2M8PA

The structure of the w184am185a mutant of the hiv-1 capsid protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
221
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structure and Dynamics of Full-Length HIV-1 Capsid Protein in Solution.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 63
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2m8pA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2m8pA02
1M9CC 1EIAA 4PH3A 2LF4A 5JPAA 3DPHA 2M8LA 4U0AA 1EOQA 5HGMA 3P05A 1M9EC 4XROA 5HGLA 5HGKA 4INBA 1G03A 2ONTA 4U0FA 4B4NA 2PWMA 1M9XC 4E91A 2XT1A 4DGEC 3DS0A 1U7KA 4LQWC 4U0EA 4PH0A 4M0IA 3G1GA 4XFYA 2XV6A 2XDEA 1BAJA 3VRLC 4XFXA 2GOLB 2JYLA 2KGFA 2L6EA 2X2DD 4U0DA 1AK4C 4U0BA 3MGEA 4PH1A 2X82A 4COCA 2KODA 3DS4A 5I4TG 2JO0A 4U0CA 2WLVA 4NX4C 2XGUA 3NTEA 1D1DA 3DS5A 4WYMA 1L6NA 3G21A 3G29A 3DS1A 1GWPA 3G1IA 3DS2A 2XGVA 2WLVB 2JYGA 4PH2A 5HGOA 3H47A 1AFVA 2PWOA 4XRQA 2XXMA 3G26A 1EM9A 3DS3A 1M9YC 4XFZA 4HTWA 1A8OA 5DCKA 2JPRA 3H4EA 2BUOA 3LRYA 5HGNA 1M9DC 2X83A 2EIAA 3BP9A 4QNBA 3G0VA 1P7NA 4COPA 1E6JP 2GONA 2M8PA 2M8NA 1M9FC 3G28A 4J93A 1QRJA 4E92A 1A43A 2V4XA 4IPYA 1AUMA 2Y4ZA 3DTJA 4DGAC 2XGYA 2PXRC
chains in the Genus database with same CATH superfamily
2EHTA 1RO2A 5BS1A 1M6NA 3OW2O 1K9MQ 2JAZA 2GDXA 3P05A 5HGLA 2ONTA 1E0HA 2OTJP 3B4QA 2GDYA 2K92A 1IMPA 2FHSC 4U0EA 4CA3A 2AVAA 1UJZA 2KGCA 3G1GA 2X2BA 5HVCA 2MVVA 4XFXA 2JYLA 2KGFA 2L6EA 3CCUP 2X2DD 2N50A 3RG6C 2PEOA 5BS2A 2K2QA 4COCA 1Z6MA 2CNRA 2GZFA 1HQBA 3EJEA 1D1DA 3DS5A 3E2DA 5KP8B 2CQ8A 2K0YA 2GZIA 2JYGA 5HV8A 4PH2A 2K93A 2PWOA 4XRQA 2PEQA 2MF4A 3G26A 2CG5B 1M9YC 3Q20A 3EJBA 2JPRA 1F80D 1KQSO 2FVFA 1M9DC 3I56P 1M1KQ 4BPHA 2L0QA 2Z46A 1K73Q 2QA4P 2ERHA 1ZMBA 3CC4P 1P7NA 1E6JP 3GJNA 1YIJP 2N6ZA 2JU2A 1QRJA 2N5HA 2KW2A 2MY5A 2EFJA 1RO0A 2NO8A 4IPYA 3CCLP 2FQ1A 3RG2A 4H2WC 1Q7YQ 2Y4ZA 4DGAC 1M9CC 1X3OA 2VLQA 3CMEP 2PEIA 4PH3A 4GR6A 2E1MA 1EOQA 2CWOA 3CE7A 3CCVP 3CC2P 2DGYA 2AF8A 5HGKA 4INBA 3CMAP 4BPGA 2VSQA 3NY7B 2KGEA 2XT1A 3CPWO 2JU1A 1M90Q 1YJWP 1M74A 2WPTA 4XFYA 2GZGA 1YHQP 