2M9UA

Solution nmr structure of the c-terminal domain (ctd) of moloney murine leukemia virus integrase, northeast structural genomics target or41a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
b'HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase p46
molecule tags Viral protein
source organism Moloney murine leukemia virus isolate shinnick
publication title Altering murine leukemia virus integration through disruption of the integrase and BET protein family interaction.
pubmed doi rcsb
total genus 14
structure length 89
sequence length 89
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.850 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2m9uA00
2M9UA
chains in the Genus database with same CATH superfamily
1N9RA 1QQJA 2X4XA 3OS5A 5J39A 4FL6A 5FU6C 5KYXB 5GAOn 3OYJA 1MMNA 4KULA 1Q7YU 2QI2A 3JB9F 1KQSA 3HFOA 1VQ4A 3PFSA 5A0GA 3FIFA 3RESA 3EGDB 4PFOA 3CD6Q 1NZ9A 2E70A 2EKOA 2J06A 3H0HA 2ATCB 1Q7YC 1ZA2B 1H641 3CPWS 4Y91A 1OZ2A 1IXDA 2QGFB 3L2VA 2NUPA 2L8DA 4RCBA 2A28A 8AT1B 3PT9A 1D1AA 3VYHB 1M3CA 3CMET 1M2VA 2QTXA 2EQJA 2F5TX 1AWWA 2KRSA 2RHUA 4FW1A 5GMKe 2YUNA 5CAIA 1IGUA 3L2WA 1ZSZC 4EMKB 2QAZA 2O88A 2X4YA 2LP5A 2YUQA 3JRZA 1LCKA 1TTHB 4AG2C 3OYNA 4F16A 5KYWB 1VQ9Q 1KHIA 2CREA 3OYDA 3CCQQ 4BI4A 1JU5C 1F1BB 4Y92A 1BB9A 2R5MA 1JXOA 1Q82C 2J6OA 2KNBB 3V8KA 2FHDA 2E5QA 3MEAA 1MUZA 1X27A 5I22A 5IT9E 1I5LA 2VVKA 2DXCA 4AMCA 2A36A 4M7AB 5IH2A 1I5OB 4M75E 1KD1C 4M7DA 4QVZA 4M7DE 5KYUA 3DB4A 4KRTA 3CC7T 2E41A 3P8DA 2BE9B 1D3BB 5D7UA 2QK0A 1WHJA 2LQWA 3ME9A 1EFNA 1PNJA 2SEMA 1VQMA 2KSSA 4M78E 1QP3A 1WQ7A 2KROA 4L6V5 4XTYA 1GBQA 1K73R 2VUBA 2DL4A 2ABLA 1ABQA 1UHFA 4Z89A 3PIPA 1LJOA 1WHLA 1QKWA 4FU6A 3C94A 1VOMA 4OB3B 4NS5A 3CC2Q 3ASKA 3S3MA 1VQMQ 1W4SA 2KGTA 1RLPC 1YJ9A 1PSEA 3UA7A 2LRQA 2VC8A 2DJZA 5L8RE 4FYXB 2KT8A 3OSSC 1BCMA 1M2OA 5GAMd 3RMQA 2DD5A 4RG2A 1HSQA 1WPYA 2RJDA 3JCMQ 2EQMA 3FRNA 4MMLA 1ZHIA 1YJWT 3HFNA 3ZL7C 4PFPA 1VQPA 1PG5B 3OW2P 5LJ5e 1WHKA 2GCXA 2HNIA 2VKNA 2EW3A 1IREB 2V26A 4M7DG 4M77D 2KXDA 4AFZC 3AT1B 2M16A 1UGSB 5LJ3g 5IAYA 4F7UB 4RCCA 1SF9A 1NPPA 1R0CB 3M0SA 1TUDA 5CKFA 1QVFP 2QA4T 2EJ9A 1UDLA 3CPWA 2DL8A 1W1FA 2CZ0B 3J81E 5CKEA 3RR6A 2HBWA 3PVLA 1X43A 2GTJA 1K9MR 2P0PA 4M7DF 4HCKA 4BE0A 1UG1A 3I56A 5EG2A 4KBMB 2DA9A 3EH1A 2E3IA 4QQGA 7AT1B 1UE9A 2LCCA 2LNHB 3M54A 1WX6A 2L3SA 4LDXA 2YRDA 4DQ2A 4WTOB 1YJWQ 3NPFA 3FB9A 3CCST 4UC4A 4X9CA 1JO8A 5GAMj 1YITA 1VQKQ 2ENMA 1VQ7Q 2HSEB 2GQVA 4C0ZA 4XQ3A 2FPEA 1HK9A 1IHWA 1AVZC 5KYUB 1MMDA 2QDLA 5LJ3h 4ESRA 3CCQA 3I5SA 2JXBA 4M75F 2DJQA 2FZCB 2FZGB 3EFSA 4BACA 1X6OA 3MCAB 5GAMh 3V7SA 3VS3A 4JZ4A 2X3WD 4C92A 2IG0A 3V8LA 5I11A 1YP5A 4ATOA 3EGXA 2X9HA 4J5YA 1R8OB 3M0PA 2BE7D 3VS4A 4JJNK 1PM3A 1RAEB 1JXMA 3HL8A 1M5Q1 5GAN5 4ORZA 4JRIA 4ZGJB 5CO7A 1WJRA 1IRXA 4XAXB 1K76A 1VQLT 2R5AA 4BD3A 4ZGEB 1NPRA 2CZ6B 1X75C 4E7LA 1AWXA 2CUBA 2J6FA 3QO3A 3JCMd 2YUOA 2NUPB 4PJNA 1VUBA 5DLOA 1TG0A 2LQ8A 1JJ2S 3MHXA 2LCSA 3CCEQ 1QVGS 2EQKA 2LNVA 4IUVA 1UEBA 2XU8A 4JRQA 1VQMT 3OW2A 3H8ZA 1VQOT 4LD9K 1WYXA 3EH2A 5CKDA 2KYBA 3EGXB 3NTHA 1YJNA 3LLRA 3CCRQ 3AHUA 2KVQG 4ZTJA 3SEMA 1QWFA 4LUEA 1TXQA 4AG1C 4JS4A 4J6YA 1X6BA 4JLIA 3OYMA 5FRMA 3EG9A 4PJOB 4WF2A 2YWWA 1U1TA 2CUDA 3VRYA 1Q82R 5I21A 2JT4A 1OV3A 1KC8R 1Q86U 3OSVA 3F70A 3NHNA 1VYVA 1EX4A 5HY6A 2FYKA 5GAOl 1JJ2A 4O6JA 1OPLA 2GBQA 2CH4W 4C5IA 2X4WA 1KG1A 2FRYA 4M75A 1XOVA 4TVRA 2MCNA 2ZPIB 2DPPB 4M78F 3X26B 1K1ZA 2ESWA 1WGSA 3INZA 1YI2T 4N4IA 4F17A 1M90R 2XIDA 2KBTA 5LL6S 3JSCA 1U5SA 2RQWA 3QBYA 1QP2A 3LYIA 1J3TA 2RK2A 4E6RA 2KR3A 5GAN8 2QQRA 5A2QE 3E2UA 1VYUA 3V8JA 1YHQA 1Z9QA 1KD1U 1Q81C 3CMAA 4P5NA 4C5EA 1RAGB 4M7AA 1RUWA 3R6OA 5GAN6 3GIBA 1VQKA 1WXUA 2K5FA 2KT1A 2RMOA 2L3QA 2BIVA 3CD6T 1BI2A 2EVRA 1JJ2P 2RJFA 3OQ5A 4B9XA 4A63B 1YWOA 3N5BB 1IB8A 1Q82U 5D6XA 5GANg 2JTMA 3HPWA 1PSFA 1VIFA 1LNXA 4C0DB 4HCCA 1ZX6A 1Q86C 4WCIA 3CMAQ 4RTZA 3SHWA 3CCJQ 1YIJQ 4MZMA 2LJ0A 4RTTA 3JCMb 3QJYA 1OX8A 4FSSA 4M77B 3OB9A 2GGRA 2X51A 1IGQA 3A8GB 3EFOA 2E10A 2RA2A 2K3YA 2L3PA 4V2SA 2X3XD 2L5QA 3RUXA 1YCSB 3CEYA 4N4GA 5CQXA 5GAMg 1QVFS 2DVJA 5I2SA 2OAUA 3CCRA 2CZ1B 2X4JA 1CKAA 2B86A 5GAOr 2LT4A 3MP1A 1VYTA 1QKXA 1QWEA 3CCMT 1K9AA 4OMFB 2DILA 3G6ET 1T3LA 4E2FB 1IZ6A 3J80E 4PLIA 2EFIA 1MV0B 4OMOA 3LWHA 4E47A 5C6SA 2ED1A 3UATA 4J9CA 2YLCA 5LJ5j 3LH0A 3UDCA 2QEXA 4M78G 2DRKA 3M9QA 1VQLA 2V8IA 3JCMc 4PL6A 4R0KA 5FWBA 1Y71A 3A8HB 4L59A 1RI9A 2GF7A 3C0CA 1BKBA 3MEVA 4ANJA 5D6WA 4JRPA 3JCMX 5LJ5d 4J83A 4ZGDB 2O9VA 2ED0A 3BY7A 2F5KA 1KSWA 4RTWA 3DLLA 2AKKA 3S3OA 1S72Q 3MP8A 2ZCFB 4MZTA 1SG5A 1D09B 3WVEB 4BB7A 3E19A 3HTRA 4Z8AA 4MDWA 2RK1A 1NLPC 5CQYA 3A8MB 3H6ZA 2VYTA 2DVEA 3CXCP 4QT7A 1VQ5Q 2HQXA 1M1KR 3OBWA 4FT2A 1VQ8T 5FWCA 4HT9A 2CS7A 1ZUUA 3NMZC 3PGGA 1G5VA 1YI2Q 4KH0B 2RHZA 4FYVB 2DK3A 5KE2A 1BCOA 1UGPB 2JS0A 2YXYA 2O4XB 3ZEHA 1RAHB 3ER0A 2F2VA 3M56A 4LDWA 3QDFA 4OGCA 2K79A 2OTLA 1O9SA 5HKCA 2EJFA 3LX7A 1AWOA 3EFRA 1HYOA 2DYBA 3CCUA 4LN2A 1VQ9T 2AZSA 3VYGA 3G4SQ 4F7UF 2C0IA 3BDLA 1QCOA 2R58A 3GBQA 1Q86R 2LDMA 4DBQA 2PTKA 1ZUYA 2J05A 1OOTA 2RM4A 3CPFA 4QVCA 2DXUA 2RHYA 2MYSA 4M4ZA 2K57A 3CBMA 2DYIA 2K2VA 1G3YA 4M7DB 2V1RA 1FMKA 1QMCA 1K0SA 4ZN3A 1M1KC 1B07A 1JRIA 2DETA 1Q81R 1H3HA 1NJIU 1VQ5T 5GANh 5GAN2 1NYFA 3EGUA 2ZGWA 1K9MC 3CCET 3JB9I 5CCAA 3SDZA 3TREA 2XMFA 1N8RR 3JB9G 2ZPBB 1VQOA 2NUTB 3L42A 2PZ1A 4RTUA 4AFUC 2ZPFB 1RI0A 1K8AU 3G1JA 4Z02A 1W2BS 3OS2A 2MWOA 3O8VA 5DY9A 1UJ0A 4JS5A 2DRMA 1B7TA 1OEBA 4HCBA 4JLGA 1CKBA 5DM7R 5GAN7 1PD1A 4FM4B 3G71A 3EG9B 4PJOA 1MGQA 2AK5A 5CVIA 5FU7B 2CKKA 3NTIA 1A0NB 2DO3A 5FROA 2W0ZA 3VUBA 4C8QG 3PE0A 4RKUE 4EMHA 2QTVA 2FZKB 4M7AF 4E7JA 2P4RA 3VS7A 1K8AC 2RD1A 2HD0A 2P0QA 2PNIA 4RUGA 2ECZA 4PLLA 1MNDA 5GAOp 4HT8A 2M9UA 2JTFA 2YRCA 2MMPA 1M1FA 1KC8U 4F14A 1SSFA 1TWBA 2MOXA 4IUUA 1KQ2A 4EIKA 3LH5A 3GPLA 2A7YA 2IIMA 3M55A 2DL3A 5KYWA 3SWNB 3SB2A 1Y0MA 1N5ZA 4C92C 4PJOD 1ABOA 3FLGA 5GMKi 4ELZC 2DF6A 2ZAEA 4PJJA 2HQEA 4BY6B 2EKHA 3QYGB 1ZBXA 2YRVA 1RAFB 3L2ZA 4B9WA 2EQIA 4YTLA 5IN1A 4XU1A 2YT6A 4OMMA 2E65A 1VQ5A 4EMGA 2VGMA 3CCMQ 2DIGA 2K7AA 4X9DA 4QQDA 2CP3A 2CP2A 2KEAA 1W6XA 4DBRA 3CCJA 3MP6A 1SHFA 3PIOA 4FIBA 2RHIA 