2M9VA

Structure of saccharomyces cerevisiae est3 protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
STDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKISLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomere replication protein EST3
publication title Structure of Est3 reveals a bimodal surface with differential roles in telomere replication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m9vA00
5I2XA 5I2YA 2I46A 2M9VA
chains in the Genus database with same CATH superfamily
2QDBA 2N55A 4EQOA 1SMXA 2F4IA 4EVOA 3BVMA 1FNVA 2MP1A 2NYZD 4R4QA 2PZTA 4JI0L 3S1NB 3FDTA 1NUCA 4JBKA 4YCVA 2K50A 4DV5Q 5DEHA 1PH7A 3D4DA 4MIUA 1B2TA 1EY4A 3U9SA 2XWJB 1PFMA 4QY7A 1PRTB 1S5FD 3FPUB 5E7NA 1QJOA 4XQQA 2Z6KA 1KXLA 2JA5H 1TWCB 2VUMB 3BG3A 1C4QA 5C4JB 5IIFA 1GOZA 1CFMA 3DWQA 4JK1C 3HOVH 4KY5A 3OW2A 1KDCA 5IP9G 2RSNA 3Q23A 1A3VA 4NP5A 4JCVE 4P72A 4TKOB 3FKIG 4CDEC 1SE4A 4XT3B 4DAYA 2KQ3A 2IHFA 4O1NA 3KJOA 1I4HA 5JVH3 4RH6A 1Y8PB 2E74C 3V2TA 4J15A 2L11A 4DR2Q 5D65A 2XIWA 1CUKA 3J7A5 3EFXD 1MGSA 1STYA 5M5XB 1R9TB 1SROA 5EPJA 3SK8A 4ALPA 4PZ7A 3M4YA 3CAMA 3HOYG 1PVOA 4DR5Q 3EBEA 3A5UA 4JI6L 4JBWA 3H3VC 1B4OA 3RN5A 1JC7A 1ENCA 4KMUC 2HIXA 4BBSH 1TWAB 2Q8TA 3GTMB 1TWCH 4BY7H 4IUVA 4RHRA 5IYBH 4OXPA 4K0KL 5EKLA 1LABA 4Y7NH 1KQSA 1CTMA 3S9WA 4YY3Q 1NBWA 1IHZA 2N78A 4DUYQ 4B3SQ 1XNQL 1SBBB 1LT3D 3BZCA 4AYBE 2CCZA 4UPAA 2M2LA 4CJ0B 1BUVT 3Q0AA 3PO2G 1QWYA 1G2SA 4DV4L 4DV1Q 4GOPC 3H0GB 3S1RB 2A5HA 1N34L 1MSGA 5JJLA 3RD4A 4OWXB 1DOLA 1HJPA 1ZEQX 3RLFA 3G48A 2RBMA 3J81i 2A6HC 1HR0Q 2K32A 4F88A 5K5PA 2PW7A 2DUDA 3CPWA 3CCLA 3UDIA 4DNIA 1EY5A 4YWLA 4ZUJA 4L5TA 5M5XH 3GTJB 4DR6L 4GKKL 3A8IE 3E0EA 4A75A 1CKNB 1V1OA 2NB0A 4EQ5A 5DM73 1SJED 3S24A 2HHHL 3M3YB 4IO9A 1VQBA 2JA7H 3TS2A 2UU9Q 4A3MG 3GTMH 4A3LH 3VYUA 1YVCA 1WTHA 2L9HA 4O2DA 1Y8OB 4C3IH 1HNZQ 2L1BA 3H3VH 1XNRL 4DAMA 3AU7A 4OO1H 3OTOQ 1WFQA 4TSSA 3ULJA 1U4LA 1M4VA 3F2UA 1K3BC 1H9SB 3CQZB 1VQ8A 3HRZC 2F1MA 1KNAA 4FYDA 1KRSA 1IBMQ 4DV3Q 1SSOA 1L2FA 4LF4L 2SDFA 1BO0A 5GQOA 1YITA 4H13C 3TBIB 5AJ3Q 4JI2L 4DNTB 1S5DD 4G7OC 3BZDB 1K8AC 1I3QH 4WRDA 3DM1A 1QZGA 4A3EH 4WJ4A 5CGKA 1J8IA 4IFDH 2F0SA 1RTOA 3NE5B 2AQ2B 1FVIA 4ME3A 3VYTA 4IPCA 1A3TA 2H4OA 1VQLA 1X54A 2LFNA 1ML0D 3BYYB 3RZDB 2QA4A 1KLGD 2ZXOA 3S2HB 2HQLA 4RWSC 2B2YC 2VB2X 1XMOL 2YTYA 1F9PA 1ZYRC 5JAVA 3BS1A 1X55A 2IJ0A 1YHAA 5FLMH 2K1BA 3EIVA 2BE5D 2D9UA 3IAYA 2C35B 2KENA 2HT1A 4IZ8A 4JV5L 1FGUA 5IT9c 2ID0A 5FJ8H 3ITPA 1SNMA 3I70A 2IX0A 4RCOA 1Q46A 4PQXA 1QVGA 3I4MG 3A54A 2A68C 4XDXA 3CCUA 2P5ZX 4HCSA 1BCPF 1B1ZA 2B63G 5JJIA 1C0AA 4ZLTF 1NCVA 1SDFA 1UE5A 1FGBD 2F3VA 3KLRA 1EYCA 2CHBD 3FMCA 4NMZA 3HOXH 1YZ6A 1B70B 3U4VA 5BR8Q 1EYGA 2CKZB 3K7AB 4C2MB 1JR0D 2MUYA 2NZHA 1EIYB 2MO1A 4CGYB 1HQMC 1TT2A 1MJCA 4XYOA 2F03A 4DV2L 2UXDL 3NENA 3R8BA 1LT6D 1B53A 1YNXA 1LTRD 1I4XA 3M7GA 1NR4A 5I6WA 1PH2A 4B9WA 4AIMA 2WP8J 5H1SE 4BA2I 4OHJA 3HP3A 5I2XA 1S5BD 3U58A 3K57A 5IGEA 2FINB 4K6DA 1CZGA 1RJTA 3JAMc 1EIHA 2BH2A 3OPOA 4AYBB 1L1OB 2XGTA 3HEJA 1Y1WB 5ELFA 1VQFA 3F8TA 3OMGA 3S2DB 4RMFA 2ZXPA 4N9TA 2KUMA 1BR9A 3IRBA 3L3OC 1I50B 1CKNA 1P8LA 2RKSA 2EDGA 1VDZA 2LSSA 1WOCA 4TVAB 2NN6G 1RCVD 4RA8A 5E3FA 4UP7A 4UP9A 3I4NG 3RMHA 3CRLC 2BOSA 4C3JB 4UHVA 1C8CA 1SYEA 3VR4A 1HCZA 2ICEC 5M3MH 1WCMB 1L0XB 4CHTB 5KNBA 1LT4D 4ILWA 3RZOH 2G9DA 5LMNQ 2AKWB 1STNA 3M4OB 4OIJA 1HXYD 3W1GA 1H9SA 4LF8Q 1CSQA 3CKIB 3GTQH 5HGTA 3L2PA 4DV6L 1XPOA 1I94L 2R93B 1VMPA 5I9OA 4DNRB 2R7DA 4P71A 2HUGA 2Z8LA 1A3UA 4JI8L 1OXXK 3SGIA 3I8ZA 1X3PA 1O7IA 1PRTD 3DMUA 3R2TA 4DR3L 5K36H 1EWHA 1PTOB 2CVRA 3A0JA 1BF4A 4NDXA 1PHJA 1T5EA 1K3RA 2CW0D 4NXNL 2Z0SA 5J1ZA 1IW7D 1IKMA 3T16A 4L5RC 1TWGH 1SN8A 2NBFA 4GN3B 4A3KB 5NUCA 1W6KA 4KK7A 3OHXC 1HTLD 3ERQA 4EX5A 1BKBA 1X9NA 2PI2A 3NEMA 4LW1A 3T13A 2G5DA 3G6EA 5E4WC 4KD3A 4V190 1HRJA 3VR6A 4R8IA 3GTPB 2EXDA 5CV7A 4HEDA 4GS3A 3TEHB 1WCMH 3KBGA 3C3LA 4X3KA 4DV4Q 1PH3A 5J3BA 2NVQH 1Q1BA 1JWSD 1CKOA 1A62A 4DR7L 1FYCA 1SMYD 1OO9B 1SE3A 1N34Q 1I6HB 3S1QB 1CA6A 4JYAL 4XQJA 2Z4IA 5M5YB 2F0TA 4X6AH 2FFKB 2IPKD 3GDEA 4LJZC 3CCVA 1LO5D 5ELNA 2FJ2A 4A3BG 2EY5A 3KYHC 4DR6Q 3RN2A 4GKKQ 1BBXC 1V9PA 1PTOH 2FMMA 2X6LA 5CV8A 2R6GA 3HOWH 4LNQA 2H1EA 3SR1A 2HCIA 1RL2A 1A2UA 2NVYB 3MXUA 3H6MA 2F4VL 3F2CA 5TSSA 3GTKB 4LFBL 2JA9A 4A93H 1HTPA 1YNNC 2K7VA 4A3IH 1O7LA 4JBJA 1NNXA 5C0XH 5IYDH 5LMUQ 2A6HD 2EY1A 3S17H 4IUQA 3NP8A 1X3QA 4WORA 4HTHA 4HIKA 4A3JB 2EQSA 1SEBD 3CC4A 5M3FG 1UE6A 2I07B 5C3EG 3F2DA 1BCPB 4L6TB 4LF4Q 4C56C 5EPLA 1K28A 2F3WA 4KN4C 3SVMA 3TP7A 4OEMB 1QOHA 4HJ8A 1ENFA 2ZT9C 2Z6KC 3A7LA 3I4LA 1Y1VH 5CV6A 4BY1B 1A8VA 1L1OA 2VY3A 3M4PA 2F0IA 2AWOA 3NTKA 1GHJA 2LXKA 1OXVA 1EY9A 3UI2A 4WFN3 2DJFC 2F0OA 3E9HA 1Q90A 4DPGA 1XXGA 4BA1I 1E22A 1PFNA 1OXTA 4RKLA 4B3MQ 1K0RA 1RF2D 5BN5A 3C2PA 3F2BA 1XMOQ 2QF7A 3K59A 2L15A 2BE5C 2O2LD 2B2UA 3NSWA 5FOBB 3J7ZC 5BN4A 4AYBG 3TN2A 5IYCG 1YIJA 4RG1A 3T1YQ 1F2LA 1Y1WG 5C44G 3JAME 1I4RA 4B3TQ 4LF7L 1UEBA 3MEHA 4Q0FA 5EBCA 1SYDA 1N33Q 3STBC 2X6GA 5GAEC 2K5WA 4KHZA 4PZ6A 1EOTA 2O5JC 2AHOB 5IGGA 2NVXH 2G9HD 1SLJA 1O7YA 2PQEA 4X3TA 5I6YA 3ONAB 4QIWE 5IGDA 1UE1A 1PZJD 2EYLA 4C3JG 5C4ZA 3FPPA 1T9HA 2B2TA 2QGQA 1NMGA 3GV6A 1HZCA 1WTWA 3E5SA 1JJ2A 2E2DC 1Z6HA 5ELEA 1NAPA 3T4AC 2JA8B 2RQXA 3I73A 2PMZB 4DK6C 1PMRA 4BXXH 1PFSA 1QUQB 3KF6B 3ZJYC 2D0OA 4ZQ3A 4X62L 3Q22A 2CH4A 4X66Q 1W3SA 1EY7A 1PYSB 2JEAI 4A3GB 1NY4A 3K81C 1I4QA 1YBYA 3BYTB 2R93G 1JQYD 2JSOA 4O42A 4RGMA 2E2IH 1AE3A 1LTSD 4I7AA 4P75A 4FO2A 1N32Q 1XPRA 1CZWA 1AEXA 4FXDA 5C4XH 1U0LA 2E5LL 1HZ9A 2RDFA 1NSNS 2XTIA 3GV3A 3HGBA 5CR3A 4G7HC 3AMUA 2KECA 2JA5B 4U673 3PO3H 1VS0A 1QB5D 1N36Q 1AW7A 1FR3A 3WDNA 2VS1A 5IT9L 1VQHA 4HR7B 5KGUA 