2XDEA 3VRLC 1VQNP 1HY8A 2M5RA 4U0DA 5EJDA 1VQOP 3GZMA 2X82A 1M6EX 4H2XC 2KODA 1Q82Q 4HKGA 2OARA 2MR8A 4U0CA 1KC8Q 2KOPA 4WYMA 2MR7A 3G21A 3WBHA 3DS1A 1GWPA 1YI2P 1VKUA 1VQ5P 2FVEA 1Q81Q 1YJNP 2WLVB 1KD1Q 2EG5A 3H47A 2FQ2A 3G71P 1VQ8P 2VLNA 3CXCO 3DS3A 2XZ1C 2QEXP 1VQKP 1A8OA 1Q86Q 1AYIA 1YJ9P 5EW5E 3BP9A 2JB0A 1T8KA 2FAEA 3G0VA 2GDWA 2PENA 3CCSP 1QVFO 2M8NA 2PEJA 3U43A 1A43A 1DV5A 1IUQA 3M1MA 1NJIQ 1AUMA 3DTJA 3B5IA 2PXRC 1VQMP 1EIAA 7CEIA 2Z45A 2L22A 1CEIA 2CGQA 2FQ0A 1ZNVA 1L0HA 4DG9A 2M8LA 1L0IA 3HYBA 2EHSA 2KOSA 1UNKA 1M9EC 4XROA 1G03A 2FACA 1S72P 4DGEC 3DS0A 1GXHA 2MVUA 4PH0A 2KOOA 3CCEP 4M0IA 2GZJA 4R0MA 2GOLB 4H2YC 2FADA 1AK4C 1YITP 1K8AQ 3MGEA 4PH1A 2KG9A 1OR5A 2OTLP 5I4TG 2JQ4A 5F2KA 1N8RQ 2N6YA 3G29A 1GPJA 3G1IA 3CCJP 3DS2A 2XGVA 3CC7P 2KG8A 3GZLA 2VLPA 2LKIA 1AFVA 5CZDB 2JBGA 2GYKA 2L9FA 2K0XA 1EM9A 4XFZA 5F2NA 4HTWA 1EMVA 5HGNA 5F2OA 2JGPA 2KG6A 1VQPP 5KP6B 2PEKA 1VQLP 2GONA 2M8PA 2AFEA 2PNGA 2XZ0D 1M9FC 3G28A 3G4SP 1RNIA 4UHPB 2LL8A 2LIWA 3CCRP 2V4XA 2KORA 2PY8A 3G6EP 3CD6P 1QVGO 2XGYA 4F37A 1IMQA 2LF4A 5JPAA 3DPHA 4U0AA 1JJ2O 2ROQA 5HGMA 4NEOA 1FR2A 2KOQA 2K5XA 4PXHB 2KR5A 4U0FA 4B4NA 2PWMA 1M9XC 2BHVA 1KLPA 4E91A 1VQ4P 3LMOA 2P9XA 1U7KA 4LQWC 2GZEA 1ACPA 1MZ8A 1VHNA 2XV6A 3CCQP 2L4BA 1BAJA 2N98A 4U0BA 2KGDA 2VLOA 3DS4A 2Z44A 2JO0A 2WLVA 3HZQA 4NX4C 4IZ6A 2XGUA 3NTEA 2AFDA 1L6NA 2LTEA 1VQ7P 1W2BO 3EJDA 2KWLA 3H0DA 5HGOA 1AF8A 2KGAA 2PEMA 2QNWA 1DNYA 2XXMA 4GR2A 5KP7B 4PWVB 5DCKA 3CCMP 3H4EA 1VQ6P 2BUOA 3LRYA 2LMLA 4BPFA 2K94A 2X83A 2FVAA 1K30A 2LPKA 4QNBA 2LOLA 3GKLC 4COPA 1BXIA 3I55P 4J93A 4E92A 2LIUA 4MRTC 4QKOA 2K0DX 1NQ4A 1VQ9P 1GXGA 2MD9A 2DNWA 2N5IA 2EIAA
chains in the Genus database with same CATH topology
1M9CC 1VQMP 3CMEP 1EIAA 2PEIA 1RO2A 2Z45A 4PH3A 2LF4A 4GR6A 5BS1A 5JPAA 3DPHA 1M6NA 2M8LA 4U0AA 2E1MA 3HYBA 3OW2O 1EOQA 2CWOA 1K9MQ 1JJ2O 3CCVP 5HGMA 3P05A 1M9EC 2DGYA 3CC2P 4XROA 5HGLA 5HGKA 4INBA 1G03A 2ONTA 3CMAP 4U0FA 2OTJP 1S72P 4B4NA 2PWMA 1M9XC 2BHVA 4E91A 2XT1A 4DGEC 3DS0A 3CPWO 1VQ4P 2P9XA 1U7KA 1M90Q 4LQWC 4U0EA 1M74A 