2LX7A 5GAN3 1NJIR 1BIAA 2HMAA 1YI2A 4DOVA 4LNPA 2K2MA 1VQ6Q 4CI0C 4JUVA 2XK0A 1AZEA 1ZSZA 4F7UE 2DBMA 2NYSA 1G2BA 1GCQC 2FB7A 4EMKC 4R56A 1YIJT 2BZXA 1BYMA 3A1PA 3QPHA 3CBOA 3LWIA 1H92A 3QZ9B 2H3EB 4QVDA 1OX9A 2EAYA 1SPKA 2LJ3A 2WACA 1TUGB 4C5HA 3REBB 4EDUA 4CRIA 1OU9A 3VJPA 2A3LA 3FEOA 4A54A 5CR2A 3ZFJA 2C0OA 5L23A 2DFUA 4C8QC 4BUGA 3G71Q 1PC0A 4OVAA 6AT1B 4RG8A 1UGQB 1OYXA 3JCMV 1VQLQ 4XTWA 2YDLA 4QQ6A 1OPKA 2L3RA 2R57A 3JCMW 2K9GA 2PVGB 3UWNA 2CGHA 5GANe 4C8QE 3CCSQ 3EFOB 1K4US 4C8QF 4RTYA 1VQ8Q 3SWNA 1VQ4Q 3BDUA 1UGRB 1B34A 4PJLA 3I5RA 3OYEA 1B3QA 1NEBA 3A98A 4Z88A 4OMPA 5J3BA 1PKTA 2I0NA 4E7IA 1SEMA 3URGA 1BI3A 3H41A 3JCMf 2DLPA 3T9NA 1C6VX 5GAMe 4XK8E 4PJOC 5GMKj 4XTUA 1WLPB 5LJ5f 4XTXA 1NYGA 4C5GA 2BZYA 2XHCA 3V7CA 2QYZA 1Z9ZA 3META 4A4KA 4C92G 2GFAA 5IHKA 1VQ9A 2COZA 3JCMe 5GMKl 1NJIC 2FPFA 4JDSA 2K5LA 3CC4T 3S3NA 3G71T 2RQVA 3OYKA 5FLXE 1AHJB 1DJ7B 1WDXA 2RQUA 3NGPA 2BTTA 2H8HA 4M75C 2O01E 3CC7Q 4BE1A 2J7IA 1YNZA 1NBEB 4M7DC 3M4GA 3G6EQ 1KC8C 3C4SA 4PFZA 1ZQ1A 2FEIA 1HXDA 4CC2A 5FU7C 4OMLA 5GMKh 1GRIA 2KYMA 2JVVA 2YLBA 1R77A 2E6ZA 1JBMA 4NL3A 4KGVB 4AT1B 2HBPA 2A37A 3E9GA 1RLQC 1YCYA 3CCMA 2FRWA 2QEXT 2LCLA 2D1XA 4N4HA 2MF2A 2FL7A 2JTEA 2ROLA 3CC2A 3GF5A 3OBYA 1OU8A 2C06A 4PJOF 2FO0A 1K0XA 2F2XA 2PU9B 3ZBDA 2J6KA 3A8OB 2FVUA 1I1JA 1YFNA 2DEUA 4D8KA 2E12A 1ZUKA 2BUDA 4JJDA 3VS6A 4E7HA 4HVUA 3JCMJ 3M59A 4A4HA 2KI7A 3CCEA 4M77C 1FMWA 1W2BP 1MHNA 1UUEA 2DBKA 2QQSA 1U3OA 4PJOG 2KRNA 3O5ZA 4M7AD 2SRCA 2DX1A 1NM7A 2QQAA 2AHJB 4EPCA 1WNLA 2JMAA 5ECAA 4M77G 5LJ3e 1G3SA 3L2QA 4C8QA 2Y90A 1M90C 2EGAA 2K4YA 4A4FA 4DBFA 3CXCS 1RAAB 4PNOA 1WHMA 2P84A 3TVTA 2RJEA 3EG3A 3OYBA 2KMTA 4GLKA 2XDBA 3VU3C 1YITQ 1B34B 1MMGA 1KFZA 3QJ6A 1FYNA 3G7ZA 1YHQT 1W70A 2OJ2A 1JB0E 5A0LA 1SRMA 5GAMf 1M1GA 2GNCA 3FJ5A 2OTLT 3CC4Q 4PKCC 3PMIA 2MIOA 2E5KA 3GLXA 4KGZB 1G3TA 1NEGA 4HCZA 1TH7A 5FU6B 5AT1B 3CXCA 3RERA 3LGFA 4N0AC 3TCJA 4A53A 3TEEA 1VQ6T 2CP6A 2RB6A 4C8QB 3MPUB 5IHNA 4II1A 3D7SB 3CC4A 4HA8A 3A5ZB 4J9DA 2F2WA 2M1HA 4DOWA 1D1BA 1M3AA 3GP8A 1TU0B 3QKJA 3I55T 2D9TA 1OQKA 1OULA 1Y7XA 3HRTA 3X28B 2LMJA 2YHTA 3JCMh 1X2KA 3CCRT 2DZ9A 1YJ9Q 3FJPA 1WIEA 5HK3A 1BI0A 2JJ9A 1WHGA 2B8AA 2QQBA 2RQTA 2JW4A 2QXFA 3CC7A 1UHCA 1AEYA 4J7IA 1VQNT 4NL2A 2DXTA 1GFDA 4IUPA 2Z0WA 4FYWB 2JUFA 4KH1B 2RQRA 2IPOB 1OI1A 3H0FA 1XQHA 3L2RA 1X6GA 4M7AC 2RHXA 3OY9A 2QDYB 2E6NA 4NOYA 4QW2A 1BIBA 1AD5A 1G8XA 4IIMA 4DEYA 5GAOm 1QCFA 1NE8A 4AFQC 2QA4A 2EYQA 2O31A 5CKBA 2HQHA 4J8OA 3IQLA 2JZ2A 4F7UG 1H8KA 2JMCA 3C12A 1M30A 4XU0A 2VXFA 4J9IA 3M0QA 2XG8D 1C1AA 1NG2A 2NUTA 3H9NA 1D0XA 3X25B 2VB6A 1VQPQ 1VQPT 5KE3A 3FC3A 2WSEE 1AOJA 3VRZA 4DEXA 4HVVA 2JN0A 2RI2A 2EYWA 3CPWP 2MPXC 1X2QA 3CBPA 2C0TA 4IUQA 2RO0A 3V7RA 2MWPA 4C0DC 1AWJA 1D0YA 1KK7A 1V1CA 3VV0A 1SSHA 1Y96A 5GJWB 3JB9J 3UPUA 3PNWC 1I07A 1FWZA 4M7DD 3QSUA 1JQQA 4LDVA 3CMAT 4LUDA 4E7ZA 1S1NA 4M75D 1N8RC 4CC3A 1VQNA 2KY9A 3JCMP 5CKHA 2CP0A 2M0YA 1WI7A 1G83A 2RF0A 3NFCA 2JS2A 3G6EA 1GBRA 2CT3A 4XTVA 2BZ8A 5KYYA 1XNIA 2NLUA 1AT1B 1PRLC 3CQTA 4M77E 3X24B 4FCYA 3WXMB 1QW1A 4OGEA 1VQ7A 1VQNQ 5IHIA 4PJOE 4J6XA 2HCKA 1XJWB 2OX7A 5HCKA 4M7AG 3TU4K 3OYYA 4BDYA 3THKA 5I2MA 2XKOC 2LVMA 4BE2A 2RN8A 3CCVA 3CMEA 2LZ6B 4JJBA 5GANj 1V76A 2FG0A 2EPDA 4LE9A 3TSZA 3OMCA 1GFCA 2NWMA 4XU3A 3CCJT 1UTIA 1YN8A 3G4SA 3PMTA 5LJ5g 4E7KA 5AYFA 4JJCA 4FW2A 5CK9A 1FXXA 1YJNQ 3CMEQ 4RTVA 3JCMg 1VIEA 1FX7A 2DD4A 5CIUA 4D8DA 1KQSS 2M0OA 3OA6A 2KDSA 2DZCA 2QG9B 1QVGP 1M90U 3CC2T 3DKMA 2JNGA 2D8JA 4C92E 2MAMA 4A4EA 2LT1A 1PHTA 2DIQA 2OAWA 2DE0X 3LGLA 1I0CA 2CDTA 2GFUA 1N8RU 1Q7YR 1ZSZB 1UB4A 1K8AR 2A0FB 3KXTA 3SD4A 4Q5WA 2COYA 5LJ3j 2A08A 2DTHA 3VKIA 2RNAA 2HKNA 4GBQA 1GL5A 3P8HA 3QXEB 4FSXA 4MZPA 3GNFB 2OI3A 1T3SA 2GQIA 1S72A 2I2LA 1KQ1A 3DLMA 3RMSA 1TSFA 2EYZA 3TQ7P 3I55Q 3CCSA 1WHHA 4K11A 3L1AA 2MK5A 4IKFA 5KYNA 1WQWA 4FYYB 5LJ5h 5J26A 2VXEA 2KQWA 1R0BG 2PVDB 2L89A 2EWNA 2VGNA 5C0MA 4C0FA 8ATCB 1PKSA 3OYGA 1QLYA 2XDDA 2HZYA 3MO8A 3I55A 2HAXA 4C92F 1YJ9T 1ZLMA 2G3RA 4ZNXA 4J9BA 1Y57A 3JV3A 1N9SA 5FRNA 1WFWA 4RMOA 4HKEA 2COWA 3OYAA 5FW9A 1LOJA 3SFMA 1CSKA 3RNJA 2ZPGB 5M9OA 4LXCA 1S72T 2BKDN 5GJVB 1XTDA 2DKGA 2ROTA 4KUIA 3TSWA 2GTOA 3QYHB 4MMKA 2CH4A 3M57A 4OMNA 4KUDK 2AIRB 1M1KU 3FDRA 1YIJA 2LQKA 1BI1A 3OYIA 3X20B 2PQWA 3KBGA 1O75A 1BK2A 4X1VA 5GANf 4F7UA 3MEUA 4M78B 3M53A 1QVFA 3QIIA 5GANd 1T0JA 3MEWA 2HSPA 1YHQQ 2AZVA 3UT1A 2LC4A 3MJXA 2LQNA 4KGXB 4Y28E 3QWYA 1T0HA 1M27C 3JAME 3VS1A 4M75B 3M58A 3I9QA 1PWTA 2DAQA 4CC4B 1Q95G 1VQOQ 2KRMA 3EHQA 3DB3A 1LPLA 1IO6A 1U8RA 2PUOB 2DTIA 4OB0B 3EG1A 1UECA 3VS5A 1U1SA 2PUKB 2DTOA 3ULRB 2AT1B 3M4YA 5GAN4 2HKQB 1I81A 4M78A 3RKXA 2KK4A 2G6FX 1M2VB 2QGGA 4M77F 2CP5A 2O4XA 4GY5A 2DEQA 2JM9A 1NLOC 3QDRB 2MI6A 4D6WA 3R6NA 2OTJA 1YBYA 4ME7A 2PVOB 3JB9D 2DL7A 2CYZB 2DL5A 2EYXA 3VUZA 1G3WA 3I35A 1VQKT 4MDXA 4BY6C 1FMVA 4XU2A 2D6FA 3GNGA 1RACB 3I56Q 1ACMB 2L0AA 1LVKA 1Q81U 3M0UA 4M7AE 3LW5E 4IIOA 2E4HA 4F04B 5GAOq 2O9SA 3HSBA 4BI8B 2EJGA 1YJWA 1IHVA 2EYYA 1W2BA 1M8VA 2CT4A 3Q1JA 4M75G 4XTZA 5D6YA 2D0QB 4J7FA 4J9EA 4E7SA 3PVQA 4J6WA 4ZTFA 2O2OA 1UFFA 1SHGA 5KCOA 1PRMC 1VQ7T 3UF4A 1QVPA 3QUIA 3PTAA 4JPBW 1WJSA 3GOXA 4JZ3A 3RIRA 1WZOA 2OTJT 4OB2B 2CP7A 1AZGB 2L2PA 3VS0A 1K73U 2RI3A 2X35A 3J7AF 4C0GA 4LDUA 2VV5A 5A0DA 1K73C 2EIFA 4GLMA 5KYYB 1GCQA 4EMKA 2RI5A 2KE9A 4DA4A 2VASA 5GMKm 3EHRA 4OP0A 1KJWA 3CCUQ 4J9GA 2JOYA 3RBBB 3G4ST 1BBZA 4QKUA 1RADB 3BFMA 3HRUA 1RABB 1QCNA 4A4GA 1YITT 1X01A 1RL2A 2E3HA 2E1HA 2K3BA 1SKUB 3CCVQ 2AKLA 1KQSP 2H3JA 2IVWA 5DLQE 4CC7A 3OYFA 4IUTA 1Y07A 4ELYC 3QZ5B 1YWPA 2NUZA 3E1SA 3JB9H 2DERA 2XDPA 5KYXA 4J9FA 4PJMA 3CCVT 2W10A 5IXBA 3KUFA 2KAFA 1ZSGA 4PK4A 3QWXX 1OZ3A 4J9HA 1WXTA 2YUPA 3MKDA 3CCUT 4OB1B 2CSIA 1TS9A 1M9SA 2WSCE 3OYHA 4OMQA 3M0RA 1GCPA 3RKYA 2EQUA 3HP9A 1M8MA 3CCLQ 2D8HA 1WJQA 2V1QA 2ZPHB 2DNUA 3UA6A 1P92A 3BW1A 4IURA 2ZZDA 1ARKA 3QG1A 2M51A 2DMOA 2Y4YA 4O5VA 2F69A 3OS0A 2K5IA 3RDVA 4M77A 4B6MA 2QEXQ 1MV3A 2K6DA 2HL3A 2HL5C 5KH6A 3OMGA 3CCLA 1EZZB 2QA4Q 1TOVA 2YSQA 2ZPEB 3NTKA 3U23A 3P8BB 2CSQA 5KCHA 4VUBA 1WA7A 4BI3A 2DM1A 3BE3A 1JEGA 2DXBA 1E7OA 2LTOA 1BU1A 2CZ7B 1I8FA 4DBHA 1HJDA 3KFVA 5HK0A 2RH2A 2QASA 1V29B 1PD0A 4X34A 2OTJQ 5LJ3d 2EBPA 3REAB 2EGCA 3OYLA 4C8QD 5LJ3f 2WSFE 4R55A 4HXJA 3RKWA 3HRSA 1YJNT 1VQ8A 1H3ZA 2HEQA 1Y96B 2M02A 5IXFA 4FT4A 1WXBA 1VA7A 1N27A 2D0NA 1TUCA 3H0IA 1C0MA 1KIKA 1UGVA 2E64A 2V8JA 9ATCB 3M5AA 4M78C 1U06A 1MNEA 2P0KA 3M0TA 4KT0E 4BDZA 3CCQT 2XD0A 3I56T 1EIFA 1GXIE 1X69A 3QHSA 2KXCA 1MMAA 1UJYA 1E6HA 2OTLQ 2P4TA 3S6WA 1QVGA 2XICA 3EG2A 1D1CA 1HD3A 1K9MU 1PCXA 1ZA1B 3L2UA 1I4K1 1ZBJA 3OW2S 1RAIB 1D0ZA 1E6GA 2K3XA 4HVWA 4N0AA 2HDAA 1VQ4T 3HKSA 4JRKA 4L5GA 3HHTB 2VWFA 3E9FA 1M4ZA 3CCLT 2FPDA 2EGEA 4RTXA 1SRLA 5EC7A 2RPNA 3C95A 4LDYA 3VS2A 2V8KA 3OYCA 4M78D 3EG0A 4C92D 3WVDB 4ZN1A 1M3BA 2RJCA 3OS1A 1D3BA 2XI9A 4LD6A 3SWNC 4C92B 2JM8A 4OF1A 2Y4XA 3EAEA 2LX9A 3A8LB 1KD1R 1KHCA 4AFSC 3CD6A 1N6AA 1VQ6A 2QQ9A 2LJ1A 2F1LA 3EGDA
