2M8PA

The structure of the w184am185a mutant of the hiv-1 capsid protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
221
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of Full-Length HIV-1 Capsid Protein in Solution.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 63
structure length 221
sequence length 221
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2m8pA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2m8pA02
1M9XC 4B4NA 4DGEC 1M9CC 2XV6A 2PWMA 2V4XA 2JO0A 2M8LA 4U0EA 4E91A 1G03A 3G29A 2WLVB 5HGKA 2KODA 2JYLA 3G0VA 3DTJA 4U0CA 3DS2A 2PWOA 2L6EA 2X83A 1A43A 4DGAC 4COPA 5HGLA 2ONTA 3H47A 1EM9A 4E92A 5JPAA 3DS0A 4U0FA 2WLVA 2M8NA 2XGVA 5HGMA 3G1IA 1M9DC 1GWPA 2M8PA 3G1GA 1EIAA 2XDEA 1A8OA 3G28A 2JYGA 3DPHA 4XFZA 4IPYA 4XFYA 3BP9A 4NX4C 1EOQA 3NTEA 5HGOA 3H4EA 1QRJA 4PH1A 1U7KA 3DS4A 3LRYA 4XROA 1AUMA 2XGUA 2LF4A 4HTWA 2XGYA 1P7NA 4PH3A 2EIAA 4XRQA 1D1DA 2GOLB 2JPRA 5HGNA 4M0IA 2PXRC 2Y4ZA 2X82A 1BAJA 3G26A 1M9EC 4PH2A 3G21A 3DS3A 3VRLC 2XT1A 4XFXA 5I4TG 3DS5A 2X2DD 1AK4C 2KGFA 1E6JP 4COCA 1L6NA 2XXMA 4WYMA 4QNBA 4U0DA 3MGEA 1M9FC 3P05A 4U0AA 2GONA 4J93A 1M9YC 4INBA 4LQWC 3DS1A 4U0BA 1AFVA 2BUOA 4PH0A 5DCKA
chains in the Genus database with same CATH superfamily
1HQBA 3CCSP 1Q81Q 3EJBA 4QKOA 2XV6A 2PWMA 1G03A 3G29A 2JGPA 2KODA 1QVFO 4DG9A 1L0IA 4COPA 2JU1A 5BS2A 5HGLA 2EHSA 3H47A 1CEIA 2KGEA 1DV5A 1EM9A 4H2YC 1M90Q 3B5IA 1JJ2O 3GJNA 2WLVA 1K73Q 1YI2P 2M8PA 3G1GA 1VQKP 1L0HA 3CCVP 2X2BA 4XFYA 1M6EX 5HGOA 3OW2O 3LRYA 2K93A 1QVGO 4HTWA 1Q86Q 1ZMBA 2KOSA 3CCQP 2EIAA 2K94A 2N5IA 2PENA 4F37A 2GDWA 2JPRA 2EHTA 5HGNA 2GYKA 2LKIA 2KG8A 2XZ1C 2X82A 1M6NA 1M9EC 1VQ8P 2OTLP 2XT1A 4XFXA 2GZJA 2ROQA 3GZLA 2KGFA 2JBGA 1VQ9P 1L6NA 2PEOA 5HVCA 2MF4A 1VQMP 3RG2A 4LQWC 2CNRA 2KGCA 1VQ4P 2PNGA 1VQ5P 2N6ZA 2EG5A 1AFVA 2BUOA 2Z45A 1RO0A 5DCKA 1IMQA 3CCEP 3G6EP 1YJ9P 2QNWA 4B4NA 4DGEC 1M9CC 3I55P 2JO0A 2FVEA 2WLVB 2PEIA 3DS2A 2AF8A 4DGAC 2K0DX 1DNYA 1AYIA 2GZIA 2ONTA 2GDYA 2CGQA 2CG5B 1OR5A 2PEJA 1KQSO 5KP7B 2Z44A 5HGMA 2FHSC 1GWPA 2XDEA 1A8OA 3NY7B 