2M8PA

The structure of the w184am185a mutant of the hiv-1 capsid protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
221
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structure and Dynamics of Full-Length HIV-1 Capsid Protein in Solution.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 63
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2m8pA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2m8pA02
2PWMA 2X2DD 3DS0A 2M8NA 1U7KA 2Y4ZA 4B4NA 3DS3A 1QRJA 3G26A 3VRLC 5JPAA 3G29A 1A8OA 3G21A 4PH1A 4E91A 1M9CC 5HGKA 2M8PA 4WYMA 1EIAA 3MGEA 2XDEA 2ONTA 4U0DA 2XV6A 4NX4C 2JYLA 2L6EA 4U0AA 2XGUA 3G0VA 2KGFA 4J93A 2XGVA 4COCA 4COPA 1AFVA 2V4XA 1GWPA 4DGAC 2WLVB 3DS1A 1E6JP 4DGEC 4U0BA 4HTWA 3BP9A 2X83A 1EOQA 4U0CA 4IPYA 4QNBA 3DS4A 3LRYA 1M9EC 2XT1A 4XROA 1EM9A 1M9FC 2PWOA 3H47A 2BUOA 3G1IA 2JPRA 2EIAA 5HGNA 5DCKA 2GOLB 3DTJA 5HGOA 2JYGA 2M8LA 3G28A 3DS2A 4M0IA 5HGLA 4XFYA 2JO0A 1D1DA 3NTEA 1M9DC 4PH3A 1A43A 4INBA 1AUMA 2XXMA 1BAJA 3DS5A 2LF4A 1M9YC 3P05A 4XFXA 4E92A 4XRQA 4XFZA 2KODA 1AK4C 2XGYA 3H4EA 1L6NA 2PXRC 4LQWC 4PH0A 3DPHA 1M9XC 3G1GA 4PH2A 4U0FA 1P7NA 2X82A 1G03A 5HGMA 2WLVA 2GONA 4U0EA 5I4TG
chains in the Genus database with same CATH superfamily
2X2DD 1BXIA 1UJZA 2M8NA 2KOQA 5BS2A 2VLNA 3DS3A 2GZJA 2PEKA 3CE7A 1YHQP 2Z44A 4E91A 2K0DX 1VQ6P 3CCLP 3NY7B 1AF8A 3G71P 2CWOA 2M8PA 1VQ9P 3LMOA 2KOSA 1EIAA 1YJWP 3MGEA 2XDEA 2N98A 2FHSC 1KQSO 1DNYA 2L6EA 4U0AA 2KGEA 3G0VA 2KGFA 1VKUA 2N6YA 4DGAC 3DS1A 1YIJP 3RG2A 4U0BA 1Q86Q 4HTWA 3BP9A 2PNGA 4IPYA 1GXHA 4PXHB 4R0MA 1KD1Q 1T8KA 3LRYA 1L0HA 2FQ0A 4XROA 3GKLC 4BPGA 3CCRP 1EM9A 1DV5A 1ZNVA 2GZFA 3G1IA 2JPRA 5HGNA 2GOLB 1VQ5P 2KG8A 2QA4P 2KWLA 2XZ0D 1VQ8P 1D1DA 1M9DC 1A43A 1W2BO 2XXMA 1BAJA 4BPHA 3CCJP 2FQ1A 3DS5A 7CEIA 1VQ4P 1E0HA 5F2OA 1VQOP 2N6ZA 2PEOA 1L0IA 4XFZA 1AK4C 2CGQA 2PXRC 4LQWC 2VLPA 2MF4A 4PH0A 2QNWA 3WBHA 2LL8A 1HY8A 2KW2A 2AF8A 1M6NA 2AFEA 5KP6B 1K8AQ 2VSQA 2JU1A 2Y4ZA 4B4NA 3CXCO 1QVGO 1K73Q 2FAEA 3G21A 2PEJA 2OTLP 1RO0A 1M9CC 5HGKA 5EJDA 1KLPA 2PEIA 1RNIA 2GZEA 2PENA 