chains in the Genus database with same CATH topology
1Q86C 1NJIC 1N9RA 5J39A 2X4XA 3OS5A 2K5LA 4JDSA 3CC4T 4IKFA 1WQWA 4FL6A 3G71T 3S3NA 5LJ5h 5FU6C 3OYKA 4MZMA 5FLXE 5J26A 2VXEA 2KQWA 1AHJB 3QJYA 3JCMb 1DJ7B 5GAOn 2PVDB 3JB9F 3OYJA 4KULA 2L89A 4M77B 2QI2A 1Q7YU 2EWNA 2VGNA 3OB9A 3HFOA 4C0FA 5C0MA 3OYGA 3PFSA 5A0GA 1VQ4A 4M75C 3FIFA 2XDDA 2O01E 3A8GB 3RESA 4BE1A 3MO8A 3I55A 2HAXA 1NZ9A 2E70A 2E10A 2EKOA 1Q7YC 2RA2A 4C92F 2K3YA 1H641 3CPWS 1YJ9T 4M7DC 3M4GA 1OZ2A 2G3RA 4Y91A 1KC8C 4V2SA 3C4SA 3L2VA 1ZQ1A 2L5QA 3RUXA 3CEYA 5CQXA 4N4GA 5GAMg 1QVFS 1HXDA 1N9SA 2L8DA 5FRNA 4RCBA 2OAUA 5FU7C 5I2SA 3PT9A 3CCRA 2CZ1B 3VYHB 5GMKh 3CMET 2X4JA 4RMOA 2QTXA 4HKEA 5GAOr 2EQJA 2F5TX 3OYAA 2YLBA 2JVVA 2LT4A 1LOJA 2RHUA 3MP1A 5GMKe 5CAIA 2E6ZA 3L2WA 1JBMA 3SFMA 4NL3A 2ZPGB 5M9OA 2HBPA 4EMKB 3CCMT 1S72T 2BKDN 1XTDA 2DKGA 4OMFB 2X4YA 3G6ET 3JRZA 3E9GA 4KUIA 1IZ6A 1YCYA 3J80E 3OYNA 3CCMA 3QYHB 4PLIA 2EFIA 1KHIA 4MMKA 3OYDA 3M57A 3LWHA 4E47A 4KUDK 4BI4A 2QEXT 5C6SA 1M1KU 2LCLA 3FDRA 4N4HA 1YIJA 2YLCA 2LQKA 2MF2A 2FL7A 5LJ5j 1BI1A 3OYIA 3CC2A 3GF5A 2R5MA 3OBYA 3X20B 2C06A 3LH0A 3UDCA 2QEXA 4PJOF 1Q82C 2PQWA 4M78G 3KBGA 1O75A 3M9QA 5GANf 3V8KA 1VQLA 4F7UA 2PU9B 2FHDA 2V8IA 3A8OB 3MEUA 2E5QA 2FVUA 4M78B 3JCMc 3M53A 1QVFA 4PL6A 3MEAA 3QIIA 5GANd 1Y71A 3MEWA 3A8HB 4L59A 2GF7A 5IT9E 1I5LA 1BKBA 2BUDA 2E12A 3MEVA 2LC4A 5D6WA 2DXCA 3UT1A 5LJ5d 3JCMX 4JRPA 3JCMJ 3M59A 4M7AB 4J83A 4A4HA 4Y28E 4ZGDB 4M75E 1KD1C 3CCEA 4M7DA 3JAME 4M77C 3BY7A 4QVZA 2F5KA 1MHNA 4M75B 3M58A 4M7DE 3DLLA 2QQSA 3S3OA 3DB4A 5A0LA 4PJOG 2DAQA 3MP8A 2ZCFB 4MZTA 3CC7T 2E41A 3P8DA 4M7AD 1D3BB 3WVEB 2QQAA 2AHJB 3E19A 4BB7A 3ME9A 1WNLA 4EPCA 4MDWA 2RK1A 4M77G 3DB3A 1VQMA 2KSSA 5LJ3e 4M78E 1G3SA 1QP3A 1WQ7A 3A8MB 5CQYA 3H6ZA 4L6V5 4XTYA 4C8QA 2PUOB 2Y90A 3L2QA 1U8RA 2DTIA 4OB0B 1M90C 2VYTA 2DVEA 2K4YA 2VUBA 4A4FA 1U1SA 3CXCS 3PIPA 4PNOA 1LJOA 2PUKB 2DTOA 2HQXA 4FU6A 3C94A 2RJEA 4OB3B 3M4YA 5GAN4 3OBWA 4FT2A 4NS5A 3OYBA 1VQ8T 2KMTA 4GLKA 2XDBA 1I81A 4HT9A 3ASKA 2CS7A 4M78A 3RKXA 3VU3C 1B34B 2KK4A 3S3MA 3QJ6A 3PGGA 1G5VA 2RHZA 1W4SA 3G7ZA 4M77F 2DK3A 2O4XA 4GY5A 5KE2A 2DEQA 1YHQT 1UGPB 1YJ9A 3QDRB 1JB0E 1PSEA 2MI6A 2VC8A 2LRQA 2O4XB 4D6WA 1YBYA 2DJZA 2PVOB 4ME7A 3ZEHA 2OTJA 5L8RE 3ER0A 3JB9D 5GAMf 1M1GA 3M56A 2CYZB 3OSSC 4LDWA 2OTLT 4PKCC 3PMIA 3VUZA 1G3WA 3GLXA 5GAMd 4OGCA 3RMQA 1G3TA 2DD5A 1VQKT 4MDXA 4RG2A 4BY6C 4HCZA 4XU2A 1TH7A 2OTLA 1WPYA 2D6FA 1O9SA 3GNGA 5FU6B 5HKCA 2EJFA 3LX7A 3CXCA 3RERA 2RJDA 3EFRA 3LGFA 4N0AC 3TCJA 3CCUA 1VQ9T 1Q81U 3JCMQ 2EQMA 3FRNA 4MMLA 3VYGA 4A53A 3TEEA 1VQ6T 1ZHIA 2RB6A 3LW5E 3HFNA 4C8QB 1YJWT 4M7AE 4F7UF 5GAOq 3HSBA 1VQPA 4II1A 3BDLA 4BI8B 3CC4A 4HA8A 2EJGA 2R58A 1YJWA 3A5ZB 2LDMA 5LJ5e 1W2BA 1M8VA 2GCXA 2HNIA 3Q1JA 1IREB 4M75G 4M7DG 4M77D 2D0QB 2M1HA 2RM4A 4J7FA 4XTZA 5D6YA 4DOWA 3GP8A 3CPFA 4QVCA 2DXUA 2RHYA 3QKJA 3I55T 4J6WA 2M16A 2D9TA 1UGSB 2K57A 3CBMA 5LJ3g 4ZTFA 2K2VA 5IAYA 4F7UB 1G3YA 4RCCA 4M7DB 1Y7XA 3HRTA 3X28B 1NPPA 5KCOA 1VQ7T 2YHTA 3JCMh 1QVPA 5CKFA 3QUIA 4ZN3A 3CCRT 3PTAA 2DZ9A 2QA4T 1WJSA 2EJ9A 3GOXA 1M1KC 1JRIA 3RIRA 2OTJT 4OB2B 3CPWA 3FJPA 2CZ0B 3J81E 5CKEA 1NJIU 1VQ5T 5HK3A 5GANh 5GAN2 2P0PA 1BI0A 1K73U 4M7DF 2B8AA 2ZGWA 1K9MC 3CCET 2RI3A 2X35A 3JB9I 5CCAA 3J7AF 3SDZA 2QQBA 4LDUA 2VV5A 4C0GA 3TREA 5A0DA 4BE0A 2QXFA 3CC7A 3I56A 3JB9G 1K73C 2ZPBB 2EIFA 1VQOA 3L42A 5EG2A 4KBMB 4EMKA 4J7IA 2RI5A 4DA4A 1VQNT 2ZPFB 4QQGA 5GMKm 1RI0A 4NL2A 4OP0A 2LCCA 2DXTA 1K8AU 3M54A 4Z02A 1W2BS 3OS2A 4LDXA 4DQ2A 2JOYA 4IUPA 2MWOA 3O8VA 3G4ST 5DY9A 3FB9A 3BFMA 3HRUA 4JS5A 4A4GA 2JUFA 3CCST 1YITT 1X01A 4UC4A 4HCBA 1RL2A 1OI1A 2E1HA 4JLGA 5DM7R 1XQHA 3ZBDA 4X9CA 5GAMj 5GAN7 3L2RA 4FM4B 4M7AC 2RHXA 2H3JA 2IVWA 3G71A 1YITA 4PJOA 1MGQA 2QDYB 3OY9A 2E6NA 4NOYA 4QW2A 5DLQE 3OYFA 1BIBA 4IUTA 2GQVA 4C0ZA 4XQ3A 1Y07A 1HK9A 4ELYC 3QZ5B 5GAOm 5CVIA 5FU7B 3E1SA 2CKKA 3NTIA 3JB9H 1NE8A 5LJ3h 2XDPA 2QA4A 2EYQA 3CCQA 3CCVT 2DO3A 5FROA 5CKBA 3VUBA 4C8QG 3KUFA 4RKUE 4J8OA 2KAFA 4M75F 4EMHA 2JZ2A 4M7AF 4E7JA 4F7UG 1OZ3A 3EFSA 1K8AC 2RD1A 3C12A 4BACA 1X6OA 2HD0A 2P0QA 4XU0A 2VXFA 3CCUT 4OB1B 3MCAB 2XG8D 3V7SA 5GAMh 1M9SA 4PLLA 5GAOp 2WSCE 4HT8A 4C92A 2IG0A 3V8LA 2M9UA 2JTFA 3OYHA 2MMPA 1M1FA 3X25B 4ATOA 1KC8U 3RKYA 1SSFA 2EQUA 3HP9A 4IUUA 1VQPT 1KQ2A 5KE3A 4J5YA 1R8OB 1WJQA 2WSEE 2ZPHB 3FC3A 3GPLA 2A7YA 3M55A 1P92A 3SWNB 3BW1A 4IURA 2ZZDA 3SB2A 3QG1A 4JJNK 2JN0A 4C92C 4PJOD 2Y4YA 2RI2A 3FLGA 4ELZC 5GMKi 3HL8A 4O5VA 2F69A 3OS0A 2K5IA 1M5Q1 3CBPA 4IUQA 5GAN5 2HQEA 2RO0A 4M77A 4BY6B 3V7RA 2MWPA 3QYGB 4JRIA 4C0DC 5KH6A 1ZBXA 2YRVA 4ZGJB 3OMGA 5CO7A 3CCLA 3L2ZA 3VV0A 1WJRA 4B9WA 4XAXB 4YTLA 5IN1A 2ZPEB 1VQLT 2R5AA 4BD3A 3NTKA 1NPRA 1Y96A 4ZGEB 2CZ6B 1X75C 3P8BB 4XU1A 4E7LA 2E65A 3UPUA 3JB9J 3PNWC 1VQ5A 1FWZA 3QO3A 5KCHA 4EMGA 2VGMA 3JCMd 2DIGA 1VUBA 4X9DA 4QQDA 4VUBA 4M7DD 5DLOA 4BI3A 3QSUA 4LDVA 2LQ8A 1JJ2S 3CMAT 3MHXA 3CCJA 2DXBA 2LTOA 3MP6A 2CZ7B 1QVGS 3PIOA 2EQKA 4M75D 2LNVA 4FIBA 2RHIA 4IUVA 1UEBA 5GAN3 2XU8A 4JRQA 1I8FA 1N8RC 1BIAA 1VQMT 3OW2A 3H8ZA 5HK0A 2RH2A 1VQNA 1VQOT 2KY9A 1YI2A 4DOVA 1V29B 5CKHA 3JCMP 4LD9K 5CKDA 4X34A 5LJ3d 3NTHA 3NFCA 1YJNA 3LLRA 3G6EA 3OYLA 4C8QD 5LJ3f 3AHUA 2KVQG 4ZTJA 4CI0C 4JUVA 2WSFE 2XK0A 4R55A 3RKWA 4XTVA 4JS4A 3HRSA 1YJNT 4J6YA 4F7UE 1VQ8A 1XNIA 2NLUA 1H3ZA 4JLIA 3OYMA 5FRMA 4M77E 3X24B 3WXMB 1QW1A 