1VQ6A 3HOVB 4EQNA 1G6ZA 4GLVB 2Y0SB 5JPNC 1S5CD 2E76C 1ESRA 4L5QA 4JI3L 4ZK9B 1GUOA 1TIID 4AQYL 1UAPA 2Q2UA 1CK1A 1LUZA 2EYPA 1RD9D 2K5QA 1TKWB 3KK7A 5JJZA 1A2TA 1EYDA 4DR4L 3NTHA 4K2KA 1STHA 2KCMA 2MHVA 3OMCA 3H3VI 5ELBA 3PIPA 4R4OA 1DOMA 4YHHQ 3NBIA 2IX3A 4A3GH 3S16H 3KDFB 1DM0B 2CQOA 4IPDA 2BDOA 3HKZB 4ZKCB 1EQQA 1JMCA 4PMCA 4OWWB 4GLXA 2RF4A 3D4RA 4LF5Q 1LTGD 3ER0A 3HOUG 1VQPA 2E2HH 1WTVA 2ZM6L 2F3IA 2PI2E 4JW0A 5IODA 4GNXB 2Z6BA 1D8LA 4FXGC 5ELOA 2YU9H 1TVXA 1G51A 4GKJL 5C6AA 2I5LX 4BBSB 2IY5B 4A3MH 3I4OA 3NELA 1UNSA 1LYLA 4X64L 1EEFD 1O7ZA 2ZJPA 3C1FA 4J1MA 4DV7L 4BY7B 1AH9A 3FP9A 1V1PB 4P74A 2F0JA 2OT2A 1GKHA 4IFDI 4Y7NB 1PRTC 3C1EA 3GO5A 4DR3Q 3OIPA 5JEAG 3DEPA 3PIOA 2CW0C 1FL0A 4O0AA 4OELB 1IW7C 4IOAA 4A3JG 1VQMA 4E6IA 3JAML 4APVA 4N8X1 4KV6A 5I4DA 3N52A 3CCQA 3KOJA 4KLKA 1WTOA 4MTKA 2RCFA 1SE8A 4K8JA 2OEOA 2JYOA 1PZID 1CI3M 4BY1G 1VQ4A 1TU2B 1T5XD 1ASZA 5CV5A 5L37A 4HJ9A 4OL7A 2RDGA 5T1IA 1SMYC 1Q82C 1KD1C 1ENAA 1I5FA 4XQNA 3GP7A 2BH8A 4DFAA 2JA7B 1MIUA 4JI1L 3TDQA 3E6ZX 1ZKOA 2UXCL 1IYVA 1SE2A 1A15A 4IUPA 3UDGA 1STBA 1J9OA 4DUZL 1JOQA 1EQVA 3K5NA 4C3IB 4OX9L 1JB3A 1D5MC 1RODA 4H0LC 3U50C 4QIWB 1PH8A 2IHEA 5EKKA 2WACA 3I4MH 3KF6A 1QUQA 4KN7C 4DR1L 3I56A 4LFBQ 2GVAA 3PUWA 4M1UB 4PNYA 2UUAL 3S14H 2B63H 5EQ0A 3J80i 4LK1C 2A19A 2JA6G 1XJVA 3NWTA 3WOEA 4B08A 1I3QB 3M9BA 2B2WA 4A3EB 3OW7A 4CDDC 2JA8G 1PA6A 4IJHA 2ATWA 3J81j 3GTLH 3WWVA 2V1CC 3MFGA 1EWCA 1BQQT 4R8NA 1PTOF 3GTGH 2C9OA 4KHPL 3D6CA 3MXPA 4X3UA 2PO4A 1HUMA 1KL9A 2F0VA 3J81c 1QCBD 4BBRH 1YNND 3DLLA 4RHSA 3VR5A 2VZAA 4A3CG 4J6HA 4KI0A 4LFAL 2OTJA 3NBHB 1JJGA 1K0SA 3HZXA 1EY0A 1HPCA 5HURA 4ZCKA 3LWEA 1ICFB 4C1NK 1H9MA 1EWIA 1XTCD 1FJGL 5E4XA 1S4ZA 3I91A 1EU4A 1SR3A 5T1GA 3KDFA 5C3XA 4JI5L 2XVSA 3M85A 1AN8A 1N9WA 1JWMD 2VB3X 2IT1A 1BCPD 3AFPA 4WJWA 3TQYA 1TS4A 3I72A 1Q86C 2UUBL 3S15H 1WJJA 4R4CA 4ZKBB 4PMBA 4GNXA 3AQQA 3HOXB 2PNHA 2R61A 4JI4L 3JC66 2AUKA 4L8JA 2NN6H 1JWUD 2K03A 4UP8A 3I4NH 1XMQL 1IKLA 3HS0C 4LF9Q 3T1HL 2XRSD 2Q2TA 1TXYA 3K58A 1H95A 4QB4A 1FNUA 1ESFA 1V1PA 2N8NA 4YWKA 1AFPA 4POGA 1JT8A 2ZTEA 2QILA 2HDLA 1PH9A 3MFYA 4C3HH 1LTLA 4OONA 1YHBA 2BA1A 4ZRZA 5IE8A 4YIJA 1KC8C 3V96A 1V1QA 2UUCQ 4X62Q 4QUCA 1STAA 2WAQE 2UXBQ 2EY2A 2D62A 3EJIA 1N8RC 1AP0A 1MI2A 1TY2A 2KEDA 3STBD 2SOBA 1VQAA 1RKNA 3NQTA 1QZHA 2VUMG 4BY7G 1IBKL 2JQOA 3P75A 5IYBG 2LS01 3CXCA 1HHVA 2K5DA 3SXHA 2PYKA 3TREA 1AZPA 4A4IA 4N8FA 2N3SA 4LUVA 3URYA 4HJ5A 4L63B 3FRPB 4B3RL 3O13A 1KTKA 3VA5A 1JICA 2DN8A 1H9JA 1D5ZC 1MJEA 2N49A 2Z1CA 4PG3A 2R7ZH 2EJFC 3SEBA 2V4DA 2B39A 1YNJD 1IBLQ 3KLSA 4GLAC 1MHWC 2VQEQ 3QR8A 1TY0A 4YCUA 5M3MB 2CWAA 1X32A 1D2BA 3BDCA 2KJXA 1SXTA 3CCEA 3RZOB 1TQOA 3A8JE 4I65A 4KTAA 2OWOA 4IQZA 2K5NA 3NTIA 4Z9CB 1QE6A 5C0XI 3GTQB 4A3LG 1WI5A 3RNUA 1B9NA 4JI0Q 5ELDA 2NTSA 4A3BH 2KCNA 3PSIA 5KYIA 1X3GA 3VYSA 4C3IG 3CRKC 2L5TA 1KDAA 4X65L 1B8AA 3CF5A 2WIIB 1F2YA 3UE0A 3GQBA 5C3WA 3GD7A 1UWVA 4DK3C 1K8GA 2F0GA 4OO1G 5IP7G 1L1OC 4GKJQ 4UDUC 2IL8A 2OTLA 4HJAA 2GN5A 1TWGB 1QVCA 4DV7Q 3H0GG 5IWAL 3QIAA 4RGNA 5CV4A 1VQ5A 1C48A 1UUPA 4A76A 2RHQB 2LY7A 1G2TA 4K5VA 1EZ8A 4DAVA 4JI7L 2B2UC 1LLRD 4MTNA 4A3EG 1EFWA 2NVQB 2NVTB 4IFDG 1GJXA 3NBHA 2ALYB 2QW7A 3RLNA 3RLOA 2F0PA 3BVGA 5KYLA 3KUPA 2L0CA 1TS2A 2PMZE 1ET6A 2RDHA 2M9VA 4GZYC 1GVPA 2Z4HA 3OWFA 2DJGC 4R1JA 5D14A 1IYJB 5FLMG 1NMFA 1EIGA 5I9PA 1SFOH 1LM0A 2B2TC 3J81E 3HOWB 3J80E 5DNFA 4JPBW 4JI6Q 5FJ8G 5KRUA 2FXQA 2IW3A 5FK9C 4AH6A 1JE5A 4JI1Q 1JORA 3E0JA 1PFBA 4IUNA 1SNCA 4ABNA 4K0KQ 3MA2B 1V8QA 4DN4M 5A2QE 1CM9A 2WKCA 4OX9Q 4A93B 1DGSA 1A6XA 3NXWA 1PYBA 4A3IB 2R92B 5DAUA 1ILPA 1YJNA 1XNQQ 3S17B 2L12A 5KEEA 3H09A 2Y0SE 1XX8A 3HOXG 4ODGA 2NVTH 1CSPA 4XYQA 3H15A 1XTDA 4DK1A 2UUAQ 3MTSA 2BCOA 1JOKA 2VNUD 1Y1VB 2DNEA 3C46A 2EPBA 1GM5A 1EIFA 2WAQB 1K83H 2KVMA 3HKZE 4PMWA 2WB1E 2KA7A 4F87A 1KAAA 4FVMA 3AFQA 3Q8DA 2HHHQ 1B3QA 3KF8B 1UE7A 4ZAIA 2DNCA 2A74C 5CMDA 4DXGA 2BA0A 5GADC 1HNXL 2VL6A 3DXJC 3G6JB 3HOZH 1XNRQ 1TWHH 1Y69U 2R92H 3PUZA 1TR5A 1SYFA 2Q8RE 1XYIA 4YY3L 4A3FH 2PCFB 4B3SL 4LFAQ 4UY8C 1HA5A 3NUCA 1DXMA 3MEFA 1CA5A 5KIXA 3AB9A 2K52A 3BVZA 2F0NA 3E9IA 1FJGQ 2NVXB 3K8AA 4A3DH 3CCRA 3IFTA 4JI2Q 5HGQA 2CH4W 4JI5Q 1BXTA 1BCPC 1E1TA 2VQFL 1WD1A 1Z9FA 2IX1A 2UUBQ 4OGQC 3ULLA 3NWSA 3TP6A 1X56A 4K5WA 3QOJA 3MVVA 1YEZA 4ZUIA 5M3MG 4JI4Q 2LXJA 1L0WA 2A1AA 3HG9A 3S1MH 1D6EC 1EOVA 3KLSX 3P1HA 3SK5A 2QCPX 2RVLA 2ENBA 2SNMA 5CBEE 1GO3E 2A6EC 2RHSB 4OIKA 5JEAJ 1I4GA 1WVLA 1BBUA 1S40A 1IXRA 3I90A 3HOUH 5JJKA 2NZOA 1YI2A 3SK6A 1HNZL 2E2IB 1GXDC 1HNWL 3KBXA 1GUNA 5C5LA 3EROA 4JV5Q 1W2BA 1VQ7A 2EYHA 1E2WA 2EVBA 5LL6X 2Q2IA 5K36G 3OTOL 5C4XB 2N88A 3D31A 1DD2A 3MHBA 1UEAB 4DAPA 2RA4A 1VF7A 5I2YA 1IZ6A 1WYDA 1B3AA 3DWPA 2DY8A 3LWUA 3PO3B 1Z47A 2NUCA 1IBKQ 3GTOH 4GN4B 4DV3L 1S72A 1STEA 1STGA 1KIXA 4Q5VA 1JB7A 4JG2A 5AJ3L 1EQRA 4KJNA 5IP9H 1A63A 2KHSA 2ZTCA 4C1NI 5JEAH 1E1OA 1VQIA 3PIO3 3FKIH 3PO2B 1WCMG 4B3RQ 2K04A 2YYZA 4KHVA 2D2CC 5D3DA 3G7LA 2E2JH 1F77A 3BJUA 4DV2Q 1KNEA 2UXDQ 3IFDA 4CDFC 3S16B 2NTTA 4HIMA 1YNJC 1JOOA 1MKHA 1SAPA 1SYCA 2C5CA 2XNAC 2E2HB 2RCNA 4H02A 2EYFA 2MFIA 1JE4A 5JVG3 1NTGA 3HOYH 5CBAE 3HOWG 5JOBA 1PH1A 2YU9B 1Q7YC 1KHIA 2B2WC 3RR5A 4A3MB 3G4SA 1MBYA 2R7FA 4QMGA 1ILQA 4A3KG 4NKLA 4A93G 5A35A 3I3CA 4A3IG 2WKDA 4H44C 4Y52H 1XPUA 5C0XG 2IWHA 5IYDG 2A73B 3CC7A 1BOSA 2GA4B 3V05A 3PO2H 4QQBX 5EAYA 2OQKA 3PGZA 3BU2A 4KY6A 3TP8A 1II3A 4HIOA 5BR8L 1ICWA 3KF8A 1NE3A 2JP1A 2XRQD 2K05A 3DWAA 4JOIA 4PV1C 3I55A 5FLXc 2X69A 1EU3A 1WTXA 1U5KA 3H91A 2WB1B 4MNOA 1Y1VG 3PCOB 3D3RA 1CQVA 4YCWA 4ZYSA 2WAQG 1Q8IA 4JVZA 2F0DA 4WJ3M 5G3LF 5KNCA 1CKMA 2EOTA 1PLFA 1FD7D 4GNXC 4DK0A 4DV6Q 2EYMA 5HY6A 1I94Q 3CCSA 5IGFA 