2K94A 5HV8A 2EHSA 1Z6MA 2JYLA 1NQ4A 4PWVB 1M90Q 2V4XA 1KC8Q 2KGAA 2N50A 3CMAP 1Q81Q 2VLQA 2Z45A 2X83A 1EOQA 1OR5A 3RG6C 2JQ4A 2MR7A 3CCVP 4QKOA 3GJNA 3CCQP 4NEOA 2XZ1C 1M9EC 2XT1A 2MD9A 2K5XA 2NO8A 2QEXP 1EMVA 1QVFO 2GDXA 1GXGA 2DGYA 2P9XA 4CA3A 3GZMA 2FQ2A 1VQ7P 3DTJA 5HGOA 1IMQA 2FVFA 3NTEA 5EW5E 3M1MA 4HKGA 1HQBA 4XFXA 2KR5A 4E92A 4XRQA 3HYBA 2KODA 1VQNP 2XGYA 1YITP 2PY8A 3CCEP 1MZ8A 4H2YC 1M9XC 3G1GA 4U0FA 1P7NA 2X82A 5F2KA 2ROQA 2WLVA 4BPFA 2EG5A 2KOPA 4U0EA 5I4TG 2PWMA 2L0QA 1JJ2O 1QRJA 3G26A 3VRLC 5JPAA 3G29A 4H2WC 4PH1A 2GZIA 3CCSP 1GPJA 2MVUA 1VQPP 1FR2A 2AFDA 3EJEA 2DNWA 1Q7YQ 1AYIA 4WYMA 2FACA 2M5RA 2XV6A 4NX4C 2K0YA 3I55P 2KG6A 2XGVA 2K93A 3B4QA 4COCA 4F37A 1GWPA 4MRTC 2LTEA 4U0CA 2OARA 2X2BA 1RO2A 4QNBA 3CC2P 2LOLA 2K92A 2PWOA 2KOOA 3H47A 5KP8B 2Z46A 2BUOA 4GR6A 2FVEA 3H0DA 5KP7B 2GYKA 2BHVA 2M8LA 3G28A 3DS2A 4M0IA 4IZ6A 2K2QA 5HGLA 1IUQA 4UHPB 3EJDA 3OW2O 3I56P 2GDYA 4PH3A 1ACPA 4INBA 2EFJA 1X3OA 1YI2P 4GR2A 3B5IA 1M6EX 2LIUA 3G4SP 1M9YC 3P05A 2GZGA 2E1MA 1VHNA 3G6EP 1S72P 2K0XA 2JGPA 2LKIA 1L6NA 1F80D 1N8RQ 3DPHA 2KGCA 4PH2A 1VQKP 1M74A 3CPWO 1G03A 1K30A 5HGMA 3CMEP 1CEIA 2ERHA 3DS0A 5HVCA 1NJIQ 2MR8A 2L9FA 1U7KA 5F2NA 1YJ9P 2N5HA 2FVAA 2AVAA 1A8OA 3U43A 3CCUP 2JU2A 3E2DA 2OTJP 3CCMP 2CG5B 1M1KQ 2KORA 1YJNP 2ONTA 4U0DA 2XGUA 1VQLP 2LPKA 1IMPA 4J93A 2LIWA 5CZDB 4COPA 1AFVA 2KG9A 3EJBA 2WLVB 1E6JP 3GZLA 4DGEC 1K9MQ 3Q20A 2LMLA 2JB0A 3DS4A 5BS1A 2JBGA 2PEQA 3CC7P 1M9FC 2N5IA 2EIAA 5DCKA 3CC4P 2KGDA 2JYGA 1Q82Q 2WPTA 2L22A 4XFYA 2JO0A 2FADA 2L4BA 2CQ8A 1AUMA 2PEMA 1UNKA 2EHTA 2MVVA 2VLOA 2LF4A 3H4EA 3HZQA 2GDWA 1ZMBA 1VQMP 4DG9A 4H2XC 2JAZA 3CD6P 2CNRA 2GONA 2MY5A
chains in the Genus database with same CATH topology
2PWMA 2X2DD 1K8AQ 3DS0A 1NJIQ 2M8NA 1JJ2O 1U7KA 2Y4ZA 4B4NA 5BS2A 5F2NA 3CXCO 1YJ9P 3DS3A 1QVGO 1QRJA 3G26A 1K73Q 3VRLC 2PEKA 5JPAA 3G29A 1YHQP 1A8OA 3G21A 2Z44A 4PH1A 2PEJA 3CCSP 2OTLP 4E91A 3CCUP 1VQ6P 1RO0A 3CCLP 1M9CC 3E2DA 5HGKA 3G71P 2OTJP 2PEIA 1VQPP 3CCMP 2CWOA 1RNIA 2M8PA 1M1KQ 1VQ9P 1Q7YQ 2PENA 4WYMA 1EIAA 1YJWP 3MGEA 