1Y96B 4PJOB 4OGEA 4FT4A 4WF2A 1VQ7A 4EMKC 2FB7A 1KQSA 1N27A 1U1TA 4R56A 4PJOE 4J6XA 1YIJT 5I21A 1BYMA 2E64A 2V8JA 3QPHA 4M7AG 3CBOA 3OSVA 1Q86U 3LWIA 3TU4K 3F70A 3QZ9B 4QVDA 3M5AA 2EAYA 4M78C 3OYYA 5HY6A 5I2MA 4BDYA 2FYKA 5GAOl 2WACA 2XKOC 1JJ2A 2P0KA 2LVMA 4C5HA 4BE2A 4EDUA 4KT0E 4BDZA 4O6JA 3CCQT 2XD0A 3CCVA 3CMEA 4CRIA 4C5IA 3I56T 2X4WA 1EIFA 3VJPA 2A3LA 5GANj 1KG1A 4M75A 3FEOA 1XOVA 1GXIE 4TVRA 4A54A 3QHSA 5CR2A 3ZFJA 2ZPIB 2DPPB 3OMCA 4C8QC 4M78F 3X26B 4XU3A 4BUGA 3CCJT 2P4TA 3S6WA 1QVGA 3G4SA 2XICA 4OVAA 4RG8A 1UGQB 1WGSA 3PMTA 1OYXA 3JCMV 5LJ5g 4XTWA 5AYFA 4E7KA 4QQ6A 1K9MU 2L3RA 2R57A 3JCMW 3INZA 5CK9A 2PVGB 1FXXA 1YI2T 3UWNA 2CGHA 5GANe 4N4IA 4C8QE 3JCMg 1VIEA 3L2UA 1FX7A 4C8QF 1I4K1 2XIDA 2DD4A 5CIUA 3OW2S 4E7HA 1KQSS 5LL6S 3JSCA 2M0OA 3OA6A 2KDSA 2DZCA 1M90U 3CC2T 2K3XA 3DKMA 3SWNA 2JNGA 4N0AA 4C92E 2MAMA 1QP2A 3BDUA 3QBYA 1VQ4T 1UGRB 3HKSA 1B34A 4A4EA 4JRKA 3LYIA 4L5GA 2LT1A 3OYEA 2RK2A 3HHTB 2DIQA 3E9FA 1M4ZA 5J3BA 5GAN8 2QQRA 3CCLT 3LGLA 4E7IA 2GFUA 1N8RU 1UB4A 5A2QE 3URGA 1BI3A 3C95A 3JCMf 4LDYA 2V8KA 3OYCA 3KXTA 3T9NA 3V8JA 3SD4A 1YHQA 4Q5WA 4M78D 5GAMe 5LJ3j 1KD1U 1Q81C 4XK8E 2DTHA 3VKIA 4P5NA 4C5EA 3CMAA 4C92D 4PJOC 5GMKj 4XTUA 3WVDB 3R6OA 5LJ5f 4XTXA 5GAN6 4ZN1A 3GIBA 4M7AA 3P8HA 1VQKA 2K5FA 3QXEB 4FSXA 4MZPA 4C5GA 2RJCA 3OS1A 1D3BA 2XI9A 4LD6A 2XHCA 2BIVA 3SWNC 3V7CA 1BI2A 3CD6T 3GNFB 4C92B 2RJFA 3OQ5A 1S72A 4OF1A 2I2LA 2Y4XA 3EAEA 1KQ1A 4B9XA 3META 3DLMA 2LX9A 3A8LB 4A4KA 4C92G 3RMSA 3N5BB 1KHCA 2GFAA 1Q82U 5D6XA 3CD6A 1N6AA 2JTMA 5GANg 2QQ9A 3HPWA 1VQ6A 1PSFA 1VIFA 3CCSA 1VQ9A 1LNXA 4C0DB 3JCMe 3L1AA 5GMKl 4HCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9U A; 
#chains in the Genus database with same CATH topology
 1N9R A;  1QQJ A;  2X4X A;  3OS5 A;  5J39 A;  4FL6 A;  5FU6 C;  5KYX B;  5GAO n;  3OYJ A;  1MMN A;  4KUL A;  1Q7Y U;  2QI2 A;  3JB9 F;  1KQS A;  3HFO A;  1VQ4 A;  3PFS A;  5A0G A;  3FIF A;  3RES A;  3EGD B;  4PFO A;  3CD6 Q;  1NZ9 A;  2E70 A;  2EKO A;  2J06 A;  3H0H A;  2ATC B;  1Q7Y C;  1ZA2 B;  1H64 1;  3CPW S;  4Y91 A;  1OZ2 A;  1IXD A;  2QGF B;  3L2V A;  2NUP A;  2L8D A;  4RCB A;  2A28 A;  8AT1 B;  3PT9 A;  1D1A A;  3VYH B;  1M3C A;  3CME T;  1M2V A;  2QTX A;  2EQJ A;  2F5T X;  1AWW A;  2KRS A;  2RHU A;  4FW1 A;  5GMK e;  2YUN A;  5CAI A;  1IGU A;  3L2W A;  1ZSZ C;  4EMK B;  2QAZ A;  2O88 A;  2X4Y A;  2LP5 A;  2YUQ A;  3JRZ A;  1LCK A;  1TTH B;  4AG2 C;  3OYN A;  4F16 A;  5KYW B;  1VQ9 Q;  1KHI A;  2CRE A;  3OYD A;  3CCQ Q;  4BI4 A;  1JU5 C;  1F1B B;  4Y92 A;  1BB9 A;  2R5M A;  1JXO A;  1Q82 C;  2J6O A;  2KNB B;  3V8K A;  2FHD A;  2E5Q A;  3MEA A;  1MUZ A;  1X27 A;  5I22 A;  5IT9 E;  1I5L A;  2VVK A;  2DXC A;  4AMC A;  2A36 A;  4M7A B;  5IH2 A;  1I5O B;  4M75 E;  1KD1 C;  4M7D A;  4QVZ A;  4M7D E;  5KYU A;  3DB4 A;  4KRT A;  3CC7 T;  2E41 A;  3P8D A;  2BE9 B;  1D3B B;  5D7U A;  2QK0 A;  1WHJ A;  2LQW A;  3ME9 A;  1EFN A;  1PNJ A;  2SEM A;  1VQM A;  2KSS A;  4M78 E;  1QP3 A;  1WQ7 A;  2KRO A;  4L6V 5;  4XTY A;  1GBQ A;  1K73 R;  2VUB A;  2DL4 A;  2ABL A;  1ABQ A;  1UHF A;  4Z89 A;  3PIP A;  1LJO A;  1WHL A;  1QKW A;  4FU6 A;  3C94 A;  1VOM A;  4OB3 B;  4NS5 A;  3CC2 Q;  3ASK A;  3S3M A;  1VQM Q;  1W4S A;  2KGT A;  1RLP C;  1YJ9 A;  1PSE A;  3UA7 A;  2LRQ A;  2VC8 A;  2DJZ A;  5L8R E;  4FYX B;  2KT8 A;  3OSS C;  1BCM A;  1M2O A;  5GAM d;  3RMQ A;  2DD5 A;  4RG2 A;  1HSQ A;  1WPY A;  2RJD A;  3JCM Q;  2EQM A;  3FRN A;  4MML A;  1ZHI A;  1YJW T;  3HFN A;  3ZL7 C;  4PFP A;  1VQP A;  1PG5 B;  3OW2 P;  5LJ5 e;  1WHK A;  2GCX A;  2HNI A;  2VKN A;  2EW3 A;  1IRE B;  2V26 A;  4M7D G;  4M77 D;  2KXD A;  4AFZ C;  3AT1 B;  2M16 A;  1UGS B;  5LJ3 g;  5IAY A;  4F7U B;  4RCC A;  1SF9 A;  1NPP A;  1R0C B;  3M0S A;  1TUD A;  5CKF A;  1QVF P;  2QA4 T;  2EJ9 A;  1UDL A;  3CPW A;  2DL8 A;  1W1F A;  2CZ0 B;  3J81 E;  5CKE A;  3RR6 A;  2HBW A;  3PVL A;  1X43 A;  2GTJ A;  1K9M R;  2P0P A;  4M7D F;  4HCK A;  4BE0 A;  1UG1 A;  3I56 A;  5EG2 A;  4KBM B;  2DA9 A;  3EH1 A;  2E3I A;  4QQG A;  7AT1 B;  1UE9 A;  2LCC A;  2LNH B;  3M54 A;  1WX6 A;  2L3S A;  4LDX A;  2YRD A;  4DQ2 A;  4WTO B;  1YJW Q;  3NPF A;  3FB9 A;  3CCS T;  4UC4 A;  4X9C A;  1JO8 A;  5GAM j;  1YIT A;  1VQK Q;  2ENM A;  1VQ7 Q;  2HSE B;  2GQV A;  4C0Z A;  4XQ3 A;  2FPE A;  1HK9 A;  1IHW A;  1AVZ C;  5KYU B;  1MMD A;  2QDL A;  5LJ3 h;  4ESR A;  3CCQ A;  3I5S A;  2JXB A;  4M75 F;  2DJQ A;  2FZC B;  2FZG B;  3EFS A;  4BAC A;  1X6O A;  3MCA B;  5GAM h;  3V7S A;  3VS3 A;  4JZ4 A;  2X3W D;  4C92 A;  2IG0 A;  3V8L A;  5I11 A;  1YP5 A;  4ATO A;  3EGX A;  2X9H A;  4J5Y A;  1R8O B;  3M0P A;  2BE7 D;  3VS4 A;  4JJN K;  1PM3 A;  1RAE B;  1JXM A;  3HL8 A;  1M5Q 1;  5GAN 5;  4ORZ A;  4JRI A;  4ZGJ B;  5CO7 A;  1WJR A;  1IRX A;  4XAX B;  1K76 A;  1VQL T;  2R5A A;  4BD3 A;  4ZGE B;  1NPR A;  2CZ6 B;  1X75 C;  4E7L A;  1AWX A;  2CUB A;  2J6F A;  3QO3 A;  3JCM d;  2YUO A;  2NUP B;  4PJN A;  1VUB A;  5DLO A;  1TG0 A;  2LQ8 A;  1JJ2 S;  3MHX A;  2LCS A;  3CCE Q;  1QVG S;  2EQK A;  2LNV A;  4IUV A;  1UEB A;  2XU8 A;  4JRQ A;  1VQM T;  3OW2 A;  3H8Z A;  1VQO T;  4LD9 K;  1WYX A;  3EH2 A;  5CKD A;  2KYB A;  3EGX B;  3NTH A;  1YJN A;  3LLR A;  3CCR Q;  3AHU A;  2KVQ G;  4ZTJ A;  3SEM A;  1QWF A;  4LUE A;  1TXQ A;  4AG1 C;  4JS4 A;  4J6Y A;  1X6B A;  4JLI A;  3OYM A;  5FRM A;  3EG9 A;  4PJO B;  4WF2 A;  2YWW A;  1U1T A;  2CUD A;  3VRY A;  1Q82 R;  5I21 A;  2JT4 A;  1OV3 A;  1KC8 R;  1Q86 U;  3OSV A;  3F70 A;  3NHN A;  1VYV A;  1EX4 A;  5HY6 A;  2FYK A;  5GAO l;  1JJ2 A;  4O6J A;  1OPL A;  2GBQ A;  2CH4 W;  4C5I A;  2X4W A;  1KG1 A;  2FRY A;  4M75 A;  1XOV A;  4TVR A;  2MCN A;  2ZPI B;  2DPP B;  4M78 F;  3X26 B;  1K1Z A;  2ESW A;  1WGS A;  3INZ A;  1YI2 T;  4N4I A;  4F17 A;  1M90 R;  2XID A;  2KBT A;  5LL6 S;  3JSC A;  1U5S A;  2RQW A;  3QBY A;  1QP2 A;  3LYI A;  1J3T A;  2RK2 A;  4E6R A;  2KR3 A;  5GAN 8;  2QQR A;  5A2Q E;  3E2U A;  1VYU A;  3V8J A;  1YHQ A;  1Z9Q A;  1KD1 U;  1Q81 C;  3CMA A;  4P5N A;  4C5E A;  1RAG B;  4M7A A;  1RUW A;  3R6O A;  5GAN 6;  3GIB A;  1VQK A;  1WXU