1VQOA 4I7ZC 1VQ9A 1EY8A 4HMJA 1NJIC 3OSOA 1B50A 3CCJA 4JBMA 4JI8Q 1H9RA 1SYGA 2NN6I 4CBVA 3U4ZA 5DM63 2MNAA 4R4TA 4KD4A 4F8MA 4A3CH 1EYAA 4NXNQ 1K8OA 3PUXA 3K6OA 1D1KA 4KY7A 1ASYA 1WTPA 3ULPA 1GUTA 3F1ZA 2ZJQA 5GROA 3I4MB 1LTBD 2JN4A 4HSVA 1G291 1ZXTA 4QCLA 3CD6A 1G91A 4DXFA 3R3OA 3S14B 3EQLC 1LTTD 2B63B 1HH2P 1TWFB 3KJPA 3G71A 3MAQA 4HN7A 3CW2C 3PF5A 3TZDA 1F9QA 1B44D 2MO0A 3ERSX 5COYA 2L4NA 4LFCL 1BNZA 4DR7Q 2F0WA 5LMNL 3RUZA 4BXXG 2ZTDA 3GTLB 2I46A 4LF8L 4FF3A 4JYAQ 3B6YA 2ZXRA 1OXUA 2MJ8A 1DONA 2B2VA 3GTGB 3W3AA 1PTOD 4QUFA 1BDOA 3AYHB 2XN9C 1U4PA 3S1NH 2QDLA 4BBRB 2K6AA 2WFWA 1PZKD 1C9OA 1JCKB 4RGOS 1DZ1A 5C4XG 2K5HA 4U68A 2HIVA 1G6PA 3TZUA 2FMCA 5DLQE 2F4VQ 1HNXQ 1RTNA 3EN2A 3TSSA 2VUMH 3PO3G 4P2CB 2VW9A 5C4JH 2K75A 2EZVA 1IL8A 1YHQA 1D7QA 1TWFH 3K5OA 5IGBA 4GOPB 4FF2A 2NZ1D 4K6LA 3S15B 1S3OA 4KJOA 2MGSA 3DM3A 2I5HA 1VQCA 3D0FA 4DF7A 1D1IA 1HQRD 1A0IA 3CU7A 1LT5D 3I4NB 1E3PA 4HCEA 4LF6L 3MXNB 2ICIA 2Q2HA 2L55A 4A3GG 2VQFQ 4K2LA 4LAAA 1GUSA 4BS9A 1VQKA 4C3HB 3J80c 3A7AB 1R9TH 3PUYA 1TS5A 3P7JA 2GVBA 4EGVA 4QGUA 1QNUA 2ES2A 1HFGA 2KEEA 3PUVA 2HD3A 1RIPA 1TWAH 3R2IA 4CJ1B 2F0EA 4LWCA 2EE1A 2JA5G 4GN5A 4HIDA 4NXML 1X3EA 2SEBD 1HNWQ 3FEWX 4IFDJ 3HOVG 2QKIC 5D3IB 2Y0SG 4LF7Q 4F7XA 5IP7H 5LMUL 4N9PA 1NR2A 3K0YA 4G4KA 1DJRD 3QOLA 3M4QA 4MN3A 3W2DA 3W1BA 5J39A 4IUTA 5LHY1 3H0GH 4XXEA 4R9WA 3S1RH 1PXUA 1BVSA 3TMEA 2EYJA 4K8IA 2R7ZB 2XWBB 3MZ5A 2A6ED 5LMNW 3HKZG 2WB1G 5FLXE 1K9MC 4IPHA 2K5VA 2WV6D 1Q12A 1RDPD 3SDZA 3GTJH 1W6JA 1XWEA 3SE0A 2E75C 5F2DA 3VYRA 3IKJA 3M3YH 3QWNA 4B3ML 1EY6A 4X3SA 4BBSG 4QJFA 3CMAA 3SHLA 3DHQA 3TRZA 1EZ6A 4A3BB 2CFMA 3FHWA 3L0OA 1B9MA 3ND8A 3ZYYX 3T1YL 2HDMA 4P73A 2F0LA 3VR3A 4B3TL 2E5LQ 4NB3A 2F0QA 3CQZH 2OXPA 1N33L 1Y14B 2FHTA 4K5XA 4HSPA 4FNFA 3PQIA 4FP5D 2F0KA 4S3SA 2AUJD 4JI3Q 2MPMA 5FO8B 4AQYQ 1DCZA 4HMIA 3UDXA 1H9KA 3PF4A 2JJQA 2K28A 2AWNA 5M3FB 1M8AA 4IALA 3QO2A 5C3EB 4DR4Q 2LKVA 3MXGA 4FF4A 4IN3A 1CT1D 5CYUA 5M5WB 1VF5C 3RZDH 3JAMi 3K7UC 2A8VA 1EQTA 1LTID 5C5MA 3S2HH 2PW5A 3OWEB 4V0BA 3TS0A 2JA7G 4X66L 5EGTA 2CWPA 2A69C 2PQAB 1GUWA 3A56A 1OXSC 1Y8NB 3CP0A 3PV0A 4LUOA 3EVQA 4NW2A 2EYOA 1VQEA 2ZM6Q 1AZQA 4GOPA 4BBRG 1SFOB 3D6WA 2AMCB 4DA2A 1R4QB 4ULLA 1N32L 1HFNA 1SNOA 3R93A 4KKSA 2O5IC 4DGZA 5CORA 1Q81C 1SYBA 2KCCA 2Q8IB 4X64Q 2EIFA 2DY7A 3VDYA 3EA6A 1O78A 4IURA 3L9AX 2F0MA 3MXNA 3BDOA 1PDQA 1N36L 2RSOA 1J6QA 5C44B 3OOCA 3H94A 4IUUA 1BBWA 3D8GA 4RCNA 4RFBA 4XT1B 3T51B 4K14A 2F0UA 5M3FH 5M9OA 2B29A 1ONLA 5C3EH 1I4PA 2XSCA 1LTAD 1YJ9A 4PZ8A 5M5WH 2ZJRA 2OCEA 3K7AH 4C2MH 1PH5A 3QG1A 3X3NA 1D5XC 2JXMB 1J5EL 4DV0L 2PPBC 4YHHL 1G8ZD 4LUZA 1IYUA 1SJHD 5ISRA 4LF5L 3DEOA 4LFCQ 4FF1A 4C3HG 4XIGS 1C7YA 1K83B 5EJWA 3UE1A 2ASBA 3CHBD 5FLXL 4DV5L 2F0HA 5GAHC 1E0BA 1PTOC 3CCMA 2UXCQ 2KHIA 4L5SA 3QJYA 2KCTA 3FVQA 5EBDA 4DUZQ 2TMPA 2DGYA 3LNNA 2NWGA 4ID6A 5IYCH 3HOZB 4HJ7A 1IL2A 1TWHB 1Y1WH 5C44H 3X3MA 3S2DH 3J7AV 1ET9A 4A3FB 1HUNA 1MSHA 4IJLA 4CDCC 1QNKA 3U9OA 1KABA 2JEBI 2HCCA 4CJ2C 1I50H 3A55A 3DUZA 2B2YA 1K8MA 1VQNA 4DR1Q 1F2ZA 3K0XA 3OIQA 1Z7TA 4FDBA 4A3DB 2R7ZG 2B8GA 4C3JH 5JPMC 1V43A 2H5XA 2D0PA 4DR2L 5IGCA 2K01A 4J8QA 2J0TD 3NQIA 3QB3A 2KHJA 1LACA 3S1MB 4XTCS 2PNRC 1RHPA 5ELCA 3M4OH 1M90C 3P20A 1F9RA 4LF6Q 3K5LA 2J7ZA 4DR5L 4TQUS 3OYYA 3VR2A 5E1FA 2OF1A 5C0XJ 1VCIA 1R4PB 4KHPQ 2KBNA 1HA6A 2BDNA 2R93H 1E7ZA 3HOUB 1U9RA 3A74A 5KNDA 1Q1EA 1PRTF 1DYQA 2B3GA 2TSSA 2HQEA 4JOIC 1QVFA 2JK8A 1P16A 1WTQA 1Q3LA 4DUYL 1MD2D 2PZWA 2D5DA 4DKAC 4HAEA 5IT9E 4MHEA 3Q6SA 5FO7B 4B9XA 4DV1L 4G7ZC 4A3KH 1DOKA 4NXMQ 3GTOB 3LX0A 5IY0A 4OWTB 4POFA 2PQAA 3SK4A 1HR0L 1L0YB 3FKIB 3GTPH 3T53B 5EKIA 4QF4A 5IOCA 3CMEA 2Z9HA 3D4WA 2F52A 4M8AA 4RGTA 5C4HA 2CQAA 3E3XA 1XMQQ 3ICEA 4TRDA 3PIP3 2E2JB 3T1HQ 1I6HH 3S1QH 5AFWA 5M5YH 3ND9A 1VQJA 4YWMA 2UU9L 1X6OA 1WTRA 2J4XA 1FNWA 1EL0A 2AQ3B 4UAIA 3BZKA 3HOYB 4DAYB 3I2ZA 4ME5A 1HZAA 1JJCB 3VA7A 3MWYW 3MC0B 4H7BA 1CHQD 1QILA 1O80A 2YTXA 4IPGA 3WOFA 3AEVA 3L7ZC 5BN3A 1GHKA 2NVYH 3J81L 3J80L 3NK9A 1IBML 1OTCA 2I5MX 3GTKH 1LV9A 2AQ1B 1TS3A 4CKBA 1WD0A 1X3FA 3HFZB 4CKCA 1F9SA 1QG7A 5CV9A 3J7YW 2B2VC 3K5MA 1CQFA 2I0QA 2LMCB 1Q8KA 3NPPA 5A2QL 5GAGC 1PH6A 3K80C 1GD7A 4A3JH 1KAWA 1F2MA 2SNSA 1CHPD 1YJWA 5LL6S 1M1KC 4QL5A 5EPKA 3I7FA 3NHHA 1E24A 2QEXA 4LF9L 2JA6B 4EQPA 4BY1H 3IL8A 1U4RA 2B8FA 4NPSA 1SNPA 3A5ZB 1PV4A 1ZYRD 3M7NA 2KOLA 5FKAC 1B7YB 4RAUC 2MQHA 2EXZA 2YTVA 2EJMA 3PMFA 2PZUA 5G3LD 1X65A 2UUCL 4IOCA 2WINB 4JC0A 2UXBL 4CKEA 2R3ZA 3LGJA 3A8KE 3BDLA 2M00A 2EY6A 4LMQD 3Q24A 1GUGA 1SRUA 2A68D 3HOZG 2E8GA 4X65Q 2JE6I 3UDFA 2R92G 1EFID 1U4MA 1VQGA 4A3FG 1E2VA 1EUJA 1AE2A 1KDBA 2O4XA 4FXKC 1VMCA 4DU9A 3TP5A 5J22A 2K14A 2K33A 4RKBA 5FO9B 1KLUD 4R4IA 3KLWA 1HR0W 5IWAQ 1KRTA 4MZ9A 4A3DG 1VQDA 4G57A 5CC4A 1PYWD 1E2ZA 3CPFA 3KFUA 1EEID 2EJGC 2F0FA 1K73C 1S5ED 4KKTA 3N6RA 2QEJC 2JA6H 2VXWA 2YV5A 4JI7Q 2A69D 3T56B 1IBLL 2VQEL 1PH4A 3CC2A 4BWGB 3W5OA 2JA8H 1SNDA 4KKUA 3J7AF 1SNQA 2OQ0A 1I6VC 2K4KA 1HZBA 1J5EQ 4DV0Q 4OO1I 3HKSA
chains in the Genus database with same CATH topology
2QDBA 2N55A 4EQOA 2F4IA 4EVOA 3BVMA 1FNVA 2MP1A 2NYZD 2PZTA 3S1NB 3FDTA 1NUCA 5DEHA 3D4DA 4MIUA 1B2TA 1EY4A 3U9SA 2XWJB 1PFMA 1PRTB 1S5FD 3FPUB 1QJOA 4XQQA 1TWCB 2VUMB 3BG3A 1C4QA 5C4JB 5IIFA 1GOZA 1CFMA 3DWQA 4JK1C 4KY5A 1KDCA 2RSNA 3Q23A 1A3VA 4NP5A 4TKOB 1SE4A 4XT3B 4DAYA 2KQ3A 4O1NA 1I4HA 5JVH3 4RH6A 1Y8PB 2E74C 3V2TA 2L11A 5D65A 2XIWA 3EFXD 1MGSA 1STYA 5M5XB 1R9TB 5EPJA 3SK8A 3M4YA 4JBWA 3H3VC 1B4OA 1JC7A 1ENCA 4KMUC 1TWAB 2Q8TA 3GTMB 4IUVA 4RHRA 5EKLA 1LABA 1CTMA 3S9WA 1IHZA 1SBBB 1LT3D 2M2LA 4CJ0B 1BUVT 3Q0AA 1QWYA 1G2SA 3H0GB 3S1RB 2A5HA 1MSGA 3RD4A 3RLFA 1DOLA 1ZEQX 2RBMA 2A6HC 2K32A 4F88A 5K5PA 2PW7A 1EY5A 4ZUJA 3GTJB 3A8IE 1V1OA 2NB0A 5DM73 1SJED 3M3YB 3VYUA 2L9HA 1Y8OB 2L1BA 3AU7A 4OO1H 4TSSA 1U4LA 1M4VA 3F2UA 3CQZB 1H9SB 3HRZC 2F1MA 1KNAA 4FYDA 1SSOA 2SDFA 1BO0A 4H13C 3TBIB 4DNTB 1S5DD 4G7OC 3BZDB 4WRDA 3DM1A 5CGKA 1J8IA 4IFDH 2F0SA 1RTOA 3NE5B 2AQ2B 3VYTA 1A3TA 2H4OA 2LFNA 1ML0D 3BYYB 3RZDB 1KLGD 2ZXOA 3S2HB 4RWSC 2B2YC 2VB2X 5JAVA 1F9PA 1ZYRC 3BS1A 2IJ0A 2K1BA 2BE5D 2D9UA 3IAYA 4IZ8A 2ID0A 3ITPA 1SNMA 3I70A 2IX0A 4RCOA 4PQXA 3A54A 2A68C 4XDXA 4HCSA 1BCPF 1B1ZA 4ZLTF 1NCVA 1SDFA 1FGBD 2F3VA 3KLRA 1EYCA 2CHBD 3FMCA 4NMZA 3K7AB 4C2MB 1JR0D 2MUYA 4CGYB 1HQMC 1TT2A 4XYOA 2F03A 3R8BA 1LT6D 1B53A 1LTRD 1I4XA 3M7GA 5I6WA 1NR4A 4B9WA 2WP8J 4BA2I 4OHJA 3HP3A 5I2XA 1S5BD 3K57A 5IGEA 2FINB 4K6DA 1CZGA 1RJTA 1EIHA 3OPOA 4AYBB 3HEJA 1Y1WB 5ELFA 3OMGA 3S2DB 2ZXPA 4N9TA 2KUMA 1BR9A 3L3OC 1I50B 2RKSA 2EDGA 1VDZA 2NN6G 1RCVD 4RA8A 5E3FA 3RMHA 3CRLC 2BOSA 4C3JB 1C8CA 1SYEA 3VR4A 1HCZA 2ICEC 1WCMB 1L0XB 4CHTB 5KNBA 1LT4D 4ILWA 2G9DA 1STNA 3M4OB 4OIJA 1HXYD 1H9SA 3CKIB 5HGTA 2R93B 1VMPA 5I9OA 4DNRB 2HUGA 2Z8LA 1A3UA 1OXXK 3I8ZA 1X3PA 1PRTD 3DMUA 3R2TA 5K36H 1EWHA 1PTOB 2CVRA 1BF4A 4NDXA 1T5EA 2CW0D 5J1ZA 1IW7D 1IKMA 3T16A 2NBFA 4A3KB 5NUCA 1W6KA 4KK7A 3OHXC 1HTLD 3ERQA 3T13A 5E4WC 4KD3A 4V190 1HRJA 3VR6A 4R8IA 3GTPB 5CV7A 4HEDA 3KBGA 3C3LA 4X3KA 1Q1BA 1JWSD 1FYCA 1SMYD 1OO9B 1SE3A 1I6HB 3S1QB 1CA6A 4XQJA 2Z4IA 5M5YB 2F0TA 2FFKB 2IPKD 4LJZC 1LO5D 2FJ2A 2EY5A 1BBXC 1PTOH 2FMMA 2X6LA 5CV8A 2R6GA 2H1EA 3SR1A 2HCIA 1A2UA 2NVYB 3MXUA 3H6MA 5TSSA 3GTKB 1HTPA 1YNNC 2K7VA 1O7LA 5C0XH 2A6HD 2EY1A 4IUQA 3NP8A 1X3QA 4WORA 4HTHA 4A3JB 1SEBD 2I07B 1BCPB 4L6TB 4C56C 5EPLA 2F3WA 4KN4C 3SVMA 3TP7A 1QOHA 1ENFA 2ZT9C 3A7LA 3I4LA 5CV6A 4BY1B 2F0IA 2AWOA 3NTKA 1GHJA 1OXVA 1EY9A 3UI2A 4WFN3 2F0OA 1Q90A 1XXGA 4BA1I 4RKLA 1PFNA 1OXTA 1RF2D 5BN5A 3C2PA 2QF7A 3K59A 2BE5C 2O2LD 2B2UA 3NSWA 5FOBB 5BN4A 3TN2A 1F2LA 3JAME 1I4RA 3MEHA 4Q0FA 5EBCA 1SYDA 2X6GA 2K5WA 4KHZA 1EOTA 2O5JC 5IGGA 2G9HD 1O7YA 2PQEA 4X3TA 5I6YA 3ONAB 5IGDA 1PZJD 2EYLA 4C3JG 5C4ZA 3FPPA 2B2TA 3GV6A 1WTWA 3E5SA 2E2DC 1Z6HA 5ELEA 1NAPA 3T4AC 2JA8B 2RQXA 3I73A 2PMZB 1PMRA 4ZQ3A 3Q22A 2JEAI 1EY7A 4A3GB 1I4QA 3BYTB 1JQYD 2JSOA 4O42A 4RGMA 1LTSD 4FO2A 1CZWA 1AEXA 4FXDA 2RDFA 1NSNS 3GV3A 3HGBA 5CR3A 4G7HC 3AMUA 2KECA 2JA5B 4U673 1QB5D 1AW7A 1FR3A 3WDNA 5IT9L 5KGUA 4HR7B 1G6ZA 3HOVB 4EQNA 5JPNC 2Y0SB 1S5CD 2E76C 1ESRA 4ZK9B 1GUOA 1TIID 1UAPA 1CK1A 2EYPA 1RD9D 2K5QA 1TKWB 3KK7A 5JJZA 1A2TA 1EYDA 3NTHA 4K2KA 1STHA 2MHVA 3OMCA 5ELBA 1DOMA 3NBIA 2IX3A 1DM0B 2BDOA 3HKZB 4ZKCB 4PMCA 3D4RA 1LTGD 1WTVA 5IODA 4FXGC 1TVXA 5C6AA 4BBSB 1UNSA 1EEFD 1O7ZA 3C1FA 4J1MA 4BY7B 1V1PB 2F0JA 2OT2A 4IFDI 4Y7NB 1PRTC 3C1EA 3GO5A 3OIPA 5JEAG 3DEPA 2CW0C 1IW7C 4E6IA 3JAML 4KV6A 5I4DA 3N52A 1WTOA 4K8JA 2OEOA 2JYOA 1PZID 1CI3M 1TU2B 1T5XD 5CV5A 4OL7A 2RDGA 5T1IA 1SMYC 1ENAA 4XQNA 3GP7A 4DFAA 2JA7B 3TDQA 1IYVA 3E6ZX 1ZKOA 1SE2A 1A15A 4IUPA 1STBA 1J9OA 1JOQA 1EQVA 3K5NA 4C3IB 1JB3A 1D5MC 1RODA 4H0LC 4QIWB 5EKKA 2WACA 4KN7C 3PUWA 4M1UB 4PNYA 5EQ0A 4LK1C 3NWTA 3WOEA 4B08A 1I3QB 2B2WA 4A3EB 3OW7A 3MFGA 1EWCA 1BQQT 4R8NA 1PTOF 2C9OA 3D6CA 3MXPA 4X3UA 2PO4A 1HUMA 2F0VA 1QCBD 1YNND 4RHSA 3VR5A 4J6HA 4KI0A 3HZXA 1EY0A 1HPCA 5HURA 3LWEA 4C1NK 1H9MA 1XTCD 5E4XA 1S4ZA 3I91A 1EU4A 5T1GA 5C3XA 2XVSA 3M85A 1AN8A 1JWMD 2VB3X 2IT1A 1BCPD 4WJWA 1TS4A 3I72A 4ZKBB 4PMBA 3HOXB 2R61A 2AUKA 4L8JA 2NN6H 1JWUD 2K03A 1IKLA 3HS0C 2XRSD 3K58A 4QB4A 1FNUA 1ESFA 1V1PA 1AFPA 2QILA 2HDLA 3MFYA 2BA1A 4ZRZA 4YIJA 3V96A 4QUCA 1STAA 2EY2A 2D62A 3EJIA 1AP0A 1MI2A 1TY2A 2KEDA 2SOBA 1RKNA 3NQTA 3P75A 2LS01 1HHVA 2K5DA 3SXHA 2PYKA 1AZPA 3URYA 4L63B 3FRPB 3O13A 1KTKA 3VA5A 1JICA 2DN8A 1H9JA 1D5ZC 2Z1CA 2EJFC 3SEBA 2V4DA 2B39A 1YNJD 3KLSA 1TY0A 5M3MB 1D2BA 1X32A 3BDCA 2KJXA 1SXTA 3RZOB 1TQOA 3A8JE 4I65A 4KTAA 4IQZA 3NTIA 4Z9CB 1QE6A 5C0XI 3GTQB 1B9NA 5ELDA 2NTSA 2KCNA 5KYIA 4C3IG 3VYSA 3CRKC 2L5TA 1KDAA 2WIIB 1F2YA 5C3WA 3GQBA 3GD7A 4OO1G 2F0GA 4UDUC 2IL8A 1TWGB 3QIAA 4RGNA 5CV4A 1C48A 1UUPA 2LY7A 1G2TA 4K5VA 1EZ8A 4DAVA 2B2UC 1LLRD 2NVTB 2NVQB 4IFDG 1GJXA 3NBHA 2F0PA 3BVGA 5KYLA 3KUPA 2L0CA 1TS2A 1ET6A 2RDHA 2M9VA 4GZYC 2Z4HA 3OWFA 5D14A 1EIGA 5I9PA 2B2TC 3J81E 3HOWB 3J80E 5DNFA 5KRUA 2IW3A 5FK9C 1JORA 3E0JA 1PFBA 4IUNA 1SNCA 4ABNA 3MA2B 1V8QA 4DN4M 5A2QE 1CM9A 2WKCA 4A93B 1A6XA 3NXWA 4A3IB 2R92B 5DAUA 1ILPA 3S17B 2L12A 5KEEA 3H09A 1XX8A 4ODGA 4XYQA 4DK1A 3MTSA 2BCOA 1JOKA 2VNUD 1Y1VB 2DNEA 3C46A 2EPBA 2WAQB 2KVMA 4PMWA 4F87A 2KA7A 1KAAA 4FVMA 4ZAIA 2DNCA 2A74C 5CMDA 4DXGA 2BA0A 3DXJC 3G6JB 1Y69U 3PUZA 1TR5A 1SYFA 2Q8RE 1XYIA 2PCFB 1HA5A 3NUCA 1DXMA 1CA5A 5KIXA 3AB9A 3BVZA 2F0NA 2NVXB 3IFTA 1BXTA 1BCPC 1WD1A 2IX1A 4OGQC 3NWSA 3TP6A 4K5WA 3QOJA 3MVVA 4ZUIA 3HG9A 1D6EC 3KLSX 3P1HA 3SK5A 2QCPX 2RVLA 2ENBA 2SNMA 5CBEE 2A6EC 4OIKA 5JEAJ 1I4GA 1WVLA 3I90A 3SK6A 2E2IB 1GXDC 3KBXA 1GUNA 5C5LA 3EROA 2EYHA 1E2WA 2EVBA 5LL6X 5K36G 5C4XB 2N88A 3D31A 1DD2A 3MHBA 1UEAB 4DAPA 2RA4A 1VF7A 5I2YA 3DWPA 3LWUA 1B3AA 2DY8A 3PO3B 1Z47A 2NUCA 1STEA 1STGA 4Q5VA 4KJNA 2KHSA 4C1NI 5JEAH 3PIO3 3PO2B 2K04A 2YYZA 4KHVA 2D2CC 5D3DA 3G7LA 1F77A 1KNEA 3IFDA 3S16B 2NTTA 1YNJC 1JOOA 1SAPA 1SYCA 2C5CA 2XNAC 2E2HB 2EYFA 1JE4A 5JVG3 5CBAE 5JOBA 2YU9B 2B2WC 4A3MB 1MBYA 4QMGA 1ILQA 4NKLA 5A35A 3I3CA 2WKDA 4H44C 5C0XG 2IWHA 2A73B 1BOSA 2GA4B 3V05A 3TP8A 4KY6A 1II3A 1ICWA 3KF8A 2JP1A 2XRQD 2K05A 3DWAA 4PV1C 2X69A 1EU3A 1WTXA 3H91A 2WB1B 3D3RA 1CQVA 4ZYSA 1Q8IA 2F0DA 5G3LF 5KNCA 2EOTA 1PLFA 1FD7D 4DK0A 2EYMA 5IGFA 4I7ZC 1EY8A 4HMJA 3OSOA 1B50A 1H9RA 1SYGA 2NN6I 4CBVA 5DM63 4F8MA 4KD4A 1EYAA 1K8OA 3PUXA 3K6OA 1D1KA 4KY7A 1WTPA 1GUTA 3I4MB 1LTBD 4HSVA 1G291 