1YJNP 2XDEA 2ONTA 4U0DA 2XV6A 4NX4C 2JYLA 1KQSO 1W2BO 2L6EA 4U0AA 2XGUA 1VQLP 3I55P 3G0VA 2KGFA 4J93A 1M90Q 2XGVA 4COCA 4COPA 1AFVA 2V4XA 1GWPA 4DGAC 1KC8Q 2WLVB 3DS1A 1E6JP 1YIJP 4DGEC 4U0BA 1Q86Q 3CMAP 1Q81Q 4HTWA 1K9MQ 2Z45A 3BP9A 2X83A 1EOQA 3Q20A 4U0CA 2OARA 3RG6C 1RO2A 3CCVP 4IPYA 4QNBA 3CC2P 1KD1Q 3DS4A 5BS1A 3CCQP 3LRYA 1M9EC 2XT1A 2QEXP 4XROA 2PEQA 3CCRP 3CC7P 1EM9A 1M9FC 2PWOA 1QVFO 3H47A 2Z46A 2BUOA 4GR6A 3G1IA 2JPRA 2DGYA 2P9XA 3H0DA 2EIAA 5HGNA 5DCKA 3CC4P 2BHVA 1VQ7P 2GOLB 3DTJA 1VQ5P 5HGOA 2JYGA 1Q82Q 2M8LA 3G28A 2QA4P 3DS2A 4M0IA 5HGLA 1IUQA 4XFYA 2JO0A 3OW2O 1D1DA 3I56P 1VQ8P 3NTEA 1M9DC 4PH3A 1A43A 4INBA 1AUMA 2PEMA 2XXMA 1BAJA 2EFJA 3M1MA 3CCJP 1YI2P 3DS5A 1VQ4P 4GR2A 3B5IA 1M6EX 5F2OA 3G4SP 2LF4A 1M9YC 1VQOP 2PEOA 3P05A 4XFXA 4E92A 4XRQA 2E1MA 3G6EP 4XFZA 3HYBA 2KODA 1S72P 1VQNP 1AK4C 2XGYA 1YITP 3H4EA 2PY8A 1L6NA 2PXRC 4LQWC 3HZQA 1ZMBA 3CCEP 4PH0A 1VQMP 1N8RQ 3DPHA 1M9XC 3G1GA 4PH2A 4U0FA 1P7NA 3WBHA 1M74A 2X82A 3CPWO 1G03A 5F2KA 1VQKP 1K30A 3CD6P 1M6NA 5HGMA 2WLVA 2GONA 3CMEP 2EG5A 4U0EA 5I4TG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PWM A;  2X2D D;  3DS0 A;  2M8N A;  1U7K A;  2Y4Z A;  4B4N A;  3DS3 A;  1QRJ A;  3G26 A;  3VRL C;  5JPA A;  3G29 A;  1A8O A;  3G21 A;  4PH1 A;  4E91 A;  1M9C C;  5HGK A;  2M8P A;  4WYM A;  1EIA A;  3MGE A;  2XDE A;  2ONT A;  4U0D A;  2XV6 A;  4NX4 C;  2JYL A;  2L6E A;  4U0A A;  2XGU A;  3G0V A;  2KGF A;  4J93 A;  2XGV A;  4COC A;  4COP A;  1AFV A;  2V4X A;  1GWP A;  4DGA C;  2WLV B;  3DS1 A;  1E6J P;  4DGE C;  4U0B A;  4HTW A;  3BP9 A;  2X83 A;  1EOQ A;  4U0C A;  4IPY A;  4QNB A;  3DS4 A;  3LRY A;  1M9E C;  2XT1 A;  4XRO A;  1EM9 A;  1M9F C;  2PWO A;  3H47 A;  2BUO A;  3G1I A;  2JPR A;  2EIA A;  5HGN A;  5DCK A;  2GOL B;  3DTJ A;  5HGO A;  2JYG A;  2M8L A;  3G28 A;  3DS2 A;  4M0I A;  5HGL A;  4XFY A;  2JO0 A;  1D1D A;  3NTE A;  1M9D C;  4PH3 A;  1A43 A;  4INB A;  1AUM A;  2XXM A;  1BAJ A;  3DS5 A;  2LF4 A;  1M9Y C;  3P05 A;  4XFX A;  4E92 A;  4XRQ A;  4XFZ A;  2KOD A;  1AK4 C;  2XGY A;  3H4E A;  1L6N A;  2PXR C;  4LQW C;  4PH0 A;  3DPH A;  1M9X C;  3G1G A;  4PH2 A;  4U0F A;  1P7N A;  2X82 A;  1G03 A;  5HGM A;  2WLV A;  2GON A;  4U0E A;  5I4T G; 