1YJWP 4PH0A 3CCEP 4M0IA 3G1GA 4XFYA 2XV6A 1YHQP 3CCQP 2XDEA 1BAJA 3VRLC 4XFXA 1VQNP 2GOLB 2JYLA 2KGFA 2L6EA 3CCUP 2X2DD 4U0DA 3RG6C 1AK4C 4U0BA 1YITP 1VQOP 1K8AQ 3MGEA 2PEOA 2X82A 1M6EX 4PH1A 4COCA 5BS2A 2KODA 1Q82Q 2OARA 3DS4A 2OTLP 5I4TG 2Z44A 2JO0A 4U0CA 2WLVA 5F2KA 3HZQA 1N8RQ 4NX4C 1KC8Q 2XGUA 3NTEA 1D1DA 3DS5A 4WYMA 3E2DA 1L6NA 3G21A 3WBHA 3G29A 3DS1A 1GWPA 3G1IA 3CCJP 1YI2P 1VQ5P 3DS2A 2XGVA 1W2BO 1Q81Q 1VQ7P 3CC7P 3H0DA 2WLVB 2JYGA 1YJNP 4PH2A 5HGOA 2EG5A 1KD1Q 3H47A 2PEMA 3G71P 1AFVA 2PWOA 4XRQA 2PEQA 1VQ8P 2XXMA 4GR2A 3CXCO 3G26A 1EM9A 3DS3A 1M9YC 3Q20A 2QEXP 4XFZA 1VQKP 5F2NA 4HTWA 1A8OA 5DCKA 3CCMP 2JPRA 3H4EA 1KQSO 1VQ6P 2BUOA 3LRYA 1Q86Q 1YJ9P 5HGNA 5F2OA 1M9DC 3I56P 1M1KQ 2X83A 2EIAA 3BP9A 1K30A 2Z46A 1K73Q 4QNBA 1VQPP 3G0VA 2QA4P 2PENA 1ZMBA 3CC4P 1P7NA 4COPA 3CCSP 1E6JP 2PEKA 1VQLP 1QVFO 2GONA 2M8PA 2M8NA 1YIJP 1M9FC 2PEJA 4J93A 3G28A 1QRJA 4E92A 3I55P 3G4SP 1RNIA 1A43A 1IUQA 2EFJA 3M1MA 1RO0A 3CCRP 2V4XA 4IPYA 3CCLP 2PY8A 1VQ9P 1NJIQ 1Q7YQ 3G6EP 3CD6P 1AUMA 2Y4ZA 3DTJA 1QVGO 4DGAC 3B5IA 2XGYA 2PXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9C C;  1EIA A;  4PH3 A;  2LF4 A;  5JPA A;  3DPH A;  2M8L A;  4U0A A;  1EOQ A;  5HGM A;  3P05 A;  1M9E C;  4XRO A;  5HGL A;  5HGK A;  4INB A;  1G03 A;  2ONT A;  4U0F A;  4B4N A;  2PWM A;  1M9X C;  4E91 A;  2XT1 A;  4DGE C;  3DS0 A;  1U7K A;  4LQW C;  4U0E A;  4PH0 A;  4M0I A;  3G1G A;  4XFY A;  2XV6 A;  2XDE A;  1BAJ A;  3VRL C;  4XFX A;  2GOL B;  2JYL A;  2KGF A;  2L6E A;  2X2D D;  4U0D A;  1AK4 C;  4U0B A;  3MGE A;  4PH1 A;  2X82 A;  4COC A;  2KOD A;  3DS4 A;  5I4T G;  2JO0 A;  4U0C A;  2WLV A;  4NX4 C;  2XGU A;  3NTE A;  1D1D A;  3DS5 A;  4WYM A;  1L6N A;  3G21 A;  3G29 A;  3DS1 A;  1GWP A;  3G1I A;  3DS2 A;  2XGV A;  2WLV B;  2JYG A;  4PH2 A;  5HGO A;  3H47 A;  1AFV A;  2PWO A;  4XRQ A;  2XXM A;  3G26 A;  1EM9 A;  3DS3 A;  1M9Y C;  4XFZ A;  4HTW A;  1A8O A;  5DCK A;  2JPR A;  3H4E A;  2BUO A;  3LRY A;  5HGN A;  1M9D C;  2X83 A;  2EIA A;  3BP9 A;  4QNB A;  3G0V A;  1P7N A;  4COP A;  1E6J P;  2GON A;  2M8P A;  2M8N A;  1M9F C;  3G28 A;  4J93 A;  1QRJ A;  4E92 A;  1A43 A;  2V4X A;  4IPY A;  1AUM A;  2Y4Z A;  3DTJ A;  4DGA C;  2XGY A;  2PXR C; 