2DNWA 3G4SP 4BPHA 3G28A 1NJIQ 2VLQA 5F2OA 1T8KA 4XFZA 3CCRP 4IPYA 3BP9A 2QEXP 1YJWP 3CC7P 3H4EA 2P9XA 2KWLA 1U7KA 2ERHA 3DS4A 5EJDA 1AUMA 3U43A 1VQOP 2AFDA 1P7NA 4PH3A 3CD6P 2K5XA 1D1DA 3EJEA 2Y4ZA 2FAEA 2L22A 4PH2A 3DS3A 3E2DA 4MRTC 4CA3A 2MR7A 5I4TG 2N50A 3DS5A 5F2NA 1S72P 1FR2A 1K30A 1YIJP 2LTEA 1VQPP 2MR8A 4COCA 1BXIA 2MY5A 2N6YA 2XXMA 3B4QA 2NO8A 2FQ2A 4QNBA 4U0DA 3H0DA 3CCMP 2GONA 4J93A 4PWVB 3Q20A 2K2QA 4INBA 2KGDA 2KG6A 3CPWO 1HY8A 3GKLC 3CMAP 3CCLP 4U0BA 2GDXA 5KP6B 2PEKA 1M9XC 2M5RA 1MZ8A 1Z6MA 2V4XA 5EW5E 5HGKA 1YHQP 2OARA 1M74A 2JYLA 2L6EA 4BPFA 1A43A 2LPKA 3DS0A 7CEIA 2XGVA 3G1IA 1M9DC 1AF8A 4GR2A 1W2BO 1VHNA 4R0MA 2FVAA 2JYGA 2K0YA 2JB0A 2GZGA 1EOQA 3NTEA 3CCJP 1VQLP 3HYBA 4PXHB 2CWOA 1QRJA 3HZQA 2L9FA 3I56P 2LF4A 2XGYA 1N8RQ 2Z46A 4XRQA 2OTJP 1KC8Q 2JAZA 1YITP 3EJDA 2FVFA 2LIUA 3CCUP 2DGYA 3M1MA 1UNKA 1BAJA 1RO2A 3G26A 1VKUA 1X3OA 3G21A 3VRLC 2LMLA 4GR6A 2LIWA 1GPJA 1AK4C 4NEOA 2MD9A 2KOOA 3MGEA 1M9FC 2KG9A 4BPGA 1M9YC 1IUQA 4H2WC 4HKGA 2MVVA 4IZ6A 3GZMA 5KP8B 1YJNP 2E1MA 2PEMA 1K8AQ 1GXHA 1KD1Q 1VQ6P 4PH0A 1NQ4A 5BS1A 2M8LA 2LOLA 4U0EA 4E91A 1E0HA 1Q7YQ 1GXGA 3G0VA 3DTJA 4U0CA 2PWOA 2X83A 2CQ8A 1ACPA 2AVAA 1IMPA 3CE7A 2FQ1A 3CC2P 2N98A 2PY8A 4E92A 5JPAA 2BHVA 4U0FA 3LMOA 5CZDB 2M8NA 1EIAA 1VQ7P 2JU2A 4UHPB 2MVUA 2WPTA 1UJZA 3DPHA 2VSQA 2N5HA 2VLPA 4NX4C 2GZEA 4H2XC 1F80D 4PH1A 2FADA 4XROA 2XGUA 3G71P 2GZFA 1EMVA 5HV8A 2K92A 2GOLB 2PEQA 4M0IA 2KGAA 2PXRC 1RNIA 2FQ0A 2L4BA 5F2KA 1VQNP 2KR5A 2VLNA 2JQ4A 2KOPA 2KW2A 3CMEP 2L0QA 2KOQA 2X2DD 1E6JP 1Q82Q 1K9MQ 3CC4P 2QA4P 4WYMA 3P05A 4U0AA 2EFJA 3CXCO 1KLPA 3RG6C 3DS1A 2XZ0D 1ZNVA 1M1KQ 2KORA 2K0XA 2VLOA 3WBHA 2LL8A 2FACA 2AFEA
chains in the Genus database with same CATH topology
2PEKA 1M9XC 3CCSP 1YJ9P 1Q81Q 4B4NA 4DGEC 1M9CC 5BS1A 2XV6A 3I55P 2PWMA 2V4XA 2JO0A 2M8LA 4U0EA 4E91A 1G03A 3G29A 2WLVB 1Q7YQ 1YHQP 5HGKA 2KODA 2OARA 1M74A 2JYLA 2PEIA 3DTJA 3G0VA 4U0CA 3DS2A 2PWOA 1QVFO 2L6EA 2X83A 1A43A 4DGAC 4COPA 5BS2A 5HGLA 2ONTA 3H47A 1EM9A 3CC2P 2PY8A 2PEJA 4E92A 5JPAA 3B5IA 3DS0A 1M90Q 1KQSO 