#chains in the Genus database with same CATH topology
 2X2D D;  1BXI A;  1UJZ A;  2M8N A;  2KOQ A;  5BS2 A;  2VLN A;  3DS3 A;  2GZJ A;  2PEK A;  3CE7 A;  1YHQ P;  2Z44 A;  4E91 A;  2K0D X;  1VQ6 P;  3CCL P;  3NY7 B;  1AF8 A;  3G71 P;  2CWO A;  2M8P A;  1VQ9 P;  3LMO A;  2KOS A;  1EIA A;  1YJW P;  3MGE A;  2XDE A;  2N98 A;  2FHS C;  1KQS O;  1DNY A;  2L6E A;  4U0A A;  2KGE A;  3G0V A;  2KGF A;  1VKU A;  2N6Y A;  4DGA C;  3DS1 A;  1YIJ P;  3RG2 A;  4U0B A;  1Q86 Q;  4HTW A;  3BP9 A;  2PNG A;  4IPY A;  1GXH A;  4PXH B;  4R0M A;  1KD1 Q;  1T8K A;  3LRY A;  1L0H A;  2FQ0 A;  4XRO A;  3GKL C;  4BPG A;  3CCR P;  1EM9 A;  1DV5 A;  1ZNV A;  2GZF A;  3G1I A;  2JPR A;  5HGN A;  2GOL B;  1VQ5 P;  2KG8 A;  2QA4 P;  2KWL A;  2XZ0 D;  1VQ8 P;  1D1D A;  1M9D C;  1A43 A;  1W2B O;  2XXM A;  1BAJ A;  4BPH A;  3CCJ P;  2FQ1 A;  3DS5 A;  7CEI A;  1VQ4 P;  1E0H A;  5F2O A;  1VQO P;  2N6Z A;  2PEO A;  1L0I A;  4XFZ A;  1AK4 C;  2CGQ A;  2PXR C;  4LQW C;  2VLP A;  2MF4 A;  4PH0 A;  2QNW A;  3WBH A;  2LL8 A;  1HY8 A;  2KW2 A;  2AF8 A;  1M6N A;  2AFE A;  5KP6 B;  1K8A Q;  2VSQ A;  2JU1 A;  2Y4Z A;  4B4N A;  3CXC O;  1QVG O;  1K73 Q;  2FAE A;  3G21 A;  2PEJ A;  2OTL P;  1RO0 A;  1M9C C;  5HGK A;  5EJD A;  1KLP A;  2PEI A;  1RNI A;  2GZE A;  2PEN A;  2K94 A;  5HV8 A;  2EHS A;  1Z6M A;  2JYL A;  1NQ4 A;  4PWV B;  1M90 Q;  2V4X A;  1KC8 Q;  2KGA A;  2N50 A;  3CMA P;  1Q81 Q;  2VLQ A;  2Z45 A;  2X83 A;  1EOQ A;  1OR5 A;  3RG6 C;  2JQ4 A;  2MR7 A;  3CCV P;  4QKO A;  3GJN A;  3CCQ P;  4NEO A;  2XZ1 C;  1M9E C;  2XT1 A;  2MD9 A;  2K5X A;  2NO8 A;  2QEX P;  1EMV A;  1QVF O;  2GDX A;  1GXG A;  2DGY A;  2P9X A;  4CA3 A;  3GZM A;  2FQ2 A;  1VQ7 P;  3DTJ A;  5HGO A;  1IMQ A;  2FVF A;  3NTE A;  5EW5 E;  3M1M A;  4HKG A;  1HQB A;  4XFX A;  2KR5 A;  4E92 A;  4XRQ A;  3HYB A;  2KOD A;  1VQN P;  2XGY A;  1YIT P;  2PY8 A;  3CCE P;  1MZ8 A;  