2M96A

Solution nmr structure of the rxfp2 ldla module
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
GSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the RXFP2 LDLa module
rcsb
molecule keywords Relaxin receptor 2
molecule tags Membrane protein
source organism Homo sapiens
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2m96A00
1CR8A 1N7DA 1XFEA 2I1PA 2KNXA 1JRFA 2M0PA 2LGPA 1J8EA 1F5YA 1LDLA 1LDRA 2FCWB 2FYJA 2M7PA 1K7BA 2JM4A 2KNYA 1D2JA 2FYLB 2M96A 1D2LA
chains in the Genus database with same CATH superfamily
1CR8A 1N7DA 1XFEA 2I1PA 2KNXA 1JRFA 2M0PA 2LGPA 1J8EA 1F5YA 1LDLA 1LDRA 2FCWB 2FYJA 2M7PA 1K7BA 2JM4A 2KNYA 1D2JA 2FYLB 2M96A 1D2LA
chains in the Genus database with same CATH topology
1CR8A 1N7DA 1XFEA 2I1PA 2KNXA 1JRFA 2M0PA 2LGPA 1J8EA 1F5YA 1LDLA 1LDRA 2FCWB 2FYJA 2M7PA 1K7BA 2JM4A 2KNYA 1D2JA 2FYLB 2M96A 1D2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CR8 A;  1N7D A;  1XFE A;  2I1P A;  2KNX A;  1JRF A;  2M0P A;  2LGP A;  1J8E A;  1F5Y A;  1LDL A;  1LDR A;  2FCW B;  2FYJ A;  2M7P A;  1K7B A;  2JM4 A;  2KNY A;  1D2J A;  2FYL B;  2M96 A;  1D2L A; 
#chains in the Genus database with same CATH topology
 1CR8 A;  1N7D A;  1XFE A;  2I1P A;  2KNX A;  1JRF A;  2M0P A;  2LGP A;  1J8E A;  1F5Y A;  1LDL A;  1LDR A;  2FCW B;  2FYJ A;  2M7P A;  1K7B A;  2JM4 A;  2KNY A;  1D2J A;  2FYL B;  2M96 A;  1D2L A; 
#chains in the Genus database with same CATH homology
 1CR8 A;  1N7D A;  1XFE A;  2I1P A;  2KNX A;  1JRF A;  2M0P A;  2LGP A;  1J8E A;  1F5Y A;  1LDL A;  1LDR A;  2FCW B;  2FYJ A;  2M7P A;  1K7B A;  2JM4 A;  2KNY A;  1D2J A;  2FYL B;  2M96 A;  1D2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...