1ZXTA 4QCLA 1G91A 4DXFA 3R3OA 3S14B 3EQLC 1LTTD 2B63B 1TWFB 3MAQA 4HN7A 3TZDA 1F9QA 1B44D 5COYA 1BNZA 2L4NA 2F0WA 3RUZA 3GTLB 2I46A 4FF3A 2ZXRA 1OXUA 2MJ8A 1DONA 2B2VA 3GTGB 3W3AA 1PTOD 4QUFA 1BDOA 2XN9C 1U4PA 4BBRB 2K6AA 1PZKD 1JCKB 4RGOS 1DZ1A 4U68A 3TZUA 2FMCA 1RTNA 3TSSA 4P2CB 2EZVA 1IL8A 3K5OA 5IGBA 4FF2A 2NZ1D 4K6LA 3S15B 4KJOA 2MGSA 4DF7A 1D1IA 1HQRD 3CU7A 1LT5D 3I4NB 4HCEA 2ICIA 2L55A 4K2LA 4LAAA 1GUSA 4BS9A 4C3HB 3A7AB 3PUYA 1TS5A 3P7JA 4EGVA 1QNUA 1HFGA 2KEEA 3PUVA 3R2IA 4CJ1B 2F0EA 2EE1A 2SEBD 3FEWX 4IFDJ 2QKIC 5D3IB 4F7XA 4N9PA 1NR2A 3K0YA 4G4KA 1DJRD 3QOLA 4MN3A 3W2DA 5J39A 4IUTA 5LHY1 4XXEA 4R9WA 1PXUA 3TMEA 2EYJA 4K8IA 2R7ZB 2XWBB 3MZ5A 2A6ED 5FLXE 2WV6D 1Q12A 1RDPD 3SDZA 1W6JA 1XWEA 3SE0A 2E75C 5F2DA 3VYRA 3IKJA 3QWNA 1EY6A 4X3SA 3SHLA 3DHQA 4A3BB 1EZ6A 3ND8A 1B9MA 3ZYYX 2HDMA 2F0LA 3VR3A 2F0QA 2OXPA 2FHTA 4K5XA 4HSPA 4FNFA 4FP5D 2F0KA 4S3SA 2AUJD 2MPMA 5FO8B 1DCZA 4HMIA 1H9KA 2K28A 2AWNA 5M3FB 1M8AA 4IALA 3QO2A 5C3EB 2LKVA 3MXGA 4FF4A 4IN3A 1CT1D 5CYUA 5M5WB 1VF5C 1EQTA 1LTID 5C5MA 2PW5A 3OWEB 4V0BA 5EGTA 2A69C 1GUWA 3A56A 1OXSC 1Y8NB 3PV0A 4NW2A 3EVQA 2EYOA 1AZQA 1SFOB 3D6WA 4DA2A 1R4QB 4ULLA 1HFNA 1SNOA 3R93A 4KKSA 2O5IC 4DGZA 5CORA 1SYBA 2KCCA 2Q8IB 2DY7A 3EA6A 1O78A 4IURA 3L9AX 2F0MA 3MXNA 3BDOA 1PDQA 2RSOA 5C44B 3OOCA 3H94A 4IUUA 3D8GA 4RCNA 4RFBA 4XT1B 3T51B 4K14A 2F0UA 5M9OA 1ONLA 1I4PA 2XSCA 1LTAD 3QG1A 3X3NA 1D5XC 2JXMB 2PPBC 1G8ZD 1IYUA 1SJHD 5ISRA 3DEOA 4FF1A 4C3HG 4XIGS 1K83B 5EJWA 3CHBD 5FLXL 2F0HA 1E0BA 1PTOC 3QJYA 3FVQA 5EBDA 2TMPA 3LNNA 2NWGA 4ID6A 3HOZB 1TWHB 3X3MA 3J7AV 1ET9A 4A3FB 1HUNA 1MSHA 1QNKA 3U9OA 1KABA 2JEBI 2HCCA 4CJ2C 3A55A 3DUZA 2B2YA 1K8MA 1F2ZA 3OIQA 1Z7TA 4A3DB 2B8GA 5JPMC 1V43A 5IGCA 2K01A 4J8QA 2J0TD 3NQIA 3QB3A 1LACA 3S1MB 4XTCS 2PNRC 1RHPA 5ELCA 3P20A 1F9RA 3K5LA 2J7ZA 4TQUS 3VR2A 5E1FA 2OF1A 5C0XJ 1VCIA 1R4PB 1HA6A 2BDNA 3HOUB 1U9RA 5KNDA 1Q1EA 1PRTF 1DYQA 2TSSA 2HQEA 1WTQA 1Q3LA 1MD2D 2PZWA 2D5DA 4HAEA 5IT9E 4MHEA 3Q6SA 5FO7B 4B9XA 4G7ZC 1DOKA 3GTOB 3LX0A 3SK4A 1L0YB 3FKIB 3T53B 5EKIA 4QF4A 5IOCA 3D4WA 4M8AA 4RGTA 5C4HA 2CQAA 4TRDA 3PIP3 2E2JB 5AFWA 3ND9A 1WTRA 2J4XA 1FNWA 1EL0A 2AQ3B 4UAIA 3HOYB 4ME5A 3VA7A 3MWYW 3MC0B 4H7BA 1CHQD 1QILA 1O80A 3WOFA 3L7ZC 5BN3A 1GHKA 3J81L 3J80L 3NK9A 1LV9A 2AQ1B 1TS3A 4CKBA 1WD0A 4CKCA 1F9SA 1QG7A 5CV9A 3J7YW 2B2VC 3K5MA 1CQFA 2LMCB 3NPPA 5A2QL 1F2MA 2SNSA 1CHPD 5LL6S 5EPKA 3NHHA 2JA6B 4EQPA 3IL8A 1U4RA 2B8FA 1SNPA 1ZYRD 3M7NA 2KOLA 5FKAC 4RAUC 2EXZA 2EJMA 3PMFA 2PZUA 5G3LD 2WINB 4CKEA 2R3ZA 3A8KE 3BDLA 2M00A 2EY6A 4LMQD 3Q24A 1GUGA 2A68D 2JE6I 1EFID 1U4MA 1E2VA 1KDBA 2O4XA 4FXKC 1VMCA 4DU9A 3TP5A 5J22A 2K33A 4RKBA 5FO9B 1KLUD 4G57A 5CC4A 1PYWD 1E2ZA 1EEID 2EJGC 2F0FA 1S5ED 4KKTA 3N6RA 2QEJC 2VXWA 2A69D 3T56B 4BWGB 1SNDA 4KKUA 3J7AF 1SNQA 1I6VC 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2X A;  5I2Y A;  2I46 A;  2M9V A; 
#chains in the Genus database with same CATH topology
 2QDB A;  2N55 A;  4EQO A;  1SMX A;  2F4I A;  4EVO A;  3BVM A;  1FNV A;  2MP1 A;  2NYZ D;  4R4Q A;  2PZT A;  4JI0 L;  3S1N B;  3FDT A;  1NUC A;  4JBK A;  4YCV A;  2K50 A;  4DV5 Q;  5DEH A;  1PH7 A;  3D4D A;  4MIU A;  1B2T A;  1EY4 A;  3U9S A;  2XWJ B;  1PFM A;  4QY7 A;  1PRT B;  1S5F D;  3FPU B;  5E7N A;  1QJO A;  4XQQ A;  2Z6K A;  1KXL A;  2JA5 H;  1TWC B;  2VUM B;  3BG3 A;  1C4Q A;  5C4J B;  5IIF A;  1GOZ A;  1CFM A;  3DWQ A;  4JK1 C;  3HOV H;  4KY5 A;  3OW2 A;  1KDC A;  5IP9 G;  2RSN A;  3Q23 A;  1A3V A;  4NP5 A;  4JCV E;  4P72 A;  4TKO B;  3FKI G;  4CDE C;  1SE4 A;  4XT3 B;  4DAY A;  2KQ3 A;  2IHF A;  4O1N A;  3KJO A;  1I4H A;  5JVH 3;  4RH6 A;  1Y8P B;  2E74 C;  3V2T A;  4J15 A;  2L11 A;  4DR2 Q;  5D65 A;  2XIW A;  1CUK A;  3J7A 5;  3EFX D;  1MGS A;  1STY A;  5M5X B;  1R9T B;  1SRO A;  5EPJ A;  3SK8 A;  4ALP A;  4PZ7 A;  3M4Y A;  3CAM A;  3HOY G;  1PVO A;  4DR5 Q;  3EBE A;  3A5U A;  4JI6 L;  4JBW A;  3H3V C;  1B4O A;  3RN5 A;  1JC7 A;  1ENC A;  4KMU C;  2HIX A;  4BBS H;  1TWA B;  2Q8T A;  3GTM B;  1TWC H;  4BY7 H;  4IUV A;  4RHR A;  5IYB H;  4OXP A;  4K0K L;  5EKL A;  1LAB A;  4Y7N H;  1KQS A;  1CTM A;  3S9W A;  4YY3 Q;  1NBW A;  1IHZ A;  2N78 A;  4DUY Q;  4B3S Q;  1XNQ L;  1SBB B;  1LT3 D;  3BZC A;  4AYB E;  2CCZ A;  4UPA A;  2M2L A;  4CJ0 B;  1BUV T;  3Q0A A;  3PO2 G;  1QWY A;  1G2S A;  4DV4 L;  4DV1 Q;  4GOP C;  3H0G B;  3S1R B;  2A5H A;  1N34 L;  1MSG A;  5JJL A;  3RD4 A;  4OWX B;  1DOL A;  1HJP A;  1ZEQ X;  3RLF A;  3G48 A;  2RBM A;  3J81 i;  2A6H C;  1HR0 Q;  2K32 A;  4F88 A;  5K5P A;  2PW7 A;  2DUD A;  3CPW A;  3CCL A;  3UDI A;  4DNI A;  1EY5 A;  4YWL A;  4ZUJ A;  4L5T A;  5M5X H;  3GTJ B;  4DR6 L;  4GKK L;  3A8I E;  3E0E A;  4A75 A;  1CKN B;  1V1O A;  2NB0 A;  4EQ5 A;  5DM7 3;  1SJE D;  3S24 A;  2HHH L;  3M3Y B;  4IO9 A;  1VQB A;  2JA7 H;  3TS2 A;  2UU9 Q;  4A3M G;  3GTM H;  4A3L H;  3VYU A;  1YVC A;  1WTH A;  2L9H A;  4O2D A;  1Y8O B;  4C3I H;  1HNZ Q;  2L1B A;  3H3V H;  1XNR L;  4DAM A;  3AU7 A;  4OO1 H;  3OTO Q;  1WFQ A;  4TSS A;  3ULJ A;  1U4L A;  1M4V A;  3F2U A;  1K3B C;  1H9S B;  3CQZ B;  1VQ8 A;  3HRZ C;  2F1M A;  1KNA A;  4FYD A;  1KRS A;  1IBM Q;  4DV3 Q;  1SSO A;  1L2F A;  4LF4 L;  2SDF A;  1BO0 A;  5GQO A;  1YIT A;  4H13 C;  3TBI B;  5AJ3 Q;  4JI2 L;  4DNT B;  1S5D D;  4G7O C;  3BZD B;  1K8A C;  1I3Q H;  4WRD A;  3DM1 A;  1QZG A;  4A3E H;  4WJ4 A;  5CGK A;  1J8I A;  4IFD H;  2F0S A;  1RTO A;  3NE5 B;  2AQ2 B;  1FVI A;  4ME3 A;  3VYT A;  4IPC A;  1A3T A;  2H4O A;  1VQL A;  1X54 A;  2LFN A;  1ML0 D;  3BYY B;  3RZD B;  2QA4 A;  1KLG D;  2ZXO A;  3S2H B;  2HQL A;  4RWS C;  2B2Y C;  2VB2 X;  1XMO L;  