A;  2K5F A;  2KT1 A;  2RMO A;  2L3Q A;  2BIV A;  3CD6 T;  1BI2 A;  2EVR A;  1JJ2 P;  2RJF A;  3OQ5 A;  4B9X A;  4A63 B;  1YWO A;  3N5B B;  1IB8 A;  1Q82 U;  5D6X A;  5GAN g;  2JTM A;  3HPW A;  1PSF A;  1VIF A;  1LNX A;  4C0D B;  4HCC A;  1ZX6 A;  1Q86 C;  4WCI A;  3CMA Q;  4RTZ A;  3SHW A;  3CCJ Q;  1YIJ Q;  4MZM A;  2LJ0 A;  4RTT A;  3JCM b;  3QJY A;  1OX8 A;  4FSS A;  4M77 B;  3OB9 A;  2GGR A;  2X51 A;  1IGQ A;  3A8G B;  3EFO A;  2E10 A;  2RA2 A;  2K3Y A;  2L3P A;  4V2S A;  2X3X D;  2L5Q A;  3RUX A;  1YCS B;  3CEY A;  4N4G A;  5CQX A;  5GAM g;  1QVF S;  2DVJ A;  5I2S A;  2OAU A;  3CCR A;  2CZ1 B;  2X4J A;  1CKA A;  2B86 A;  5GAO r;  2LT4 A;  3MP1 A;  1VYT A;  1QKX A;  1QWE A;  3CCM T;  1K9A A;  4OMF B;  2DIL A;  3G6E T;  1T3L A;  4E2F B;  1IZ6 A;  3J80 E;  4PLI A;  2EFI A;  1MV0 B;  4OMO A;  3LWH A;  4E47 A;  5C6S A;  2ED1 A;  3UAT A;  4J9C A;  2YLC A;  5LJ5 j;  3LH0 A;  3UDC A;  2QEX A;  4M78 G;  2DRK A;  3M9Q A;  1VQL A;  2V8I A;  3JCM c;  4PL6 A;  4R0K A;  5FWB A;  1Y71 A;  3A8H B;  4L59 A;  1RI9 A;  2GF7 A;  3C0C A;  1BKB A;  3MEV A;  4ANJ A;  5D6W A;  4JRP A;  3JCM X;  5LJ5 d;  4J83 A;  4ZGD B;  2O9V A;  2ED0 A;  3BY7 A;  2F5K A;  1KSW A;  4RTW A;  3DLL A;  2AKK A;  3S3O A;  1S72 Q;  3MP8 A;  2ZCF B;  4MZT A;  1SG5 A;  1D09 B;  3WVE B;  4BB7 A;  3E19 A;  3HTR A;  4Z8A A;  4MDW A;  2RK1 A;  1NLP C;  5CQY A;  3A8M B;  3H6Z A;  2VYT A;  2DVE A;  3CXC P;  4QT7 A;  1VQ5 Q;  2HQX A;  1M1K R;  3OBW A;  4FT2 A;  1VQ8 T;  5FWC A;  4HT9 A;  2CS7 A;  1ZUU A;  3NMZ C;  3PGG A;  1G5V A;  1YI2 Q;  4KH0 B;  2RHZ A;  4FYV B;  2DK3 A;  5KE2 A;  1BCO A;  1UGP B;  2JS0 A;  2YXY A;  2O4X B;  3ZEH A;  1RAH B;  3ER0 A;  2F2V A;  3M56 A;  4LDW A;  3QDF A;  4OGC A;  2K79 A;  2OTL A;  1O9S A;  5HKC A;  2EJF A;  3LX7 A;  1AWO A;  3EFR A;  1HYO A;  2DYB A;  3CCU A;  4LN2 A;  1VQ9 T;  2AZS A;  3VYG A;  3G4S Q;  4F7U F;  2C0I A;  3BDL A;  1QCO A;  2R58 A;  3GBQ A;  1Q86 R;  2LDM A;  4DBQ A;  2PTK A;  1ZUY A;  2J05 A;  1OOT A;  2RM4 A;  3CPF A;  4QVC A;  2DXU A;  2RHY A;  2MYS A;  4M4Z A;  2K57 A;  3CBM A;  2DYI A;  2K2V A;  1G3Y A;  4M7D B;  2V1R A;  1FMK A;  1QMC A;  1K0S A;  4ZN3 A;  1M1K C;  1B07 A;  1JRI A;  2DET A;  1Q81 R;  1H3H A;  1NJI U;  1VQ5 T;  5GAN h;  5GAN 2;  1NYF A;  3EGU A;  2ZGW A;  1K9M C;  3CCE T;  3JB9 I;  5CCA A;  3SDZ A;  3TRE A;  2XMF A;  1N8R R;  3JB9 G;  2ZPB B;  1VQO A;  2NUT B;  3L42 A;  2PZ1 A;  4RTU A;  4AFU C;  2ZPF B;  1RI0 A;  1K8A U;  3G1J A;  4Z02 A;  1W2B S;  3OS2 A;  2MWO A;  3O8V A;  5DY9 A;  1UJ0 A;  4JS5 A;  2DRM A;  1B7T A;  1OEB A;  4HCB A;  4JLG A;  1CKB A;  5DM7 R;  5GAN 7;  1PD1 A;  4FM4 B;  3G71 A;  3EG9 B;  4PJO A;  1MGQ A;  2AK5 A;  5CVI A;  5FU7 B;  2CKK A;  3NTI A;  1A0N B;  2DO3 A;  5FRO A;  2W0Z A;  3VUB A;  4C8Q G;  3PE0 A;  4RKU E;  4EMH A;  2QTV A;  2FZK B;  4M7A F;  4E7J A;  2P4R A;  3VS7 A;  1K8A C;  2RD1 A;  2HD0 A;  2P0Q A;  2PNI A;  4RUG A;  2ECZ A;  4PLL A;  1MND A;  5GAO p;  4HT8 A;  2M9U A;  2JTF A;  2YRC A;  2MMP A;  1M1F A;  1KC8 U;  4F14 A;  1SSF A;  1TWB A;  2MOX A;  4IUU A;  1KQ2 A;  4EIK A;  3LH5 A;  3GPL A;  2A7Y A;  2IIM A;  3M55 A;  2DL3 A;  5KYW A;  3SWN B;  3SB2 A;  1Y0M A;  1N5Z A;  4C92 C;  4PJO D;  1ABO A;  3FLG A;  5GMK i;  4ELZ C;  2DF6 A;  2ZAE A;  4PJJ A;  2HQE A;  4BY6 B;  2EKH A;  3QYG B;  1ZBX A;  2YRV A;  1RAF B;  3L2Z A;  4B9W A;  2EQI A;  4YTL A;  5IN1 A;  4XU1 A;  2YT6 A;  4OMM A;  2E65 A;  1VQ5 A;  4EMG A;  2VGM A;  3CCM Q;  2DIG A;  2K7A A;  4X9D A;  4QQD A;  2CP3 A;  2CP2 A;  2KEA A;  1W6X A;  4DBR A;  3CCJ A;  3MP6 A;  1SHF A;  3PIO A;  4FIB A;  2RHI A;  2LX7 A;  5GAN 3;  1NJI R;  1BIA A;  2HMA A;  1YI2 A;  4DOV A;  4LNP A;  2K2M A;  1VQ6 Q;  4CI0 C;  4JUV A;  2XK0 A;  1AZE A;  1ZSZ A;  4F7U E;  2DBM A;  2NYS A;  1G2B A;  1GCQ C;  2FB7 A;  4EMK C;  4R56 A;  1YIJ T;  2BZX A;  1BYM A;  3A1P A;  3QPH A;  3CBO A;  3LWI A;  1H92 A;  3QZ9 B;  2H3E B;  4QVD A;  1OX9 A;  2EAY A;  1SPK A;  2LJ3 A;  2WAC A;  1TUG B;  4C5H A;  3REB B;  4EDU A;  4CRI A;  1OU9 A;  3VJP A;  2A3L A;  3FEO A;  4A54 A;  5CR2 A;  3ZFJ A;  2C0O A;  5L23 A;  2DFU A;  4C8Q C;  4BUG A;  3G71 Q;  1PC0 A;  4OVA A;  6AT1 B;  4RG8 A;  1UGQ B;  1OYX A;  3JCM V;  1VQL Q;  4XTW A;  2YDL A;  4QQ6 A;  1OPK A;  2L3R A;  2R57 A;  3JCM W;  2K9G A;  2PVG B;  3UWN A;  2CGH A;  5GAN e;  4C8Q E;  3CCS Q;  3EFO B;  1K4U S;  4C8Q F;  4RTY A;  1VQ8 Q;  3SWN A;  1VQ4 Q;  3BDU A;  1UGR B;  1B34 A;  4PJL A;  3I5R A;  3OYE A;  1B3Q A;  1NEB A;  3A98 A;  4Z88 A;  4OMP A;  5J3B A;  1PKT A;  2I0N A;  4E7I A;  1SEM A;  3URG A;  1BI3 A;  3H41 A;  3JCM f;  2DLP A;  3T9N A;  1C6V X;  5GAM e;  4XK8 E;  4PJO C;  5GMK j;  4XTU A;  1WLP B;  5LJ5 f;  4XTX A;  1NYG A;  4C5G A;  2BZY A;  2XHC A;  3V7C A;  2QYZ A;  1Z9Z A;  3MET A;  4A4K A;  4C92 G;  2GFA A;  5IHK A;  1VQ9 A;  2COZ A;  3JCM e;  5GMK l;  1NJI C;  2FPF A;  4JDS A;  2K5L A;  3CC4 T;  3S3N A;  3G71 T;  2RQV A;  3OYK A;  5FLX E;  1AHJ B;  1DJ7 B;  1WDX A;  2RQU A;  3NGP A;  2BTT A;  2H8H A;  4M75 C;  2O01 E;  3CC7 Q;  4BE1 A;  2J7I A;  1YNZ A;  1NBE B;  4M7D C;  3M4G A;  3G6E Q;  1KC8 C;  3C4S A;  4PFZ A;  1ZQ1 A;  2FEI A;  1HXD A;  4CC2 A;  5FU7 C;  4OML A;  5GMK h;  1GRI A;  2KYM A;  2JVV A;  2YLB A;  1R77 A;  2E6Z A;  1JBM A;  4NL3 A;  4KGV B;  4AT1 B;  2HBP A;  2A37 A;  3E9G A;  1RLQ C;  1YCY A;  3CCM A;  2FRW A;  2QEX T;  2LCL A;  2D1X A;  4N4H A;  2MF2 A;  2FL7 A;  2JTE A;  2ROL A;  3CC2 A;  3GF5 A;  3OBY A;  1OU8 A;  2C06 A;  4PJO F;  2FO0 A;  1K0X A;  2F2X A;  2PU9 B;  3ZBD A;  2J6K A;  3A8O B;  2FVU A;  1I1J A;  1YFN A;  2DEU A;  4D8K A;  2E12 A;  1ZUK A;  2BUD A;  4JJD A;  3VS6 A;  4E7H A;  4HVU A;  3JCM J;  3M59 A;  4A4H A;  2KI7 A;  3CCE A;  4M77 C;  1FMW A;  1W2B P;  1MHN A;  1UUE A;  2DBK A;  2QQS A;  1U3O A;  4PJO G;  2KRN A;  3O5Z A;  4M7A D;  2SRC A;  2DX1 A;  1NM7 A;  2QQA A;  2AHJ B;  4EPC A;  1WNL A;  2JMA A;  5ECA A;  4M77 G;  5LJ3 e;  1G3S A;  3L2Q A;  4C8Q A;  2Y90 A;  1M90 C;  2EGA A;  2K4Y A;  4A4F A;  4DBF A;  3CXC S;  1RAA B;  4PNO A;  1WHM A;  2P84 A;  