4H2Y C;  1M9X C;  3G1G A;  4U0F A;  1P7N A;  2X82 A;  5F2K A;  2ROQ A;  2WLV A;  4BPF A;  2EG5 A;  2KOP A;  4U0E A;  5I4T G;  2PWM A;  2L0Q A;  1JJ2 O;  1QRJ A;  3G26 A;  3VRL C;  5JPA A;  3G29 A;  4H2W C;  4PH1 A;  2GZI A;  3CCS P;  1GPJ A;  2MVU A;  1VQP P;  1FR2 A;  2AFD A;  3EJE A;  2DNW A;  1Q7Y Q;  1AYI A;  4WYM A;  2FAC A;  2M5R A;  2XV6 A;  4NX4 C;  2K0Y A;  3I55 P;  2KG6 A;  2XGV A;  2K93 A;  3B4Q A;  4COC A;  4F37 A;  1GWP A;  4MRT C;  2LTE A;  4U0C A;  2OAR A;  2X2B A;  1RO2 A;  4QNB A;  3CC2 P;  2LOL A;  2K92 A;  2PWO A;  2KOO A;  3H47 A;  5KP8 B;  2Z46 A;  2BUO A;  4GR6 A;  2FVE A;  3H0D A;  5KP7 B;  2GYK A;  2BHV A;  2M8L A;  3G28 A;  3DS2 A;  4M0I A;  4IZ6 A;  2K2Q A;  5HGL A;  1IUQ A;  4UHP B;  3EJD A;  3OW2 O;  3I56 P;  2GDY A;  4PH3 A;  1ACP A;  4INB A;  2EFJ A;  1X3O A;  1YI2 P;  4GR2 A;  3B5I A;  1M6E X;  2LIU A;  3G4S P;  1M9Y C;  3P05 A;  2GZG A;  2E1M A;  1VHN A;  3G6E P;  1S72 P;  2K0X A;  2JGP A;  2LKI A;  1L6N A;  1F80 D;  1N8R Q;  3DPH A;  2KGC A;  4PH2 A;  1VQK P;  1M74 A;  3CPW O;  1G03 A;  1K30 A;  5HGM A;  3CME P;  1CEI A;  2ERH A;  3DS0 A;  5HVC A;  1NJI Q;  2MR8 A;  2L9F A;  1U7K A;  5F2N A;  1YJ9 P;  2N5H A;  2FVA A;  2AVA A;  1A8O A;  3U43 A;  3CCU P;  2JU2 A;  3E2D A;  2OTJ P;  3CCM P;  2CG5 B;  1M1K Q;  2KOR A;  1YJN P;  2ONT A;  4U0D A;  2XGU A;  1VQL P;  2LPK A;  1IMP A;  4J93 A;  2LIW A;  5CZD B;  4COP A;  1AFV A;  2KG9 A;  3EJB A;  2WLV B;  1E6J P;  3GZL A;  4DGE C;  1K9M Q;  3Q20 A;  2LML A;  2JB0 A;  3DS4 A;  5BS1 A;  2JBG A;  2PEQ A;  3CC7 P;  1M9F C;  2N5I A;  2EIA A;  5DCK A;  3CC4 P;  2KGD A;  2JYG A;  1Q82 Q;  2WPT A;  2L22 A;  4XFY A;  2JO0 A;  2FAD A;  2L4B A;  2CQ8 A;  1AUM A;  2PEM A;  1UNK A;  2EHT A;  2MVV A;  2VLO A;  2LF4 A;  3H4E A;  3HZQ A;  2GDW A;  1ZMB A;  1VQM P;  4DG9 A;  4H2X C;  2JAZ A;  3CD6 P;  2CNR A;  2GON A;  2MY5 A; 
#chains in the Genus database with same CATH homology