#chains in the Genus database with same CATH topology
 2EHT A;  1RO2 A;  5BS1 A;  1M6N A;  3OW2 O;  1K9M Q;  2JAZ A;  2GDX A;  3P05 A;  5HGL A;  2ONT A;  1E0H A;  2OTJ P;  3B4Q A;  2GDY A;  2K92 A;  1IMP A;  2FHS C;  4U0E A;  4CA3 A;  2AVA A;  1UJZ A;  2KGC A;  3G1G A;  2X2B A;  5HVC A;  2MVV A;  4XFX A;  2JYL A;  2KGF A;  2L6E A;  3CCU P;  2X2D D;  2N50 A;  3RG6 C;  2PEO A;  5BS2 A;  2K2Q A;  4COC A;  1Z6M A;  2CNR A;  2GZF A;  1HQB A;  3EJE A;  1D1D A;  3DS5 A;  3E2D A;  5KP8 B;  2CQ8 A;  2K0Y A;  2GZI A;  2JYG A;  5HV8 A;  4PH2 A;  2K93 A;  2PWO A;  4XRQ A;  2PEQ A;  2MF4 A;  3G26 A;  2CG5 B;  1M9Y C;  3Q20 A;  3EJB A;  2JPR A;  1F80 D;  1KQS O;  2FVF A;  1M9D C;  3I56 P;  1M1K Q;  4BPH A;  2L0Q A;  2Z46 A;  1K73 Q;  2QA4 P;  2ERH A;  1ZMB A;  3CC4 P;  1P7N A;  1E6J P;  3GJN A;  1YIJ P;  2N6Z A;  2JU2 A;  1QRJ A;  2N5H A;  2KW2 A;  2MY5 A;  2EFJ A;  1RO0 A;  2NO8 A;  4IPY A;  3CCL P;  2FQ1 A;  3RG2 A;  4H2W C;  1Q7Y Q;  2Y4Z A;  4DGA C;  1M9C C;  1X3O A;  2VLQ A;  3CME P;  2PEI A;  4PH3 A;  4GR6 A;  2E1M A;  1EOQ A;  2CWO A;  3CE7 A;  3CCV P;  3CC2 P;  2DGY A;  2AF8 A;  5HGK A;  4INB A;  3CMA P;  4BPG A;  2VSQ A;  3NY7 B;  2KGE A;  2XT1 A;  3CPW O;  2JU1 A;  1M90 Q;  1YJW P;  1M74 A;  2WPT A;  4XFY A;  2GZG A;  1YHQ P;  2XDE A;  3VRL C;  1VQN P;  1HY8 A;  2M5R A;  4U0D A;  5EJD A;  1VQO P;  3GZM A;  2X82 A;  1M6E X;  4H2X C;  2KOD A;  1Q82 Q;  4HKG A;  2OAR A;  2MR8 A;  4U0C A;  1KC8 Q;  2KOP A;  4WYM A;  2MR7 A;  3G21 A;  3WBH A;  3DS1 A;  1GWP A;  1YI2 P;  1VKU A;  1VQ5 P;  2FVE A;  1Q81 Q;  1YJN P;  2WLV B;  1KD1 Q;  2EG5 A;  3H47 A;  2FQ2 A;  3G71 P;  1VQ8 P;  2VLN A;  3CXC O;  3DS3 A;  2XZ1 C;  2QEX P;  1VQK P;  1A8O A;  1Q86 Q;  1AYI A;  1YJ9 P;  5EW5 E;  3BP9 A;  2JB0 A;  1T8K A;  2FAE A;  3G0V A;  2GDW A;  2PEN A;  3CCS P;  1QVF O;  2M8N A;  2PEJ A;  3U43 A;  1A43 A;  1DV5 A;  1IUQ A;  3M1M A;  1NJI Q;  1AUM A;  3DTJ A;  3B5I A;  2PXR C;  1VQM P;  1EIA A;  7CEI A;  2Z45 A;  2L22 A;  1CEI A;  2CGQ A;  2FQ0 A;  1ZNV A;  1L0H A;  4DG9 A;  2M8L A;  1L0I A;  3HYB A;  2EHS A;  2KOS A;  1UNK A;  1M9E C;  4XRO A;  1G03 A;  2FAC A;  1S72 P;  4DGE C;  3DS0 A;  1GXH A;  2MVU A;  4PH0 A;  2KOO A;  3CCE P;  4M0I A;  2GZJ A;  4R0M A;  2GOL B;  4H2Y C;  2FAD A;  1AK4 C;  1YIT P;  1K8A Q;  3MGE A;  4PH1 A;  2KG9 A;  1OR5 A;  2OTL P;  5I4T G;  2JQ4 A;  5F2K A;  1N8R Q;  2N6Y A;  3G29 A;  1GPJ A;  3G1I A;  3CCJ P;  3DS2 A;  2XGV A;  3CC7 P;  2KG8 A;  3GZL A;  2VLP A;  2LKI A;  1AFV A;  5CZD B;  2JBG A;  2GYK A;  2L9F A;  2K0X A;  1EM9 A;  4XFZ A;  5F2N A;  4HTW A;  1EMV A;  5HGN A;  5F2O A;  2JGP A;  2KG6 A;  1VQP P;  5KP6 B;  2PEK A;  1VQL P;  2GON A;  2M8P A;  2AFE A;  2PNG A;  2XZ0 D;  1M9F C;  3G28 A;  3G4S P;  1RNI A;  4UHP B;  2LL8 A;  2LIW A;  3CCR P;  2V4X A;  2KOR A;  2PY8 A;  3G6E P;  3CD6 P;  1QVG O;  2XGY A;  4F37 A;  1IMQ A;  2LF4 A;  5JPA A;  3DPH A;  4U0A A;  1JJ2 O;  2ROQ A;  5HGM A;  4NEO A;  1FR2 A;  2KOQ A;  2K5X A;  4PXH B;  2KR5 A;  4U0F A;  4B4N A;  2PWM A;  1M9X C;  2BHV A;  1KLP A;  4E91 A;  1VQ4 P;  3LMO A;  2P9X A;  1U7K A;  4LQW C;  2GZE A;  1ACP A;  1MZ8 A;  1VHN A;  2XV6 A;  3CCQ P;  2L4B A;  1BAJ A;  2N98 A;  4U0B A;  2KGD A;  2VLO A;  3DS4 A;  2Z44 A;  2JO0 A;  2WLV A;  3HZQ A;  4NX4 C;  4IZ6 A;  2XGU A;  3NTE A;  2AFD A;  1L6N A;  2LTE A;  1VQ7 P;  1W2B O;  3EJD A;  2KWL A;  3H0D A;  5HGO A;  1AF8 A;  2KGA A;  2PEM A;  2QNW A;  1DNY A;  2XXM A;  4GR2 A;  5KP7 B;  4PWV B;  5DCK A;  3CCM P;  3H4E A;  1VQ6 P;  2BUO A;  3LRY A;  2LML A;  4BPF A;  2K94 A;  2X83 A;  2FVA A;  1K30 A;  2LPK A;  4QNB A;  2LOL A;  3GKL C;  4COP A;  1BXI A;  3I55 P;  4J93 A;  4E92 A;  2LIU A;  4MRT C;  4QKO A;  2K0D X;  1NQ4 A;  1VQ9 P;  1GXG A;  2MD9 A;  2DNW A;  2N5I A;  2EIA A; 
#chains in the Genus database with same CATH homology