3TVT A;  2RJE A;  3EG3 A;  3OYB A;  2KMT A;  4GLK A;  2XDB A;  3VU3 C;  1YIT Q;  1B34 B;  1MMG A;  1KFZ A;  3QJ6 A;  1FYN A;  3G7Z A;  1YHQ T;  1W70 A;  2OJ2 A;  1JB0 E;  5A0L A;  1SRM A;  5GAM f;  1M1G A;  2GNC A;  3FJ5 A;  2OTL T;  3CC4 Q;  4PKC C;  3PMI A;  2MIO A;  2E5K A;  3GLX A;  4KGZ B;  1G3T A;  1NEG A;  4HCZ A;  1TH7 A;  5FU6 B;  5AT1 B;  3CXC A;  3RER A;  3LGF A;  4N0A C;  3TCJ A;  4A53 A;  3TEE A;  1VQ6 T;  2CP6 A;  2RB6 A;  4C8Q B;  3MPU B;  5IHN A;  4II1 A;  3D7S B;  3CC4 A;  4HA8 A;  3A5Z B;  4J9D A;  2F2W A;  2M1H A;  4DOW A;  1D1B A;  1M3A A;  3GP8 A;  1TU0 B;  3QKJ A;  3I55 T;  2D9T A;  1OQK A;  1OUL A;  1Y7X A;  3HRT A;  3X28 B;  2LMJ A;  2YHT A;  3JCM h;  1X2K A;  3CCR T;  2DZ9 A;  1YJ9 Q;  3FJP A;  1WIE A;  5HK3 A;  1BI0 A;  2JJ9 A;  1WHG A;  2B8A A;  2QQB A;  2RQT A;  2JW4 A;  2QXF A;  3CC7 A;  1UHC A;  1AEY A;  4J7I A;  1VQN T;  4NL2 A;  2DXT A;  1GFD A;  4IUP A;  2Z0W A;  4FYW B;  2JUF A;  4KH1 B;  2RQR A;  2IPO B;  1OI1 A;  3H0F A;  1XQH A;  3L2R A;  1X6G A;  4M7A C;  2RHX A;  3OY9 A;  2QDY B;  2E6N A;  4NOY A;  4QW2 A;  1BIB A;  1AD5 A;  1G8X A;  4IIM A;  4DEY A;  5GAO m;  1QCF A;  1NE8 A;  4AFQ C;  2QA4 A;  2EYQ A;  2O31 A;  5CKB A;  2HQH A;  4J8O A;  3IQL A;  2JZ2 A;  4F7U G;  1H8K A;  2JMC A;  3C12 A;  1M30 A;  4XU0 A;  2VXF A;  4J9I A;  3M0Q A;  2XG8 D;  1C1A A;  1NG2 A;  2NUT A;  3H9N A;  1D0X A;  3X25 B;  2VB6 A;  1VQP Q;  1VQP T;  5KE3 A;  3FC3 A;  2WSE E;  1AOJ A;  3VRZ A;  4DEX A;  4HVV A;  2JN0 A;  2RI2 A;  2EYW A;  3CPW P;  2MPX C;  1X2Q A;  3CBP A;  2C0T A;  4IUQ A;  2RO0 A;  3V7R A;  2MWP A;  4C0D C;  1AWJ A;  1D0Y A;  1KK7 A;  1V1C A;  3VV0 A;  1SSH A;  1Y96 A;  5GJW B;  3JB9 J;  3UPU A;  3PNW C;  1I07 A;  1FWZ A;  4M7D D;  3QSU A;  1JQQ A;  4LDV A;  3CMA T;  4LUD A;  4E7Z A;  1S1N A;  4M75 D;  1N8R C;  4CC3 A;  1VQN A;  2KY9 A;  3JCM P;  5CKH A;  2CP0 A;  2M0Y A;  1WI7 A;  1G83 A;  2RF0 A;  3NFC A;  2JS2 A;  3G6E A;  1GBR A;  2CT3 A;  4XTV A;  2BZ8 A;  5KYY A;  1XNI A;  2NLU A;  1AT1 B;  1PRL C;  3CQT A;  4M77 E;  3X24 B;  4FCY A;  3WXM B;  1QW1 A;  4OGE A;  1VQ7 A;  1VQN Q;  5IHI A;  4PJO E;  4J6X A;  2HCK A;  1XJW B;  2OX7 A;  5HCK A;  4M7A G;  3TU4 K;  3OYY A;  4BDY A;  3THK A;  5I2M A;  2XKO C;  2LVM A;  4BE2 A;  2RN8 A;  3CCV A;  3CME A;  2LZ6 B;  4JJB A;  5GAN j;  1V76 A;  2FG0 A;  2EPD A;  4LE9 A;  3TSZ A;  3OMC A;  1GFC A;  2NWM A;  4XU3 A;  3CCJ T;  1UTI A;  1YN8 A;  3G4S A;  3PMT A;  5LJ5 g;  4E7K A;  5AYF A;  4JJC A;  4FW2 A;  5CK9 A;  1FXX A;  1YJN Q;  3CME Q;  4RTV A;  3JCM g;  1VIE A;  1FX7 A;  2DD4 A;  5CIU A;  4D8D A;  1KQS S;  2M0O A;  3OA6 A;  2KDS A;  2DZC A;  2QG9 B;  1QVG P;  1M90 U;  3CC2 T;  3DKM A;  2JNG A;  2D8J A;  4C92 E;  2MAM A;  4A4E A;  2LT1 A;  1PHT A;  2DIQ A;  2OAW A;  2DE0 X;  3LGL A;  1I0C A;  2CDT A;  2GFU A;  1N8R U;  1Q7Y R;  1ZSZ B;  1UB4 A;  1K8A R;  2A0F B;  3KXT A;  3SD4 A;  4Q5W A;  2COY A;  5LJ3 j;  2A08 A;  2DTH A;  3VKI A;  2RNA A;  2HKN A;  4GBQ A;  1GL5 A;  3P8H A;  3QXE B;  4FSX A;  4MZP A;  3GNF B;  2OI3 A;  1T3S A;  2GQI A;  1S72 A;  2I2L A;  1KQ1 A;  3DLM A;  3RMS A;  1TSF A;  2EYZ A;  3TQ7 P;  3I55 Q;  3CCS A;  1WHH A;  4K11 A;  3L1A A;  2MK5 A;  4IKF A;  5KYN A;  1WQW A;  4FYY B;  5LJ5 h;  5J26 A;  2VXE A;  2KQW A;  1R0B G;  2PVD B;  2L89 A;  2EWN A;  2VGN A;  5C0M A;  4C0F A;  8ATC B;  1PKS A;  3OYG A;  1QLY A;  2XDD A;  2HZY A;  3MO8 A;  3I55 A;  2HAX A;  4C92 F;  1YJ9 T;  1ZLM A;  2G3R A;  4ZNX A;  4J9B A;  1Y57 A;  3JV3 A;  1N9S A;  5FRN A;  1WFW A;  4RMO A;  4HKE A;  2COW A;  3OYA A;  5FW9 A;  1LOJ A;  3SFM A;  1CSK A;  3RNJ A;  2ZPG B;  5M9O A;  4LXC A;  1S72 T;  2BKD N;  5GJV B;  1XTD A;  2DKG A;  2ROT A;  4KUI A;  3TSW A;  2GTO A;  3QYH B;  4MMK A;  2CH4 A;  3M57 A;  4OMN A;  4KUD K;  2AIR B;  1M1K U;  3FDR A;  1YIJ A;  2LQK A;  1BI1 A;  3OYI A;  3X20 B;  2PQW A;  3KBG A;  1O75 A;  1BK2 A;  4X1V A;  5GAN f;  4F7U A;  3MEU A;  4M78 B;  3M53 A;  1QVF A;  3QII A;  5GAN d;  1T0J A;  3MEW A;  2HSP A;  1YHQ Q;  2AZV A;  3UT1 A;  2LC4 A;  3MJX A;  2LQN A;  4KGX B;  4Y28 E;  3QWY A;  1T0H A;  1M27 C;  3JAM E;  3VS1 A;  4M75 B;  3M58 A;  3I9Q A;  1PWT A;  2DAQ A;  4CC4 B;  1Q95 G;  1VQO Q;  2KRM A;  3EHQ A;  3DB3 A;  1LPL A;  1IO6 A;  1U8R A;  2PUO B;  2DTI A;  4OB0 B;  3EG1 A;  1UEC A;  3VS5 A;  1U1S A;  2PUK B;  2DTO A;  3ULR B;  2AT1 B;  3M4Y A;  5GAN 4;  2HKQ B;  1I81 A;  4M78 A;  3RKX A;  2KK4 A;  2G6F X;  1M2V B;  2QGG A;  4M77 F;  2CP5 A;  2O4X A;  4GY5 A;  2DEQ A;  2JM9 A;  1NLO C;  3QDR B;  2MI6 A;  4D6W A;  3R6N A;  2OTJ A;  1YBY A;  4ME7 A;  2PVO B;  3JB9 D;  2DL7 A;  2CYZ B;  2DL5 A;  2EYX A;  3VUZ A;  1G3W A;  3I35 A;  1VQK T;  4MDX A;  4BY6 C;  1FMV A;  4XU2 A;  2D6F A;  3GNG A;  1RAC B;  3I56 Q;  1ACM B;  2L0A A;  1LVK A;  1Q81 U;  3M0U A;  4M7A E;  3LW5 E;  4IIO A;  2E4H A;  4F04 B;  5GAO q;  2O9S A;  3HSB A;  4BI8 B;  2EJG A;  1YJW A;  1IHV A;  2EYY A;  1W2B A;  1M8V A;  2CT4 A;  3Q1J A;  4M75 G;  4XTZ A;  5D6Y A;  2D0Q B;  4J7F A;  4J9E A;  4E7S A;  3PVQ A;  4J6W A;  4ZTF A;  2O2O A;  1UFF A;  1SHG A;  5KCO A;  1PRM C;  1VQ7 T;  3UF4 A;  1QVP A;  3QUI A;  3PTA A;  4JPB W;  1WJS A;  3GOX A;  4JZ3 A;  3RIR A;  1WZO A;  2OTJ T;  4OB2 B;  2CP7 A;  1AZG B;  2L2P A;  3VS0 A;  1K73 U;  2RI3 A;  2X35 A;  3J7A F;  4C0G A;  4LDU A;  2VV5 A;  5A0D A;  1K73 C;  2EIF A;  4GLM A;  5KYY B;  1GCQ A;  4EMK A;  2RI5 A;  2KE9 A;  4DA4 A;  2VAS A;  5GMK m;  3EHR A;  4OP0 A;  1KJW A;  3CCU Q;  4J9G A;  2JOY A;  3RBB B;  3G4S T;  1BBZ A;  4QKU A;  1RAD B;  3BFM A;  3HRU A;  1RAB B;  1QCN A;  4A4G A;  1YIT T;  1X01 A;  1RL2 A;  2E3H A;  2E1H A;  2K3B A;  1SKU B;  3CCV Q;  2AKL A;  1KQS P;  2H3J A;  2IVW A;  5DLQ E;  4CC7 A;  3OYF A;  4IUT A;  1Y07 A;  4ELY C;  3QZ5 B;  1YWP A;  2NUZ A;  3E1S A;  3JB9 H;  2DER A;  2XDP A;  5KYX A;  4J9F A;  4PJM A;  3CCV T;  2W10 A;  5IXB A;  3KUF A;  2KAF A;  1ZSG A;  4PK4 A;  3QWX X;  1OZ3 A;  4J9H A;  1WXT A;  2YUP A;  3MKD A;  3CCU T;  4OB1 B;  2CSI A;  1TS9 A;  1M9S A;  2WSC E;  3OYH A;  4OMQ A;  3M0R A;  