2YTY A;  1F9P A;  1ZYR C;  5JAV A;  3BS1 A;  1X55 A;  2IJ0 A;  1YHA A;  5FLM H;  2K1B A;  3EIV A;  2BE5 D;  2D9U A;  3IAY A;  2C35 B;  2KEN A;  2HT1 A;  4IZ8 A;  4JV5 L;  1FGU A;  5IT9 c;  2ID0 A;  5FJ8 H;  3ITP A;  1SNM A;  3I70 A;  2IX0 A;  4RCO A;  1Q46 A;  4PQX A;  1QVG A;  3I4M G;  3A54 A;  2A68 C;  4XDX A;  3CCU A;  2P5Z X;  4HCS A;  1BCP F;  1B1Z A;  2B63 G;  5JJI A;  1C0A A;  4ZLT F;  1NCV A;  1SDF A;  1UE5 A;  1FGB D;  2F3V A;  3KLR A;  1EYC A;  2CHB D;  3FMC A;  4NMZ A;  3HOX H;  1YZ6 A;  1B70 B;  3U4V A;  5BR8 Q;  1EYG A;  2CKZ B;  3K7A B;  4C2M B;  1JR0 D;  2MUY A;  2NZH A;  1EIY B;  2MO1 A;  4CGY B;  1HQM C;  1TT2 A;  1MJC A;  4XYO A;  2F03 A;  4DV2 L;  2UXD L;  3NEN A;  3R8B A;  1LT6 D;  1B53 A;  1YNX A;  1LTR D;  1I4X A;  3M7G A;  1NR4 A;  5I6W A;  1PH2 A;  4B9W A;  4AIM A;  2WP8 J;  5H1S E;  4BA2 I;  4OHJ A;  3HP3 A;  5I2X A;  1S5B D;  3U58 A;  3K57 A;  5IGE A;  2FIN B;  4K6D A;  1CZG A;  1RJT A;  3JAM c;  1EIH A;  2BH2 A;  3OPO A;  4AYB B;  1L1O B;  2XGT A;  3HEJ A;  1Y1W B;  5ELF A;  1VQF A;  3F8T A;  3OMG A;  3S2D B;  4RMF A;  2ZXP A;  4N9T A;  2KUM A;  1BR9 A;  3IRB A;  3L3O C;  1I50 B;  1CKN A;  1P8L A;  2RKS A;  2EDG A;  1VDZ A;  2LSS A;  1WOC A;  4TVA B;  2NN6 G;  1RCV D;  4RA8 A;  5E3F A;  4UP7 A;  4UP9 A;  3I4N G;  3RMH A;  3CRL C;  2BOS A;  4C3J B;  4UHV A;  1C8C A;  1SYE A;  3VR4 A;  1HCZ A;  2ICE C;  5M3M H;  1WCM B;  1L0X B;  4CHT B;  5KNB A;  1LT4 D;  4ILW A;  3RZO H;  2G9D A;  5LMN Q;  2AKW B;  1STN A;  3M4O B;  4OIJ A;  1HXY D;  3W1G A;  1H9S A;  4LF8 Q;  1CSQ A;  3CKI B;  3GTQ H;  5HGT A;  3L2P A;  4DV6 L;  1XPO A;  1I94 L;  2R93 B;  1VMP A;  5I9O A;  4DNR B;  2R7D A;  4P71 A;  2HUG A;  2Z8L A;  1A3U A;  4JI8 L;  1OXX K;  3SGI A;  3I8Z A;  1X3P A;  1O7I A;  1PRT D;  3DMU A;  3R2T A;  4DR3 L;  5K36 H;  1EWH A;  1PTO B;  2CVR A;  3A0J A;  1BF4 A;  4NDX A;  1PHJ A;  1T5E A;  1K3R A;  2CW0 D;  4NXN L;  2Z0S A;  5J1Z A;  1IW7 D;  1IKM A;  3T16 A;  4L5R C;  1TWG H;  1SN8 A;  2NBF A;  4GN3 B;  4A3K B;  5NUC A;  1W6K A;  4KK7 A;  3OHX C;  1HTL D;  3ERQ A;  4EX5 A;  1BKB A;  1X9N A;  2PI2 A;  3NEM A;  4LW1 A;  3T13 A;  2G5D A;  3G6E A;  5E4W C;  4KD3 A;  4V19 0;  1HRJ A;  3VR6 A;  4R8I A;  3GTP B;  2EXD A;  5CV7 A;  4HED A;  4GS3 A;  3TEH B;  1WCM H;  3KBG A;  3C3L A;  4X3K A;  4DV4 Q;  1PH3 A;  5J3B A;  2NVQ H;  1Q1B A;  1JWS D;  1CKO A;  1A62 A;  4DR7 L;  1FYC A;  1SMY D;  1OO9 B;  1SE3 A;  1N34 Q;  1I6H B;  3S1Q B;  1CA6 A;  4JYA L;  4XQJ A;  2Z4I A;  5M5Y B;  2F0T A;  4X6A H;  2FFK B;  2IPK D;  3GDE A;  4LJZ C;  3CCV A;  1LO5 D;  5ELN A;  2FJ2 A;  4A3B G;  2EY5 A;  3KYH C;  4DR6 Q;  3RN2 A;  4GKK Q;  1BBX C;  1V9P A;  1PTO H;  2FMM A;  2X6L A;  5CV8 A;  2R6G A;  3HOW H;  4LNQ A;  2H1E A;  3SR1 A;  2HCI A;  1RL2 A;  1A2U A;  2NVY B;  3MXU A;  3H6M A;  2F4V L;  3F2C A;  5TSS A;  3GTK B;  4LFB L;  2JA9 A;  4A93 H;  1HTP A;  1YNN C;  2K7V A;  4A3I H;  1O7L A;  4JBJ A;  1NNX A;  5C0X H;  5IYD H;  5LMU Q;  2A6H D;  2EY1 A;  3S17 H;  4IUQ A;  3NP8 A;  1X3Q A;  4WOR A;  4HTH A;  4HIK A;  4A3J B;  2EQS A;  1SEB D;  3CC4 A;  5M3F G;  1UE6 A;  2I07 B;  5C3E G;  3F2D A;  1BCP B;  4L6T B;  4LF4 Q;  4C56 C;  5EPL A;  1K28 A;  2F3W A;  4KN4 C;  3SVM A;  3TP7 A;  4OEM B;  1QOH A;  4HJ8 A;  1ENF A;  2ZT9 C;  2Z6K C;  3A7L A;  3I4L A;  1Y1V H;  5CV6 A;  4BY1 B;  1A8V A;  1L1O A;  2VY3 A;  3M4P A;  2F0I A;  2AWO A;  3NTK A;  1GHJ A;  2LXK A;  1OXV A;  1EY9 A;  3UI2 A;  4WFN 3;  2DJF C;  2F0O A;  3E9H A;  1Q90 A;  4DPG A;  1XXG A;  4BA1 I;  1E22 A;  1PFN A;  1OXT A;  4RKL A;  4B3M Q;  1K0R A;  1RF2 D;  5BN5 A;  3C2P A;  3F2B A;  1XMO Q;  2QF7 A;  3K59 A;  2L15 A;  2BE5 C;  2O2L D;  2B2U A;  3NSW A;  5FOB B;  3J7Z C;  5BN4 A;  4AYB G;  3TN2 A;  5IYC G;  1YIJ A;  4RG1 A;  3T1Y Q;  1F2L A;  1Y1W G;  5C44 G;  3JAM E;  1I4R A;  4B3T Q;  4LF7 L;  1UEB A;  3MEH A;  4Q0F A;  5EBC A;  1SYD A;  1N33 Q;  3STB C;  2X6G A;  5GAE C;  2K5W A;  4KHZ A;  4PZ6 A;  1EOT A;  2O5J C;  2AHO B;  5IGG A;  2NVX H;  2G9H D;  1SLJ A;  1O7Y A;  2PQE A;  4X3T A;  5I6Y A;  3ONA B;  4QIW E;  5IGD A;  1UE1 A;  1PZJ D;  2EYL A;  4C3J G;  5C4Z A;  3FPP A;  1T9H A;  2B2T A;  2QGQ A;  1NMG A;  3GV6 A;  1HZC A;  1WTW A;  3E5S A;  1JJ2 A;  2E2D C;  1Z6H A;  5ELE A;  1NAP A;  3T4A C;  2JA8 B;  2RQX A;  3I73 A;  2PMZ B;  4DK6 C;  1PMR A;  4BXX H;  1PFS A;  1QUQ B;  3KF6 B;  3ZJY C;  2D0O A;  4ZQ3 A;  4X62 L;  3Q22 A;  2CH4 A;  4X66 Q;  1W3S A;  1EY7 A;  1PYS B;  2JEA I;  4A3G B;  1NY4 A;  3K81 C;  1I4Q A;  1YBY A;  3BYT B;  2R93 G;  1JQY D;  2JSO A;  4O42 A;  4RGM A;  2E2I H;  1AE3 A;  1LTS D;  4I7A A;  4P75 A;  4FO2 A;  1N32 Q;  1XPR A;  1CZW A;  1AEX A;  4FXD A;  5C4X H;  1U0L A;  2E5L L;  1HZ9 A;  2RDF A;  1NSN S;  2XTI A;  3GV3 A;  3HGB A;  5CR3 A;  4G7H C;  3AMU A;  2KEC A;  2JA5 B;  4U67 3;  3PO3 H;  1VS0 A;  1QB5 D;  1N36 Q;  1AW7 A;  1FR3 A;  3WDN A;  2VS1 A;  5IT9 L;  1VQH A;  4HR7 B;  5KGU A;  1VQ6 A;  3HOV B;  4EQN A;  1G6Z A;  4GLV B;  2Y0S B;  5JPN C;  1S5C D;  2E76 C;  1ESR A;  4L5Q A;  4JI3 L;  4ZK9 B;  1GUO A;  1TII D;  4AQY L;  1UAP A;  2Q2U A;  1CK1 A;  1LUZ A;  2EYP A;  1RD9 D;  2K5Q A;  1TKW B;  3KK7 A;  5JJZ A;  1A2T A;  1EYD A;  4DR4 L;  3NTH A;  4K2K A;  1STH A;  2KCM A;  2MHV A;  3OMC A;  3H3V I;  5ELB A;  3PIP A;  4R4O A;  1DOM A;  4YHH Q;  3NBI A;  2IX3 A;  4A3G H;  3S16 H;  3KDF B;  1DM0 B;  2CQO A;  4IPD A;  2BDO A;  3HKZ B;  4ZKC B;  1EQQ A;  1JMC A;  4PMC A;  4OWW B;  4GLX A;  2RF4 A;  3D4R A;  4LF5 Q;  1LTG D;  3ER0 A;  3HOU G;  1VQP A;  2E2H H;  1WTV A;  2ZM6 L;  2F3I A;  2PI2 E;  4JW0 A;  