2Z44A 2BHVA 1JJ2O 4U0FA 2WLVA 1K73Q 2M8NA 1YI2P 2XGVA 5HGMA 3G1IA 1M9DC 1GWPA 2M8PA 3G1GA 4GR2A 1VQKP 1EIAA 1W2BO 2XDEA 1A8OA 1VQ7P 3G4SP 3G28A 1NJIQ 2JYGA 5F2OA 3DPHA 4XFZA 3CCVP 3CCRP 4IPYA 4XFYA 3BP9A 4NX4C 1EOQA 3NTEA 1M6EX 2QEXP 3HYBA 5HGOA 3CCJP 1VQLP 3OW2O 1YJWP 3CC7P 3H4EA 2P9XA 2CWOA 1QRJA 3HZQA 1U7KA 4PH1A 3DS4A 3LRYA 4XROA 1AUMA 1QVGO 2XGUA 3I56P 1VQOP 3G71P 2LF4A 4HTWA 1Q86Q 2XGYA 1ZMBA 1N8RQ 1P7NA 4PH3A 3CCQP 3CD6P 2EIAA 2Z46A 4XRQA 2OTJP 1KC8Q 1D1DA 2PENA 1YITP 2GOLB 2JPRA 2PEQA 5HGNA 4M0IA 3CCUP 2DGYA 3M1MA 2PXRC 1RNIA 2Y4ZA 2X82A 1BAJA 1RO2A 1M6NA 3G26A 1M9EC 4PH2A 3G21A 3DS3A 1VQ8P 5F2KA 3VRLC 3E2DA 1VQNP 2OTLP 2XT1A 4XFXA 4GR6A 5I4TG 3DS5A 5F2NA 3CMEP 1S72P 1K30A 1YIJP 2X2DD 1AK4C 1VQPP 2KGFA 1E6JP 1Q82Q 4COCA 1K9MQ 1VQ9P 3CC4P 1L6NA 2XXMA 2PEOA 2QA4P 4WYMA 4QNBA 4U0DA 3MGEA 1M9FC 3P05A 4U0AA 2EFJA 3H0DA 3CCMP 2GONA 4J93A 1M9YC 1VQMP 3Q20A 3CXCO 1IUQA 4INBA 4LQWC 3RG6C 3DS1A 1VQ4P 1YJNP 3CPWO 2E1MA 3CMAP 1M1KQ 2PEMA 1VQ5P 1K8AQ 4U0BA 3CCEP 3CCLP 1KD1Q 2EG5A 1AFVA 3WBHA 1VQ6P 2BUOA 2Z45A 4PH0A 1RO0A 5DCKA 3G6EP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9X C;  4B4N A;  4DGE C;  1M9C C;  2XV6 A;  2PWM A;  2V4X A;  2JO0 A;  2M8L A;  4U0E A;  4E91 A;  1G03 A;  3G29 A;  2WLV B;  5HGK A;  2KOD A;  2JYL A;  3G0V A;  3DTJ A;  4U0C A;  3DS2 A;  2PWO A;  2L6E A;  2X83 A;  1A43 A;  4DGA C;  4COP A;  5HGL A;  2ONT A;  3H47 A;  1EM9 A;  4E92 A;  5JPA A;  3DS0 A;  4U0F A;  2WLV A;  2M8N A;  2XGV A;  5HGM A;  3G1I A;  1M9D C;  1GWP A;  2M8P A;  3G1G A;  1EIA A;  2XDE A;  1A8O A;  3G28 A;  2JYG A;  3DPH A;  4XFZ A;  4IPY A;  4XFY A;  3BP9 A;  4NX4 C;  1EOQ A;  3NTE A;  5HGO A;  3H4E A;  1QRJ A;  4PH1 A;  1U7K A;  3DS4 A;  3LRY A;  4XRO A;  1AUM A;  2XGU A;  2LF4 A;  4HTW A;  2XGY A;  1P7N A;  4PH3 A;  2EIA A;  4XRQ A;  1D1D A;  2GOL B;  2JPR A;  5HGN A;  4M0I A;  2PXR C;  2Y4Z A;  2X82 A;  1BAJ A;  3G26 A;  1M9E C;  4PH2 A;  3G21 A;  3DS3 A;  3VRL C;  2XT1 A;  4XFX A;  5I4T G;  3DS5 A;  2X2D D;  1AK4 C;  2KGF A;  1E6J P;  4COC A;  1L6N A;  2XXM A;  4WYM A;  4QNB A;  4U0D A;  3MGE A;  1M9F C;  3P05 A;  4U0A A;  2GON A;  4J93 A;  1M9Y C;  4INB A;  4LQW C;  3DS1 A;  4U0B A;  1AFV A;  2BUO A;  4PH0 A;  5DCK A; 