 1M9C C;  1VQM P;  3CME P;  1EIA A;  2PEI A;  1RO2 A;  2Z45 A;  4PH3 A;  2LF4 A;  4GR6 A;  5BS1 A;  5JPA A;  3DPH A;  1M6N A;  2M8L A;  4U0A A;  2E1M A;  3HYB A;  3OW2 O;  1EOQ A;  2CWO A;  1K9M Q;  1JJ2 O;  3CCV P;  5HGM A;  3P05 A;  1M9E C;  2DGY A;  3CC2 P;  4XRO A;  5HGL A;  5HGK A;  4INB A;  1G03 A;  2ONT A;  3CMA P;  4U0F A;  2OTJ P;  1S72 P;  4B4N A;  2PWM A;  1M9X C;  2BHV A;  4E91 A;  2XT1 A;  4DGE C;  3DS0 A;  3CPW O;  1VQ4 P;  2P9X A;  1U7K A;  1M90 Q;  4LQW C;  4U0E A;  1M74 A;  1YJW P;  4PH0 A;  3CCE P;  4M0I A;  3G1G A;  4XFY A;  2XV6 A;  1YHQ P;  3CCQ P;  2XDE A;  1BAJ A;  3VRL C;  4XFX A;  1VQN P;  2GOL B;  2JYL A;  2KGF A;  2L6E A;  3CCU P;  2X2D D;  4U0D A;  3RG6 C;  1AK4 C;  4U0B A;  1YIT P;  1VQO P;  1K8A Q;  3MGE A;  2PEO A;  2X82 A;  1M6E X;  4PH1 A;  4COC A;  5BS2 A;  2KOD A;  1Q82 Q;  2OAR A;  3DS4 A;  2OTL P;  5I4T G;  2Z44 A;  2JO0 A;  4U0C A;  2WLV A;  5F2K A;  3HZQ A;  1N8R Q;  4NX4 C;  1KC8 Q;  2XGU A;  3NTE A;  1D1D A;  3DS5 A;  4WYM A;  3E2D A;  1L6N A;  3G21 A;  3WBH A;  3G29 A;  3DS1 A;  1GWP A;  3G1I A;  3CCJ P;  1YI2 P;  1VQ5 P;  3DS2 A;  2XGV A;  1W2B O;  1Q81 Q;  1VQ7 P;  3CC7 P;  3H0D A;  2WLV B;  2JYG A;  1YJN P;  4PH2 A;  5HGO A;  2EG5 A;  1KD1 Q;  3H47 A;  2PEM A;  3G71 P;  1AFV A;  2PWO A;  4XRQ A;  2PEQ A;  1VQ8 P;  2XXM A;  4GR2 A;  3CXC O;  3G26 A;  1EM9 A;  3DS3 A;  1M9Y C;  3Q20 A;  2QEX P;  4XFZ A;  1VQK P;  5F2N A;  4HTW A;  1A8O A;  5DCK A;  3CCM P;  2JPR A;  3H4E A;  1KQS O;  1VQ6 P;  2BUO A;  3LRY A;  1Q86 Q;  1YJ9 P;  5HGN A;  5F2O A;  1M9D C;  3I56 P;  1M1K Q;  2X83 A;  2EIA A;  3BP9 A;  1K30 A;  2Z46 A;  1K73 Q;  4QNB A;  1VQP P;  3G0V A;  2QA4 P;  2PEN A;  1ZMB A;  3CC4 P;  1P7N A;  4COP A;  3CCS P;  1E6J P;  2PEK A;  1VQL P;  1QVF O;  2GON A;  2M8P A;  2M8N A;  1YIJ P;  1M9F C;  2PEJ A;  4J93 A;  3G28 A;  1QRJ A;  4E92 A;  3I55 P;  3G4S P;  1RNI A;  1A43 A;  1IUQ A;  2EFJ A;  3M1M A;  1RO0 A;  3CCR P;  2V4X A;  4IPY A;  3CCL P;  2PY8 A;  1VQ9 P;  1NJI Q;  1Q7Y Q;  3G6E P;  3CD6 P;  1AUM A;  2Y4Z A;  3DTJ A;  1QVG O;  4DGA C;  3B5I A;  2XGY A;  2PXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...