;  3G29 A;  2QNW A;  2FAE A;  1F80 D;  1YHQ P;  3DTJ A;  1M6N A;  1VQN P;  1YI2 P;  2N50 A;  2KGC A;  2K5X A;  2OTJ P;  4GR2 A;  2EIA A;  3CCU P;  1VHN A;  4XRO A;  4H2X C;  5JPA A;  2GDY A;  1KD1 Q;  5KP8 B;  2JU2 A;  2JB0 A;  2LOL A;  2JQ4 A;  5HGN A;  4BPF A;  1BXI A;  1HQB A;  4GR6 A;  2WLV B;  4U0A A;  3CPW O;  1M74 A;  3OW2 O;  1AF8 A;  2MR8 A;  2BHV A;  2N6Y A;  5I4T G;  4XRQ A;  3LMO A;  2FVA A;  2VLO A;  2K0Y A;  4E91 A;  3E2D A;  2M5R A;  3M1M A;  3Q20 A;  2PEM A;  2GZI A;  3G28 A;  3VRL C;  2DNW A;  2ROQ A;  2MY5 A;  2LKI A;  1RO0 A;  2FQ1 A;  1L0H A;  2EHT A;  4PXH B;  1EM9 A;  1ZNV A;  1K30 A;  2AVA A;  1G03 A;  2LML A;  2JU1 A;  3HYB A;  2KOR A;  2X2B A;  3DS4 A;  4IZ6 A;  2GDW A;  1A8O A;  2JAZ A;  2LIW A;  1VQ5 P;  1M90 Q;  4QNB A;  2LF4 A;  1VQ7 P;  2GZG A;  3CE7 A;  4B4N A;  3EJE A;  1QVF O;  4XFZ A;  2QA4 P;  5HGK A;  5F2N A;  2OTL P;  1S72 P;  4R0M A;  1EIA A;  2VLN A;  2X2D D;  2AFD A;  3H47 A;  3DS2 A;  3CCR P;  1GPJ A;  5EJD A;  1K8A Q;  4U0E A;  3RG6 C;  4XFX A;  3I56 P;  3CCQ P;  3RG2 A;  1VQO P;  2EFJ A;  2XGY A;  2MF4 A;  1UNK A;  2FHS C;  2L9F A;  2NO8 A;  1ZMB A;  1BAJ A;  1KC8 Q;  1VQ8 P;  2KR5 A;  3P05 A;  2MD9 A;  4DGA C;  3U43 A;  3G21 A;  1A43 A;  4COC A;  2LPK A;  1NQ4 A;  2GOL B;  1FR2 A;  2L22 A;  2EG5 A;  4U0D A;  1Q81 Q;  3DPH A;  2KOP A;  2AFE A;  3LRY A;  3B4Q A;  5HVC A;  1YJN P;  3H0D A;  1AFV A;  2LTE A;  1KQS O;  5CZD B;  1YIT P;  2CQ8 A;  2Z44 A;  1AYI A;  3GZM A;  2GON A;  4H2Y C;  2WLV A;  2CGQ A;  2M8P A;  2XV6 A;  1Q7Y Q;  2WPT A;  2K92 A;  1M9D C;  2V4X A;  3CD6 P;  1ACP A;  2E1M A;  4E92 A;  2FQ0 A;  1M6E X;  2GZF A;  3NTE A;  2CNR A; 
#chains in the Genus database with same CATH homology
 1A8O A;  1VQ5 P;  4PH1 A;  3G0V A;  2KGF A;  1D1D A;  1M90 Q;  4QNB A;  2LF4 A;  5F2O A;  1VQ7 P;  2JYL A;  3DS3 A;  1M9C C;  1NJI Q;  2JPR A;  3CXC O;  2KOD A;  4B4N A;  4M0I A;  4XFY A;  1IUQ A;  1QVF O;  4XFZ A;  3H4E A;  3WBH A;  4IPY A;  2XXM A;  2QA4 P;  5HGK A;  5F2N A;  5HGL A;  3CCM P;  3G71 P;  2OTL P;  4WYM A;  1K73 Q;  5HGM A;  1VQ9 P;  2JO0 A;  1S72 P;  1Q86 Q;  2ONT A;  1YIJ P;  1EIA A;  2PWO A;  3B5I A;  3G29 A;  1VQP P;  1GWP A;  2X83 A;  2X2D D;  2CWO A;  3H47 A;  2Z46 A;  3DS2 A;  3HZQ A;  3CCR P;  1VQM P;  3G1G A;  1VQ4 P;  1VQL P;  1K8A Q;  4PH3 A;  4U0E A;  3RG6 C;  2M8N A;  4XFX A;  3I56 P;  3I55 P;  3CCQ P;  1YHQ P;  3CC2 P;  4COP A;  1QRJ A;  4NX4 C;  3CCV P;  1E6J P;  3MGE A;  2EFJ A;  3DTJ A;  1VQO P;  3G6E P;  1YJW P;  4LQW C;  2XGY A;  1M6N A;  2PY8 A;  1VQN P;  1YI2 P;  2Z45 A;  1L6N A;  2PXR C;  3CC4 P;  2OTJ P;  4GR2 A;  2EIA A;  3CCU P;  2PWM A;  2OAR A;  4XRO A;  1YJ9 P;  3CMA P;  3CC7 P;  1M9Y C;  2PEJ A;  5JPA A;  1ZMB A;  2PEO A;  1BAJ A;  1KC8 Q;  3G1I A;  1KD1 Q;  1VQ8 P;  1W2B O;  3P05 A;  1M9E C;  4DGA C;  3CCE P;  3G21 A;  2PEI A;  4PH2 A;  1A43 A;  4COC A;  1M1K Q;  2XGU A;  2L6E A;  4HTW A;  2GOL B;  3DS1 A;  5HGN A;  4GR6 A;  3CCS P;  2WLV B;  2EG5 A;  4U0A A;  4U0D A;  2JYG A;  4INB A;  3CCJ P;  3CPW O;  4U0F A;  1M74 A;  1Q81 Q;  3OW2 O;  3CME P;  4PH0 A;  4J93 A;  5BS2 A;  1VQK P;  2P9X A;  5DCK A;  3G26 A;  1Q82 Q;  1JJ2 O;  3DPH A;  2BHV A;  1RO2 A;  1M9F C;  2XGV A;  5I4T G;  4XRQ A;  1VQ6 P;  1N8R Q;  2PEN A;  4U0C A;  3LRY A;  1AUM A;  1EOQ A;  4E91 A;  2BUO A;  3E2D A;  3H0D A;  1YJN P;  1AFV A;  5F2K A;  4DGE C;  1U7K A;  1KQS O;  1YIT P;  2PEK A;  5BS1 A;  2Z44 A;  4U0B A;  3M1M A;  3Q20 A;  3G4S P;  2Y4Z A;  2PEM A;  3CCL P;  2GON A;  5HGO A;  2WLV A;  3G28 A;  3VRL C;  2XT1 A;  2X82 A;  2M8P A;  1P7N A;  2XV6 A;  1Q7Y Q;  2PEQ A;  2DGY A;  2QEX P;  1M9D C;  1RO0 A;  1K9M Q;  2V4X A;  2XDE A;  3CD6 P;  3BP9 A;  1M9X C;  1EM9 A;  3DS0 A;  1K30 A;  2E1M A;  2M8L A;  4E92 A;  1G03 A;  1M6E X;  1RNI A;  3NTE A;  3DS5 A;  3HYB A;  1AK4 C;  3DS4 A;  1QVG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...