#chains in the Genus database with same CATH topology
 1HQB A;  3CCS P;  1Q81 Q;  3EJB A;  4QKO A;  2XV6 A;  2PWM A;  1G03 A;  3G29 A;  2JGP A;  2KOD A;  1QVF O;  4DG9 A;  1L0I A;  4COP A;  2JU1 A;  5BS2 A;  5HGL A;  2EHS A;  3H47 A;  1CEI A;  2KGE A;  1DV5 A;  1EM9 A;  4H2Y C;  1M90 Q;  3B5I A;  1JJ2 O;  3GJN A;  2WLV A;  1K73 Q;  1YI2 P;  2M8P A;  3G1G A;  1VQK P;  1L0H A;  3CCV P;  2X2B A;  4XFY A;  1M6E X;  5HGO A;  3OW2 O;  3LRY A;  2K93 A;  1QVG O;  4HTW A;  1Q86 Q;  1ZMB A;  2KOS A;  3CCQ P;  2EIA A;  2K94 A;  2N5I A;  2PEN A;  4F37 A;  2GDW A;  2JPR A;  2EHT A;  5HGN A;  2GYK A;  2LKI A;  2KG8 A;  2XZ1 C;  2X82 A;  1M6N A;  1M9E C;  1VQ8 P;  2OTL P;  2XT1 A;  4XFX A;  2GZJ A;  2ROQ A;  3GZL A;  2KGF A;  2JBG A;  1VQ9 P;  1L6N A;  2PEO A;  5HVC A;  2MF4 A;  1VQM P;  3RG2 A;  4LQW C;  2CNR A;  2KGC A;  1VQ4 P;  2PNG A;  1VQ5 P;  2N6Z A;  2EG5 A;  1AFV A;  2BUO A;  2Z45 A;  1RO0 A;  5DCK A;  1IMQ A;  3CCE P;  3G6E P;  1YJ9 P;  2QNW A;  4B4N A;  4DGE C;  1M9C C;  3I55 P;  2JO0 A;  2FVE A;  2WLV B;  2PEI A;  3DS2 A;  2AF8 A;  4DGA C;  2K0D X;  1DNY A;  1AYI A;  2GZI A;  2ONT A;  2GDY A;  2CGQ A;  2CG5 B;  1OR5 A;  2PEJ A;  1KQS O;  5KP7 B;  2Z44 A;  5HGM A;  2FHS C;  1GWP A;  2XDE A;  1A8O A;  3NY7 B;  2DNW A;  3G4S P;  4BPH A;  3G28 A;  1NJI Q;  2VLQ A;  5F2O A;  1T8K A;  4XFZ A;  3CCR P;  4IPY A;  3BP9 A;  2QEX P;  1YJW P;  3CC7 P;  3H4E A;  2P9X A;  2KWL A;  1U7K A;  2ERH A;  3DS4 A;  5EJD A;  1AUM A;  3U43 A;  1VQO P;  2AFD A;  1P7N A;  4PH3 A;  3CD6 P;  2K5X A;  1D1D A;  3EJE A;  2Y4Z A;  2FAE A;  2L22 A;  4PH2 A;  3DS3 A;  3E2D A;  4MRT C;  4CA3 A;  2MR7 A;  5I4T G;  2N50 A;  3DS5 A;  5F2N A;  1S72 P;  1FR2 A;  1K30 A;  1YIJ P;  2LTE A;  1VQP P;  2MR8 A;  4COC A;  1BXI A;  2MY5 A;  2N6Y A;  2XXM A;  3B4Q A;  2NO8 A;  2FQ2 A;  4QNB A;  4U0D A;  3H0D A;  3CCM P;  2GON A;  4J93 A;  