5IOD A;  4GNX B;  2Z6B A;  1D8L A;  4FXG C;  5ELO A;  2YU9 H;  1TVX A;  1G51 A;  4GKJ L;  5C6A A;  2I5L X;  4BBS B;  2IY5 B;  4A3M H;  3I4O A;  3NEL A;  1UNS A;  1LYL A;  4X64 L;  1EEF D;  1O7Z A;  2ZJP A;  3C1F A;  4J1M A;  4DV7 L;  4BY7 B;  1AH9 A;  3FP9 A;  1V1P B;  4P74 A;  2F0J A;  2OT2 A;  1GKH A;  4IFD I;  4Y7N B;  1PRT C;  3C1E A;  3GO5 A;  4DR3 Q;  3OIP A;  5JEA G;  3DEP A;  3PIO A;  2CW0 C;  1FL0 A;  4O0A A;  4OEL B;  1IW7 C;  4IOA A;  4A3J G;  1VQM A;  4E6I A;  3JAM L;  4APV A;  4N8X 1;  4KV6 A;  5I4D A;  3N52 A;  3CCQ A;  3KOJ A;  4KLK A;  1WTO A;  4MTK A;  2RCF A;  1SE8 A;  4K8J A;  2OEO A;  2JYO A;  1PZI D;  1CI3 M;  4BY1 G;  1VQ4 A;  1TU2 B;  1T5X D;  1ASZ A;  5CV5 A;  5L37 A;  4HJ9 A;  4OL7 A;  2RDG A;  5T1I A;  1SMY C;  1Q82 C;  1KD1 C;  1ENA A;  1I5F A;  4XQN A;  3GP7 A;  2BH8 A;  4DFA A;  2JA7 B;  1MIU A;  4JI1 L;  3TDQ A;  3E6Z X;  1ZKO A;  2UXC L;  1IYV A;  1SE2 A;  1A15 A;  4IUP A;  3UDG A;  1STB A;  1J9O A;  4DUZ L;  1JOQ A;  1EQV A;  3K5N A;  4C3I B;  4OX9 L;  1JB3 A;  1D5M C;  1ROD A;  4H0L C;  3U50 C;  4QIW B;  1PH8 A;  2IHE A;  5EKK A;  2WAC A;  3I4M H;  3KF6 A;  1QUQ A;  4KN7 C;  4DR1 L;  3I56 A;  4LFB Q;  2GVA A;  3PUW A;  4M1U B;  4PNY A;  2UUA L;  3S14 H;  2B63 H;  5EQ0 A;  3J80 i;  4LK1 C;  2A19 A;  2JA6 G;  1XJV A;  3NWT A;  3WOE A;  4B08 A;  1I3Q B;  3M9B A;  2B2W A;  4A3E B;  3OW7 A;  4CDD C;  2JA8 G;  1PA6 A;  4IJH A;  2ATW A;  3J81 j;  3GTL H;  3WWV A;  2V1C C;  3MFG A;  1EWC A;  1BQQ T;  4R8N A;  1PTO F;  3GTG H;  2C9O A;  4KHP L;  3D6C A;  3MXP A;  4X3U A;  2PO4 A;  1HUM A;  1KL9 A;  2F0V A;  3J81 c;  1QCB D;  4BBR H;  1YNN D;  3DLL A;  4RHS A;  3VR5 A;  2VZA A;  4A3C G;  4J6H A;  4KI0 A;  4LFA L;  2OTJ A;  3NBH B;  1JJG A;  1K0S A;  3HZX A;  1EY0 A;  1HPC A;  5HUR A;  4ZCK A;  3LWE A;  1ICF B;  4C1N K;  1H9M A;  1EWI A;  1XTC D;  1FJG L;  5E4X A;  1S4Z A;  3I91 A;  1EU4 A;  1SR3 A;  5T1G A;  3KDF A;  5C3X A;  4JI5 L;  2XVS A;  3M85 A;  1AN8 A;  1N9W A;  1JWM D;  2VB3 X;  2IT1 A;  1BCP D;  3AFP A;  4WJW A;  3TQY A;  1TS4 A;  3I72 A;  1Q86 C;  2UUB L;  3S15 H;  1WJJ A;  4R4C A;  4ZKB B;  4PMB A;  4GNX A;  3AQQ A;  3HOX B;  2PNH A;  2R61 A;  4JI4 L;  3JC6 6;  2AUK A;  4L8J A;  2NN6 H;  1JWU D;  2K03 A;  4UP8 A;  3I4N H;  1XMQ L;  1IKL A;  3HS0 C;  4LF9 Q;  3T1H L;  2XRS D;  2Q2T A;  1TXY A;  3K58 A;  1H95 A;  4QB4 A;  1FNU A;  1ESF A;  1V1P A;  2N8N A;  4YWK A;  1AFP A;  4POG A;  1JT8 A;  2ZTE A;  2QIL A;  2HDL A;  1PH9 A;  3MFY A;  4C3H H;  1LTL A;  4OON A;  1YHB A;  2BA1 A;  4ZRZ A;  5IE8 A;  4YIJ A;  1KC8 C;  3V96 A;  1V1Q A;  2UUC Q;  4X62 Q;  4QUC A;  1STA A;  2WAQ E;  2UXB Q;  2EY2 A;  2D62 A;  3EJI A;  1N8R C;  1AP0 A;  1MI2 A;  1TY2 A;  2KED A;  3STB D;  2SOB A;  1VQA A;  1RKN A;  3NQT A;  1QZH A;  2VUM G;  4BY7 G;  1IBK L;  2JQO A;  3P75 A;  5IYB G;  2LS0 1;  3CXC A;  1HHV A;  2K5D A;  3SXH A;  2PYK A;  3TRE A;  1AZP A;  4A4I A;  4N8F A;  2N3S A;  4LUV A;  3URY A;  4HJ5 A;  4L63 B;  3FRP B;  4B3R L;  3O13 A;  1KTK A;  3VA5 A;  1JIC A;  2DN8 A;  1H9J A;  1D5Z C;  1MJE A;  2N49 A;  2Z1C A;  4PG3 A;  2R7Z H;  2EJF C;  3SEB A;  2V4D A;  2B39 A;  1YNJ D;  1IBL Q;  3KLS A;  4GLA C;  1MHW C;  2VQE Q;  3QR8 A;  1TY0 A;  4YCU A;  5M3M B;  2CWA A;  1X32 A;  1D2B A;  3BDC A;  2KJX A;  1SXT A;  3CCE A;  3RZO B;  1TQO A;  3A8J E;  4I65 A;  4KTA A;  2OWO A;  4IQZ A;  2K5N A;  3NTI A;  4Z9C B;  1QE6 A;  5C0X I;  3GTQ B;  4A3L G;  1WI5 A;  3RNU A;  1B9N A;  4JI0 Q;  5ELD A;  2NTS A;  4A3B H;  2KCN A;  3PSI A;  5KYI A;  1X3G A;  3VYS A;  4C3I G;  3CRK C;  2L5T A;  1KDA A;  4X65 L;  1B8A A;  3CF5 A;  2WII B;  1F2Y A;  3UE0 A;  3GQB A;  5C3W A;  3GD7 A;  1UWV A;  4DK3 C;  1K8G A;  2F0G A;  4OO1 G;  5IP7 G;  1L1O C;  4GKJ Q;  4UDU C;  2IL8 A;  2OTL A;  4HJA A;  2GN5 A;  1TWG B;  1QVC A;  4DV7 Q;  3H0G G;  5IWA L;  3QIA A;  4RGN A;  5CV4 A;  1VQ5 A;  1C48 A;  1UUP A;  4A76 A;  2RHQ B;  2LY7 A;  1G2T A;  4K5V A;  1EZ8 A;  4DAV A;  4JI7 L;  2B2U C;  1LLR D;  4MTN A;  4A3E G;  1EFW A;  2NVQ B;  2NVT B;  4IFD G;  1GJX A;  3NBH A;  2ALY B;  2QW7 A;  3RLN A;  3RLO A;  2F0P A;  3BVG A;  5KYL A;  3KUP A;  2L0C A;  1TS2 A;  2PMZ E;  1ET6 A;  2RDH A;  2M9V A;  4GZY C;  1GVP A;  2Z4H A;  3OWF A;  2DJG C;  4R1J A;  5D14 A;  1IYJ B;  5FLM G;  1NMF A;  1EIG A;  5I9P A;  1SFO H;  1LM0 A;  2B2T C;  3J81 E;  3HOW B;  3J80 E;  5DNF A;  4JPB W;  4JI6 Q;  5FJ8 G;  5KRU A;  2FXQ A;  2IW3 A;  5FK9 C;  4AH6 A;  1JE5 A;  4JI1 Q;  1JOR A;  3E0J A;  1PFB A;  4IUN A;  1SNC A;  4ABN A;  4K0K Q;  3MA2 B;  1V8Q A;  4DN4 M;  5A2Q E;  1CM9 A;  2WKC A;  4OX9 Q;  4A93 B;  1DGS A;  1A6X A;  3NXW A;  1PYB A;  4A3I B;  2R92 B;  5DAU A;  1ILP A;  1YJN A;  1XNQ Q;  3S17 B;  2L12 A;  5KEE A;  3H09 A;  2Y0S E;  1XX8 A;  3HOX G;  4ODG A;  2NVT H;  1CSP A;  4XYQ A;  3H15 A;  1XTD A;  4DK1 A;  2UUA Q;  3MTS A;  2BCO A;  1JOK A;  2VNU D;  1Y1V B;  2DNE A;  3C46 A;  2EPB A;  1GM5 A;  1EIF A;  2WAQ B;  1K83 H;  2KVM A;  3HKZ E;  4PMW A;  2WB1 E;  2KA7 A;  4F87 A;  1KAA A;  4FVM A;  3AFQ A;  3Q8D A;  2HHH Q;  1B3Q A;  3KF8 B;  1UE7 A;  4ZAI A;  2DNC A;  2A74 C;  5CMD A;  4DXG A;  2BA0 A;  5GAD C;  1HNX L;  2VL6 A;  3DXJ C;  3G6J B;  3HOZ H;  1XNR Q;  1TWH H;  1Y69 U;  2R92 H;  3PUZ A;  1TR5 A;  1SYF A;  2Q8R E;  1XYI A;  4YY3 L;  4A3F H;  2PCF B;  4B3S L;  4LFA Q;  4UY8 C;  1HA5 A;  3NUC A;  1DXM A;  3MEF A;  1CA5 A;  5KIX A;  3AB9 A;  2K52 A;  3BVZ A;  2F0N A;  3E9I A;  1FJG Q;  2NVX B;  3K8A A;  4A3D H;  3CCR A;  3IFT A;  4JI2 Q;  5HGQ A;  2CH4 W;  4JI5 Q;  1BXT A;  1BCP C;  1E1T A;  2VQF L;  1WD1 A;  1Z9F