1GCP A;  3RKY A;  2EQU A;  3HP9 A;  1M8M A;  3CCL Q;  2D8H A;  1WJQ A;  2V1Q A;  2ZPH B;  2DNU A;  3UA6 A;  1P92 A;  3BW1 A;  4IUR A;  2ZZD A;  1ARK A;  3QG1 A;  2M51 A;  2DMO A;  2Y4Y A;  4O5V A;  2F69 A;  3OS0 A;  2K5I A;  3RDV A;  4M77 A;  4B6M A;  2QEX Q;  1MV3 A;  2K6D A;  2HL3 A;  2HL5 C;  5KH6 A;  3OMG A;  3CCL A;  1EZZ B;  2QA4 Q;  1TOV A;  2YSQ A;  2ZPE B;  3NTK A;  3U23 A;  3P8B B;  2CSQ A;  5KCH A;  4VUB A;  1WA7 A;  4BI3 A;  2DM1 A;  3BE3 A;  1JEG A;  2DXB A;  1E7O A;  2LTO A;  1BU1 A;  2CZ7 B;  1I8F A;  4DBH A;  1HJD A;  3KFV A;  5HK0 A;  2RH2 A;  2QAS A;  1V29 B;  1PD0 A;  4X34 A;  2OTJ Q;  5LJ3 d;  2EBP A;  3REA B;  2EGC A;  3OYL A;  4C8Q D;  5LJ3 f;  2WSF E;  4R55 A;  4HXJ A;  3RKW A;  3HRS A;  1YJN T;  1VQ8 A;  1H3Z A;  2HEQ A;  1Y96 B;  2M02 A;  5IXF A;  4FT4 A;  1WXB A;  1VA7 A;  1N27 A;  2D0N A;  1TUC A;  3H0I A;  1C0M A;  1KIK A;  1UGV A;  2E64 A;  2V8J A;  9ATC B;  3M5A A;  4M78 C;  1U06 A;  1MNE A;  2P0K A;  3M0T A;  4KT0 E;  4BDZ A;  3CCQ T;  2XD0 A;  3I56 T;  1EIF A;  1GXI E;  1X69 A;  3QHS A;  2KXC A;  1MMA A;  1UJY A;  1E6H A;  2OTL Q;  2P4T A;  3S6W A;  1QVG A;  2XIC A;  3EG2 A;  1D1C A;  1HD3 A;  1K9M U;  1PCX A;  1ZA1 B;  3L2U A;  1I4K 1;  1ZBJ A;  3OW2 S;  1RAI B;  1D0Z A;  1E6G A;  2K3X A;  4HVW A;  4N0A A;  2HDA A;  1VQ4 T;  3HKS A;  4JRK A;  4L5G A;  3HHT B;  2VWF A;  3E9F A;  1M4Z A;  3CCL T;  2FPD A;  2EGE A;  4RTX A;  1SRL A;  5EC7 A;  2RPN A;  3C95 A;  4LDY A;  3VS2 A;  2V8K A;  3OYC A;  4M78 D;  3EG0 A;  4C92 D;  3WVD B;  4ZN1 A;  1M3B A;  2RJC A;  3OS1 A;  1D3B A;  2XI9 A;  4LD6 A;  3SWN C;  4C92 B;  2JM8 A;  4OF1 A;  2Y4X A;  3EAE A;  2LX9 A;  3A8L B;  1KD1 R;  1KHC A;  4AFS C;  3CD6 A;  1N6A A;  1VQ6 A;  2QQ9 A;  2LJ1 A;  2F1L A;  3EGD A; 
#chains in the Genus database with same CATH homology
 1Q86 C;  1NJI C;  1N9R A;  5J39 A;  2X4X A;  3OS5 A;  2K5L A;  4JDS A;  3CC4 T;  4IKF A;  1WQW A;  4FL6 A;  3G71 T;  3S3N A;  5LJ5 h;  5FU6 C;  3OYK A;  4MZM A;  5FLX E;  5J26 A;  2VXE A;  2KQW A;  1AHJ B;  3QJY A;  3JCM b;  1DJ7 B;  5GAO n;  2PVD B;  3JB9 F;  3OYJ A;  4KUL A;  2L89 A;  4M77 B;  2QI2 A;  1Q7Y U;  2EWN A;  2VGN A;  3OB9 A;  3HFO A;  4C0F A;  5C0M A;  3OYG A;  3PFS A;  5A0G A;  1VQ4 A;  4M75 C;  3FIF A;  2XDD A;  2O01 E;  3A8G B;  3RES A;  4BE1 A;  3MO8 A;  3I55 A;  2HAX A;  1NZ9 A;  2E70 A;  2E10 A;  2EKO A;  1Q7Y C;  2RA2 A;  4C92 F;  2K3Y A;  1H64 1;  3CPW S;  1YJ9 T;  4M7D C;  3M4G A;  1OZ2 A;  2G3R A;  4Y91 A;  1KC8 C;  4V2S A;  3C4S A;  3L2V A;  1ZQ1 A;  2L5Q A;  3RUX A;  3CEY A;  5CQX A;  4N4G A;  5GAM g;  1QVF S;  1HXD A;  1N9S A;  2L8D A;  5FRN A;  4RCB A;  2OAU A;  5FU7 C;  5I2S A;  3PT9 A;  3CCR A;  2CZ1 B;  3VYH B;  5GMK h;  3CME T;  2X4J A;  4RMO A;  2QTX A;  4HKE A;  5GAO r;  2EQJ A;  2F5T X;  3OYA A;  2YLB A;  2JVV A;  2LT4 A;  1LOJ A;  2RHU A;  3MP1 A;  5GMK e;  5CAI A;  2E6Z A;  3L2W A;  1JBM A;  3SFM A;  4NL3 A;  2ZPG B;  5M9O A;  2HBP A;  4EMK B;  3CCM T;  1S72 T;  2BKD N;  1XTD A;  2DKG A;  4OMF B;  2X4Y A;  3G6E T;  3JRZ A;  3E9G A;  4KUI A;  1IZ6 A;  1YCY A;  3J80 E;  3OYN A;  3CCM A;  3QYH B;  4PLI A;  2EFI A;  1KHI A;  4MMK A;  3OYD A;  3M57 A;  3LWH A;  4E47 A;  4KUD K;  4BI4 A;  2QEX T;  5C6S A;  1M1K U;  2LCL A;  3FDR A;  4N4H A;  1YIJ A;  2YLC A;  2LQK A;  2MF2 A;  2FL7 A;  5LJ5 j;  1BI1 A;  3OYI A;  3CC2 A;  3GF5 A;  2R5M A;  3OBY A;  3X20 B;  2C06 A;  3LH0 A;  3UDC A;  2QEX A;  4PJO F;  1Q82 C;  2PQW A;  4M78 G;  3KBG A;  1O75 A;  3M9Q A;  5GAN f;  3V8K A;  1VQL A;  4F7U A;  2PU9 B;  2FHD A;  2V8I A;  3A8O B;  3MEU A;  2E5Q A;  2FVU A;  4M78 B;  3JCM c;  3M53 A;  1QVF A;  4PL6 A;  3MEA A;  3QII A;  5GAN d;  1Y71 A;  3MEW A;  3A8H B;  4L59 A;  2GF7 A;  5IT9 E;  1I5L A;  1BKB A;  2BUD A;  2E12 A;  3MEV A;  2LC4 A;  5D6W A;  2DXC A;  3UT1 A;  5LJ5 d;  3JCM X;  4JRP A;  3JCM J;  3M59 A;  4M7A B;  4J83 A;  4A4H A;  4Y28 E;  4ZGD B;  4M75 E;  1KD1 C;  3CCE A;  4M7D A;  3JAM E;  4M77 C;  3BY7 A;  4QVZ A;  2F5K A;  1MHN A;  4M75 B;  3M58 A;  4M7D E;  3DLL A;  2QQS A;  3S3O A;  3DB4 A;  5A0L A;  4PJO G;  2DAQ A;  3MP8 A;  2ZCF B;  4MZT A;  3CC7 T;  2E41 A;  3P8D A;  4M7A D;  1D3B B;  3WVE B;  2QQA A;  2AHJ B;  3E19 A;  4BB7 A;  3ME9 A;  1WNL A;  4EPC A;  4MDW A;  2RK1 A;  4M77 G;  3DB3 A;  1VQM A;  2KSS A;  5LJ3 e;  4M78 E;  1G3S A;  1QP3 A;  1WQ7 A;  3A8M B;  5CQY A;  3H6Z A;  4L6V 5;  4XTY A;  4C8Q A;  2PUO B;  2Y90 A;  3L2Q A;  1U8R A;  2DTI A;  4OB0 B;  1M90 C;  2VYT A;  2DVE A;  2K4Y A;  2VUB A;  4A4F A;  1U1S A;  3CXC S;  3PIP A;  4PNO A;  1LJO A;  2PUK B;  2DTO A;  2HQX A;  4FU6 A;  3C94 A;  2RJE A;  4OB3 B;  3M4Y A;  5GAN 4;  3OBW A;  4FT2 A;  4NS5 A;  3OYB A;  1VQ8 T;  2KMT A;  4GLK A;  2XDB A;  1I81 A;  4HT9 A;  3ASK A;  2CS7 A;  4M78 A;  3RKX A;  3VU3 C;  1B34 B;  2KK4 A;  3S3M A;  3QJ6 A;  3PGG A;  1G5V A;  2RHZ A;  1W4S A;  3G7Z A;  4M77 F;  2DK3 A;  2O4X A;  4GY5 A;  5KE2 A;  2DEQ A;  1YHQ T;  1UGP B;  1YJ9 A;  3QDR B;  1JB0 E;  1PSE A;  2MI6 A;  2VC8 A;  2LRQ A;  2O4X B;  4D6W A;  1YBY A;  2DJZ A;  2PVO B;  4ME7 A;  3ZEH A;  2OTJ A;  5L8R E;  3ER0 A;  3JB9 D;  5GAM f;  1M1G A;  3M56 A;  2CYZ B;  3OSS C;  4LDW A;  2OTL T;  4PKC C;  3PMI A;  3VUZ A;  1G3W A;  3GLX A;  5GAM d;  4OGC A;  3RMQ A;  1G3T A;  2DD5 A;  1VQK T;  4MDX A;  4RG2 A;  4BY6 C;  4HCZ A;  4XU2 A;  1TH7 A;  2OTL A;  1WPY A;  2D6F A;  1O9S A;  3GNG A;  5FU6 B;  5HKC A;  2EJF A;  3LX7 A;  3CXC A;  3RER A;  2RJD A;  3EFR A;  3LGF A;  4N0A C;  3TCJ A;  3CCU A;  1VQ9 T;  1Q81 U;  3JCM Q;  2EQM A;  3FRN A;  4MML A;  3VYG A;  4A53 A;  3TEE A;  1VQ6 T;  1ZHI A;  2RB6 A;  3LW5 E;  3HFN A;  4C8Q B;  1YJW T;  4M7A E;  4F7U F;  5GAO q;  3HSB A;  1VQP A;  4II1 A;  3BDL A;  4BI8 B;  3CC4 A;  4HA8 A;  2EJG A;  2R58 A;  1YJW A;  3A5Z B;  2LDM A;  5LJ5 e;  1W2B A;  1M8V A;  2GCX A;  2HNI A;  3Q1J A;  1IRE B;  4M75 G;  4M7D G;  4M77 D;  2D0Q B;  2M1H A;  2RM4 A;  4J7F A;  4XTZ A;  5D6Y A;  4DOW A;  3GP8 A;  3CPF A;  4QVC A;  2DXU A;  2RHY A;  3QKJ A;  3I55 T;  4J6W A;  2M16 A;  2D9T A;  1UGS B;  2K57 A;  3CBM