4PWV B;  3Q20 A;  2K2Q A;  4INB A;  2KGD A;  2KG6 A;  3CPW O;  1HY8 A;  3GKL C;  3CMA P;  3CCL P;  4U0B A;  2GDX A;  5KP6 B;  2PEK A;  1M9X C;  2M5R A;  1MZ8 A;  1Z6M A;  2V4X A;  5EW5 E;  5HGK A;  1YHQ P;  2OAR A;  1M74 A;  2JYL A;  2L6E A;  4BPF A;  1A43 A;  2LPK A;  3DS0 A;  7CEI A;  2XGV A;  3G1I A;  1M9D C;  1AF8 A;  4GR2 A;  1W2B O;  1VHN A;  4R0M A;  2FVA A;  2JYG A;  2K0Y A;  2JB0 A;  2GZG A;  1EOQ A;  3NTE A;  3CCJ P;  1VQL P;  3HYB A;  4PXH B;  2CWO A;  1QRJ A;  3HZQ A;  2L9F A;  3I56 P;  2LF4 A;  2XGY A;  1N8R Q;  2Z46 A;  4XRQ A;  2OTJ P;  1KC8 Q;  2JAZ A;  1YIT P;  3EJD A;  2FVF A;  2LIU A;  3CCU P;  2DGY A;  3M1M A;  1UNK A;  1BAJ A;  1RO2 A;  3G26 A;  1VKU A;  1X3O A;  3G21 A;  3VRL C;  2LML A;  4GR6 A;  2LIW A;  1GPJ A;  1AK4 C;  4NEO A;  2MD9 A;  2KOO A;  3MGE A;  1M9F C;  2KG9 A;  4BPG A;  1M9Y C;  1IUQ A;  4H2W C;  4HKG A;  2MVV A;  4IZ6 A;  3GZM A;  5KP8 B;  1YJN P;  2E1M A;  2PEM A;  1K8A Q;  1GXH A;  1KD1 Q;  1VQ6 P;  4PH0 A;  1NQ4 A;  5BS1 A;  2M8L A;  2LOL A;  4U0E A;  4E91 A;  1E0H A;  1Q7Y Q;  1GXG A;  3G0V A;  3DTJ A;  4U0C A;  2PWO A;  2X83 A;  2CQ8 A;  1ACP A;  2AVA A;  1IMP A;  3CE7 A;  2FQ1 A;  3CC2 P;  2N98 A;  2PY8 A;  4E92 A;  5JPA A;  2BHV A;  4U0F A;  3LMO A;  5CZD B;  2M8N A;  1EIA A;  1VQ7 P;  2JU2 A;  4UHP B;  2MVU A;  2WPT A;  1UJZ A;  3DPH A;  2VSQ A;  2N5H A;  2VLP A;  4NX4 C;  2GZE A;  4H2X C;  1F80 D;  4PH1 A;  2FAD A;  4XRO A;  2XGU A;  3G71 P;  2GZF A;  1EMV A;  5HV8 A;  2K92 A;  2GOL B;  2PEQ A;  4M0I A;  2KGA A;  2PXR C;  1RNI A;  2FQ0 A;  2L4B A;  5F2K A;  1VQN P;  2KR5 A;  2VLN A;  2JQ4 A;  2KOP A;  2KW2 A;  3CME P;  2L0Q A;  2KOQ A;  2X2D D;  1E6J P;  1Q82 Q;  1K9M Q;  3CC4 P;  2QA4 P;  4WYM A;  3P05 A;  4U0A A;  2EFJ A;  3CXC O;  1KLP A;  3RG6 C;  3DS1 A;  2XZ0 D;  1ZNV A;  1M1K Q;  2KOR A;  2K0X A;  2VLO A;  3WBH A;  2LL8 A;  2FAC A;  2AFE A; 
#chains in the Genus database with same CATH homology