 2PWM A;  2X2D D;  1K8A Q;  3DS0 A;  1NJI Q;  2M8N A;  1JJ2 O;  1U7K A;  2Y4Z A;  4B4N A;  5BS2 A;  5F2N A;  3CXC O;  1YJ9 P;  3DS3 A;  1QVG O;  1QRJ A;  3G26 A;  1K73 Q;  3VRL C;  2PEK A;  5JPA A;  3G29 A;  1YHQ P;  1A8O A;  3G21 A;  2Z44 A;  4PH1 A;  2PEJ A;  3CCS P;  2OTL P;  4E91 A;  3CCU P;  1VQ6 P;  1RO0 A;  3CCL P;  1M9C C;  3E2D A;  5HGK A;  3G71 P;  2OTJ P;  2PEI A;  1VQP P;  3CCM P;  2CWO A;  1RNI A;  2M8P A;  1M1K Q;  1VQ9 P;  1Q7Y Q;  2PEN A;  4WYM A;  1EIA A;  1YJW P;  3MGE A;  1YJN P;  2XDE A;  2ONT A;  4U0D A;  2XV6 A;  4NX4 C;  2JYL A;  1KQS O;  1W2B O;  2L6E A;  4U0A A;  2XGU A;  1VQL P;  3I55 P;  3G0V A;  2KGF A;  4J93 A;  1M90 Q;  2XGV A;  4COC A;  4COP A;  1AFV A;  2V4X A;  1GWP A;  4DGA C;  1KC8 Q;  2WLV B;  3DS1 A;  1E6J P;  1YIJ P;  4DGE C;  4U0B A;  1Q86 Q;  3CMA P;  1Q81 Q;  4HTW A;  1K9M Q;  2Z45 A;  3BP9 A;  2X83 A;  1EOQ A;  3Q20 A;  4U0C A;  2OAR A;  3RG6 C;  1RO2 A;  3CCV P;  4IPY A;  4QNB A;  3CC2 P;  1KD1 Q;  3DS4 A;  5BS1 A;  3CCQ P;  3LRY A;  1M9E C;  2XT1 A;  2QEX P;  4XRO A;  2PEQ A;  3CCR P;  3CC7 P;  1EM9 A;  1M9F C;  2PWO A;  1QVF O;  3H47 A;  2Z46 A;  2BUO A;  4GR6 A;  3G1I A;  2JPR A;  2DGY A;  2P9X A;  3H0D A;  2EIA A;  5HGN A;  5DCK A;  3CC4 P;  2BHV A;  1VQ7 P;  2GOL B;  3DTJ A;  1VQ5 P;  5HGO A;  2JYG A;  1Q82 Q;  2M8L A;  3G28 A;  2QA4 P;  3DS2 A;  4M0I A;  5HGL A;  1IUQ A;  4XFY A;  2JO0 A;  3OW2 O;  1D1D A;  3I56 P;  1VQ8 P;  3NTE A;  1M9D C;  4PH3 A;  1A43 A;  4INB A;  1AUM A;  2PEM A;  2XXM A;  1BAJ A;  2EFJ A;  3M1M A;  3CCJ P;  1YI2 P;  3DS5 A;  1VQ4 P;  4GR2 A;  3B5I A;  1M6E X;  5F2O A;  3G4S P;  2LF4 A;  1M9Y C;  1VQO P;  2PEO A;  3P05 A;  4XFX A;  4E92 A;  4XRQ A;  2E1M A;  3G6E P;  4XFZ A;  3HYB A;  2KOD A;  1S72 P;  1VQN P;  1AK4 C;  2XGY A;  1YIT P;  3H4E A;  2PY8 A;  1L6N A;  2PXR C;  4LQW C;  3HZQ A;  1ZMB A;  3CCE P;  4PH0 A;  1VQM P;  1N8R Q;  3DPH A;  1M9X C;  3G1G A;  4PH2 A;  4U0F A;  1P7N A;  3WBH A;  1M74 A;  2X82 A;  3CPW O;  1G03 A;  5F2K A;  1VQK P;  1K30 A;  3CD6 P;  1M6N A;  5HGM A;  2WLV A;  2GON A;  3CME P;  2EG5 A;  4U0E A;  5I4T G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...