A;  5LJ3 g;  4ZTF A;  2K2V A;  5IAY A;  4F7U B;  1G3Y A;  4RCC A;  4M7D B;  1Y7X A;  3HRT A;  3X28 B;  1NPP A;  5KCO A;  1VQ7 T;  2YHT A;  3JCM h;  1QVP A;  5CKF A;  3QUI A;  4ZN3 A;  3CCR T;  3PTA A;  2DZ9 A;  2QA4 T;  1WJS A;  2EJ9 A;  3GOX A;  1M1K C;  1JRI A;  3RIR A;  2OTJ T;  4OB2 B;  3CPW A;  3FJP A;  2CZ0 B;  3J81 E;  5CKE A;  1NJI U;  1VQ5 T;  5HK3 A;  5GAN h;  5GAN 2;  2P0P A;  1BI0 A;  1K73 U;  4M7D F;  2B8A A;  2ZGW A;  1K9M C;  3CCE T;  2RI3 A;  2X35 A;  3JB9 I;  5CCA A;  3J7A F;  3SDZ A;  2QQB A;  4LDU A;  2VV5 A;  4C0G A;  3TRE A;  5A0D A;  4BE0 A;  2QXF A;  3CC7 A;  3I56 A;  3JB9 G;  1K73 C;  2ZPB B;  2EIF A;  1VQO A;  3L42 A;  5EG2 A;  4KBM B;  4EMK A;  4J7I A;  2RI5 A;  4DA4 A;  1VQN T;  2ZPF B;  4QQG A;  5GMK m;  1RI0 A;  4NL2 A;  4OP0 A;  2LCC A;  2DXT A;  1K8A U;  3M54 A;  4Z02 A;  1W2B S;  3OS2 A;  4LDX A;  4DQ2 A;  2JOY A;  4IUP A;  2MWO A;  3O8V A;  3G4S T;  5DY9 A;  3FB9 A;  3BFM A;  3HRU A;  4JS5 A;  4A4G A;  2JUF A;  3CCS T;  1YIT T;  1X01 A;  4UC4 A;  4HCB A;  1RL2 A;  1OI1 A;  2E1H A;  4JLG A;  5DM7 R;  1XQH A;  3ZBD A;  4X9C A;  5GAM j;  5GAN 7;  3L2R A;  4FM4 B;  4M7A C;  2RHX A;  2H3J A;  2IVW A;  3G71 A;  1YIT A;  4PJO A;  1MGQ A;  2QDY B;  3OY9 A;  2E6N A;  4NOY A;  4QW2 A;  5DLQ E;  3OYF A;  1BIB A;  4IUT A;  2GQV A;  4C0Z A;  4XQ3 A;  1Y07 A;  1HK9 A;  4ELY C;  3QZ5 B;  5GAO m;  5CVI A;  5FU7 B;  3E1S A;  2CKK A;  3NTI A;  3JB9 H;  1NE8 A;  5LJ3 h;  2XDP A;  2QA4 A;  2EYQ A;  3CCQ A;  3CCV T;  2DO3 A;  5FRO A;  5CKB A;  3VUB A;  4C8Q G;  3KUF A;  4RKU E;  4J8O A;  2KAF A;  4M75 F;  4EMH A;  2JZ2 A;  4M7A F;  4E7J A;  4F7U G;  1OZ3 A;  3EFS A;  1K8A C;  2RD1 A;  3C12 A;  4BAC A;  1X6O A;  2HD0 A;  2P0Q A;  4XU0 A;  2VXF A;  3CCU T;  4OB1 B;  3MCA B;  2XG8 D;  3V7S A;  5GAM h;  1M9S A;  4PLL A;  5GAO p;  2WSC E;  4HT8 A;  4C92 A;  2IG0 A;  3V8L A;  2M9U A;  2JTF A;  3OYH A;  2MMP A;  1M1F A;  3X25 B;  4ATO A;  1KC8 U;  3RKY A;  1SSF A;  2EQU A;  3HP9 A;  4IUU A;  1VQP T;  1KQ2 A;  5KE3 A;  4J5Y A;  1R8O B;  1WJQ A;  2WSE E;  2ZPH B;  3FC3 A;  3GPL A;  2A7Y A;  3M55 A;  1P92 A;  3SWN B;  3BW1 A;  4IUR A;  2ZZD A;  3SB2 A;  3QG1 A;  4JJN K;  2JN0 A;  4C92 C;  4PJO D;  2Y4Y A;  2RI2 A;  3FLG A;  4ELZ C;  5GMK i;  3HL8 A;  4O5V A;  2F69 A;  3OS0 A;  2K5I A;  1M5Q 1;  3CBP A;  4IUQ A;  5GAN 5;  2HQE A;  2RO0 A;  4M77 A;  4BY6 B;  3V7R A;  2MWP A;  3QYG B;  4JRI A;  4C0D C;  5KH6 A;  1ZBX A;  2YRV A;  4ZGJ B;  3OMG A;  5CO7 A;  3CCL A;  3L2Z A;  3VV0 A;  1WJR A;  4B9W A;  4XAX B;  4YTL A;  5IN1 A;  2ZPE B;  1VQL T;  2R5A A;  4BD3 A;  3NTK A;  1NPR A;  1Y96 A;  4ZGE B;  2CZ6 B;  1X75 C;  3P8B B;  4XU1 A;  4E7L A;  2E65 A;  3UPU A;  3JB9 J;  3PNW C;  1VQ5 A;  1FWZ A;  3QO3 A;  5KCH A;  4EMG A;  2VGM A;  3JCM d;  2DIG A;  1VUB A;  4X9D A;  4QQD A;  4VUB A;  4M7D D;  5DLO A;  4BI3 A;  3QSU A;  4LDV A;  2LQ8 A;  1JJ2 S;  3CMA T;  3MHX A;  3CCJ A;  2DXB A;  2LTO A;  3MP6 A;  2CZ7 B;  1QVG S;  3PIO A;  2EQK A;  4M75 D;  2LNV A;  4FIB A;  2RHI A;  4IUV A;  1UEB A;  5GAN 3;  2XU8 A;  4JRQ A;  1I8F A;  1N8R C;  1BIA A;  1VQM T;  3OW2 A;  3H8Z A;  5HK0 A;  2RH2 A;  1VQN A;  1VQO T;  2KY9 A;  1YI2 A;  4DOV A;  1V29 B;  5CKH A;  3JCM P;  4LD9 K;  5CKD A;  4X34 A;  5LJ3 d;  3NTH A;  3NFC A;  1YJN A;  3LLR A;  3G6E A;  3OYL A;  4C8Q D;  5LJ3 f;  3AHU A;  2KVQ G;  4ZTJ A;  4CI0 C;  4JUV A;  2WSF E;  2XK0 A;  4R55 A;  3RKW A;  4XTV A;  4JS4 A;  3HRS A;  1YJN T;  4J6Y A;  4F7U E;  1VQ8 A;  1XNI A;  2NLU A;  1H3Z A;  4JLI A;  3OYM A;  5FRM A;  4M77 E;  3X24 B;  3WXM B;  1QW1 A;  1Y96 B;  4PJO B;  4OGE A;  4FT4 A;  4WF2 A;  1VQ7 A;  4EMK C;  2FB7 A;  1KQS A;  1N27 A;  1U1T A;  4R56 A;  4PJO E;  4J6X A;  1YIJ T;  5I21 A;  1BYM A;  2E64 A;  2V8J A;  3QPH A;  4M7A G;  3CBO A;  3OSV A;  1Q86 U;  3LWI A;  3TU4 K;  3F70 A;  3QZ9 B;  4QVD A;  3M5A A;  2EAY A;  4M78 C;  3OYY A;  5HY6 A;  5I2M A;  4BDY A;  2FYK A;  5GAO l;  2WAC A;  2XKO C;  1JJ2 A;  2P0K A;  2LVM A;  4C5H A;  4BE2 A;  4EDU A;  4KT0 E;  4BDZ A;  4O6J A;  3CCQ T;  2XD0 A;  3CCV A;  3CME A;  4CRI A;  4C5I A;  3I56 T;  2X4W A;  1EIF A;  3VJP A;  2A3L A;  5GAN j;  1KG1 A;  4M75 A;  3FEO A;  1XOV A;  1GXI E;  4TVR A;  4A54 A;  3QHS A;  5CR2 A;  3ZFJ A;  2ZPI B;  2DPP B;  3OMC A;  4C8Q C;  4M78 F;  3X26 B;  4XU3 A;  4BUG A;  3CCJ T;  2P4T A;  3S6W A;  1QVG A;  3G4S A;  2XIC A;  4OVA A;  4RG8 A;  1UGQ B;  1WGS A;  3PMT A;  1OYX A;  3JCM V;  5LJ5 g;  4XTW A;  5AYF A;  4E7K A;  4QQ6 A;  1K9M U;  2L3R A;  2R57 A;  3JCM W;  3INZ A;  5CK9 A;  2PVG B;  1FXX A;  1YI2 T;  3UWN A;  2CGH A;  5GAN e;  4N4I A;  4C8Q E;  3JCM g;  1VIE A;  3L2U A;  1FX7 A;  4C8Q F;  1I4K 1;  2XID A;  2DD4 A;  5CIU A;  3OW2 S;  4E7H A;  1KQS S;  5LL6 S;  3JSC A;  2M0O A;  3OA6 A;  2KDS A;  2DZC A;  1M90 U;  3CC2 T;  2K3X A;  3DKM A;  3SWN A;  2JNG A;  4N0A A;  4C92 E;  2MAM A;  1QP2 A;  3BDU A;  3QBY A;  1VQ4 T;  1UGR B;  3HKS A;  1B34 A;  4A4E A;  4JRK A;  3LYI A;  4L5G A;  2LT1 A;  3OYE A;  2RK2 A;  3HHT B;  2DIQ A;  3E9F A;  1M4Z A;  5J3B A;  5GAN 8;  2QQR A;  3CCL T;  3LGL A;  4E7I A;  2GFU A;  1N8R U;  1UB4 A;  5A2Q E;  3URG A;  1BI3 A;  3C95 A;  3JCM f;  4LDY A;  2V8K A;  3OYC A;  3KXT A;  3T9N A;  3V8J A;  3SD4 A;  1YHQ A;  4Q5W A;  4M78 D;  5GAM e;  5LJ3 j;  1KD1 U;  1Q81 C;  4XK8 E;  2DTH A;  3VKI A;  4P5N A;  4C5E A;  3CMA A;  4C92 D;  4PJO C;  5GMK j;  4XTU A;  3WVD B;  3R6O A;  5LJ5 f;  4XTX A;  5GAN 6;  4ZN1 A;  3GIB A;  4M7A A;  3P8H A;  1VQK A;  2K5F A;  3QXE B;  4FSX A;  4MZP A;  4C5G A;  2RJC A;  3OS1 A;  1D3B A;  2XI9 A;  4LD6 A;  2XHC A;  2BIV A;  3SWN C;  3V7C A;  1BI2 A;  3CD6 T;  3GNF B;  4C92 B;  2RJF A;  3OQ5 A;  1S72 A;  4OF1 A;  2I2L A;  2Y4X A;  3EAE A;  1KQ1 A;  4B9X A;  3MET A;  3DLM A;  2LX9 A;  3A8L B;  4A4K A;  4C92 G;  3RMS A;  3N5B B;  1KHC A;  2GFA A;  1Q82 U;  5D6X A;  3CD6 A;  1N6A A;  2JTM A;  5GAN g;  2QQ9 A;  3HPW A;  1VQ6 A;  1PSF A;  1VIF A;  3CCS A;  1VQ9 A;  1LNX A;  4C0D B;  3JCM e;  3L1A A;  5GMK l;  4HCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...