 2PEK A;  1M9X C;  3CCS P;  1YJ9 P;  1Q81 Q;  4B4N A;  4DGE C;  1M9C C;  5BS1 A;  2XV6 A;  3I55 P;  2PWM A;  2V4X A;  2JO0 A;  2M8L A;  4U0E A;  4E91 A;  1G03 A;  3G29 A;  2WLV B;  1Q7Y Q;  1YHQ P;  5HGK A;  2KOD A;  2OAR A;  1M74 A;  2JYL A;  2PEI A;  3DTJ A;  3G0V A;  4U0C A;  3DS2 A;  2PWO A;  1QVF O;  2L6E A;  2X83 A;  1A43 A;  4DGA C;  4COP A;  5BS2 A;  5HGL A;  2ONT A;  3H47 A;  1EM9 A;  3CC2 P;  2PY8 A;  2PEJ A;  4E92 A;  5JPA A;  3B5I A;  3DS0 A;  1M90 Q;  1KQS O;  2Z44 A;  2BHV A;  1JJ2 O;  4U0F A;  2WLV A;  1K73 Q;  2M8N A;  1YI2 P;  2XGV A;  5HGM A;  3G1I A;  1M9D C;  1GWP A;  2M8P A;  3G1G A;  4GR2 A;  1VQK P;  1EIA A;  1W2B O;  2XDE A;  1A8O A;  1VQ7 P;  3G4S P;  3G28 A;  1NJI Q;  2JYG A;  5F2O A;  3DPH A;  4XFZ A;  3CCV P;  3CCR P;  4IPY A;  4XFY A;  3BP9 A;  4NX4 C;  1EOQ A;  3NTE A;  1M6E X;  2QEX P;  3HYB A;  5HGO A;  3CCJ P;  1VQL P;  3OW2 O;  1YJW P;  3CC7 P;  3H4E A;  2P9X A;  2CWO A;  1QRJ A;  3HZQ A;  1U7K A;  4PH1 A;  3DS4 A;  3LRY A;  4XRO A;  1AUM A;  1QVG O;  2XGU A;  3I56 P;  1VQO P;  3G71 P;  2LF4 A;  4HTW A;  1Q86 Q;  2XGY A;  1ZMB A;  1N8R Q;  1P7N A;  4PH3 A;  3CCQ P;  3CD6 P;  2EIA A;  2Z46 A;  4XRQ A;  2OTJ P;  1KC8 Q;  1D1D A;  2PEN A;  1YIT P;  2GOL B;  2JPR A;  2PEQ A;  5HGN A;  4M0I A;  3CCU P;  2DGY A;  3M1M A;  2PXR C;  1RNI A;  2Y4Z A;  2X82 A;  1BAJ A;  1RO2 A;  1M6N A;  3G26 A;  1M9E C;  4PH2 A;  3G21 A;  3DS3 A;  1VQ8 P;  5F2K A;  3VRL C;  3E2D A;  1VQN P;  2OTL P;  2XT1 A;  4XFX A;  4GR6 A;  5I4T G;  3DS5 A;  5F2N A;  3CME P;  1S72 P;  1K30 A;  1YIJ P;  2X2D D;  1AK4 C;  1VQP P;  2KGF A;  1E6J P;  1Q82 Q;  4COC A;  1K9M Q;  1VQ9 P;  3CC4 P;  1L6N A;  2XXM A;  2PEO A;  2QA4 P;  4WYM A;  4QNB A;  4U0D A;  3MGE A;  1M9F C;  3P05 A;  4U0A A;  2EFJ A;  3H0D A;  3CCM P;  2GON A;  4J93 A;  1M9Y C;  1VQM P;  3Q20 A;  3CXC O;  1IUQ A;  4INB A;  4LQW C;  3RG6 C;  3DS1 A;  1VQ4 P;  1YJN P;  3CPW O;  2E1M A;  3CMA P;  1M1K Q;  2PEM A;  1VQ5 P;  1K8A Q;  4U0B A;  3CCE P;  3CCL P;  1KD1 Q;  2EG5 A;  1AFV A;  3WBH A;  1VQ6 P;  2BUO A;  2Z45 A;  4PH0 A;  1RO0 A;  5DCK A;  3G6E P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...