A;  2IX1 A;  2UUB Q;  4OGQ C;  3ULL A;  3NWS A;  3TP6 A;  1X56 A;  4K5W A;  3QOJ A;  3MVV A;  1YEZ A;  4ZUI A;  5M3M G;  4JI4 Q;  2LXJ A;  1L0W A;  2A1A A;  3HG9 A;  3S1M H;  1D6E C;  1EOV A;  3KLS X;  3P1H A;  3SK5 A;  2QCP X;  2RVL A;  2ENB A;  2SNM A;  5CBE E;  1GO3 E;  2A6E C;  2RHS B;  4OIK A;  5JEA J;  1I4G A;  1WVL A;  1BBU A;  1S40 A;  1IXR A;  3I90 A;  3HOU H;  5JJK A;  2NZO A;  1YI2 A;  3SK6 A;  1HNZ L;  2E2I B;  1GXD C;  1HNW L;  3KBX A;  1GUN A;  5C5L A;  3ERO A;  4JV5 Q;  1W2B A;  1VQ7 A;  2EYH A;  1E2W A;  2EVB A;  5LL6 X;  2Q2I A;  5K36 G;  3OTO L;  5C4X B;  2N88 A;  3D31 A;  1DD2 A;  3MHB A;  1UEA B;  4DAP A;  2RA4 A;  1VF7 A;  5I2Y A;  1IZ6 A;  1WYD A;  1B3A A;  3DWP A;  2DY8 A;  3LWU A;  3PO3 B;  1Z47 A;  2NUC A;  1IBK Q;  3GTO H;  4GN4 B;  4DV3 L;  1S72 A;  1STE A;  1STG A;  1KIX A;  4Q5V A;  1JB7 A;  4JG2 A;  5AJ3 L;  1EQR A;  4KJN A;  5IP9 H;  1A63 A;  2KHS A;  2ZTC A;  4C1N I;  5JEA H;  1E1O A;  1VQI A;  3PIO 3;  3FKI H;  3PO2 B;  1WCM G;  4B3R Q;  2K04 A;  2YYZ A;  4KHV A;  2D2C C;  5D3D A;  3G7L A;  2E2J H;  1F77 A;  3BJU A;  4DV2 Q;  1KNE A;  2UXD Q;  3IFD A;  4CDF C;  3S16 B;  2NTT A;  4HIM A;  1YNJ C;  1JOO A;  1MKH A;  1SAP A;  1SYC A;  2C5C A;  2XNA C;  2E2H B;  2RCN A;  4H02 A;  2EYF A;  2MFI A;  1JE4 A;  5JVG 3;  1NTG A;  3HOY H;  5CBA E;  3HOW G;  5JOB A;  1PH1 A;  2YU9 B;  1Q7Y C;  1KHI A;  2B2W C;  3RR5 A;  4A3M B;  3G4S A;  1MBY A;  2R7F A;  4QMG A;  1ILQ A;  4A3K G;  4NKL A;  4A93 G;  5A35 A;  3I3C A;  4A3I G;  2WKD A;  4H44 C;  4Y52 H;  1XPU A;  5C0X G;  2IWH A;  5IYD G;  2A73 B;  3CC7 A;  1BOS A;  2GA4 B;  3V05 A;  3PO2 H;  4QQB X;  5EAY A;  2OQK A;  3PGZ A;  3BU2 A;  4KY6 A;  3TP8 A;  1II3 A;  4HIO A;  5BR8 L;  1ICW A;  3KF8 A;  1NE3 A;  2JP1 A;  2XRQ D;  2K05 A;  3DWA A;  4JOI A;  4PV1 C;  3I55 A;  5FLX c;  2X69 A;  1EU3 A;  1WTX A;  1U5K A;  3H91 A;  2WB1 B;  4MNO A;  1Y1V G;  3PCO B;  3D3R A;  1CQV A;  4YCW A;  4ZYS A;  2WAQ G;  1Q8I A;  4JVZ A;  2F0D A;  4WJ3 M;  5G3L F;  5KNC A;  1CKM A;  2EOT A;  1PLF A;  1FD7 D;  4GNX C;  4DK0 A;  4DV6 Q;  2EYM A;  5HY6 A;  1I94 Q;  3CCS A;  5IGF A;  1VQO A;  4I7Z C;  1VQ9 A;  1EY8 A;  4HMJ A;  1NJI C;  3OSO A;  1B50 A;  3CCJ A;  4JBM A;  4JI8 Q;  1H9R A;  1SYG A;  2NN6 I;  4CBV A;  3U4Z A;  5DM6 3;  2MNA A;  4R4T A;  4KD4 A;  4F8M A;  4A3C H;  1EYA A;  4NXN Q;  1K8O A;  3PUX A;  3K6O A;  1D1K A;  4KY7 A;  1ASY A;  1WTP A;  3ULP A;  1GUT A;  3F1Z A;  2ZJQ A;  5GRO A;  3I4M B;  1LTB D;  2JN4 A;  4HSV A;  1G29 1;  1ZXT A;  4QCL A;  3CD6 A;  1G91 A;  4DXF A;  3R3O A;  3S14 B;  3EQL C;  1LTT D;  2B63 B;  1HH2 P;  1TWF B;  3KJP A;  3G71 A;  3MAQ A;  4HN7 A;  3CW2 C;  3PF5 A;  3TZD A;  1F9Q A;  1B44 D;  2MO0 A;  3ERS X;  5COY A;  2L4N A;  4LFC L;  1BNZ A;  4DR7 Q;  2F0W A;  5LMN L;  3RUZ A;  4BXX G;  2ZTD A;  3GTL B;  2I46 A;  4LF8 L;  4FF3 A;  4JYA Q;  3B6Y A;  2ZXR A;  1OXU A;  2MJ8 A;  1DON A;  2B2V A;  3GTG B;  3W3A A;  1PTO D;  4QUF A;  1BDO A;  3AYH B;  2XN9 C;  1U4P A;  3S1N H;  2QDL A;  4BBR B;  2K6A A;  2WFW A;  1PZK D;  1C9O A;  1JCK B;  4RGO S;  1DZ1 A;  5C4X G;  2K5H A;  4U68 A;  2HIV A;  1G6P A;  3TZU A;  2FMC A;  5DLQ E;  2F4V Q;  1HNX Q;  1RTN A;  3EN2 A;  3TSS A;  2VUM H;  3PO3 G;  4P2C B;  2VW9 A;  5C4J H;  2K75 A;  2EZV A;  1IL8 A;  1YHQ A;  1D7Q A;  1TWF H;  3K5O A;  5IGB A;  4GOP B;  4FF2 A;  2NZ1 D;  4K6L A;  3S15 B;  1S3O A;  4KJO A;  2MGS A;  3DM3 A;  2I5H A;  1VQC A;  3D0F A;  4DF7 A;  1D1I A;  1HQR D;  1A0I A;  3CU7 A;  1LT5 D;  3I4N B;  1E3P A;  4HCE A;  4LF6 L;  3MXN B;  2ICI A;  2Q2H A;  2L55 A;  4A3G G;  2VQF Q;  4K2L A;  4LAA A;  1GUS A;  4BS9 A;  1VQK A;  4C3H B;  3J80 c;  3A7A B;  1R9T H;  3PUY A;  1TS5 A;  3P7J A;  2GVB A;  4EGV A;  4QGU A;  1QNU A;  2ES2 A;  1HFG A;  2KEE A;  3PUV A;  2HD3 A;  1RIP A;  1TWA H;  3R2I A;  4CJ1 B;  2F0E A;  4LWC A;  2EE1 A;  2JA5 G;  4GN5 A;  4HID A;  4NXM L;  1X3E A;  2SEB D;  1HNW Q;  3FEW X;  4IFD J;  3HOV G;  2QKI C;  5D3I B;  2Y0S G;  4LF7 Q;  4F7X A;  5IP7 H;  5LMU L;  4N9P A;  1NR2 A;  3K0Y A;  4G4K A;  1DJR D;  3QOL A;  3M4Q A;  4MN3 A;  3W2D A;  3W1B A;  5J39 A;  4IUT A;  5LHY 1;  3H0G H;  4XXE A;  4R9W A;  3S1R H;  1PXU A;  1BVS A;  3TME A;  2EYJ A;  4K8I A;  2R7Z B;  2XWB B;  3MZ5 A;  2A6E D;  5LMN W;  3HKZ G;  2WB1 G;  5FLX E;  1K9M C;  4IPH A;  2K5V A;  2WV6 D;  1Q12 A;  1RDP D;  3SDZ A;  3GTJ H;  1W6J A;  1XWE A;  3SE0 A;  2E75 C;  5F2D A;  3VYR A;  3IKJ A;  3M3Y H;  3QWN A;  4B3M L;  1EY6 A;  4X3S A;  4BBS G;  4QJF A;  3CMA A;  3SHL A;  3DHQ A;  3TRZ A;  1EZ6 A;  4A3B B;  2CFM A;  3FHW A;  3L0O A;  1B9M A;  3ND8 A;  3ZYY X;  3T1Y L;  2HDM A;  4P73 A;  2F0L A;  3VR3 A;  4B3T L;  2E5L Q;  4NB3 A;  2F0Q A;  3CQZ H;  2OXP A;  1N33 L;  1Y14 B;  2FHT A;  4K5X A;  4HSP A;  4FNF A;  3PQI A;  4FP5 D;  2F0K A;  4S3S A;  2AUJ D;  4JI3 Q;  2MPM A;  5FO8 B;  4AQY Q;  1DCZ A;  4HMI A;  3UDX A;  1H9K A;  3PF4 A;  2JJQ A;  2K28 A;  2AWN A;  5M3F B;  1M8A A;  4IAL A;  3QO2 A;  5C3E B;  4DR4 Q;  2LKV A;  3MXG A;  4FF4 A;  4IN3 A;  1CT1 D;  5CYU A;  5M5W B;  1VF5 C;  3RZD H;  3JAM i;  3K7U C;  2A8V A;  1EQT A;  1LTI D;  5C5M A;  3S2H H;  2PW5 A;  3OWE B;  4V0B A;  3TS0 A;  2JA7 G;  4X66 L;  5EGT A;  2CWP A;  2A69 C;  2PQA B;  1GUW A;  3A56 A;  1OXS C;  1Y8N B;  3CP0 A;  3PV0 A;  4LUO A;  3EVQ A;  4NW2 A;  2EYO A;  1VQE A;  2ZM6 Q;  1AZQ A;  4GOP A;  4BBR G;  1SFO B;  3D6W A;  2AMC B;  4DA2 A;  1R4Q B;  4ULL A;  1N32 L;  1HFN A;  1SNO A;  3R93 A;  4KKS A;  2O5I C;  4DGZ A;  5COR A;  1Q81 C;  1SYB A;  2KCC A;  2Q8I B;  4X64 Q;  2EIF A;  2DY7 A;  3VDY A;  3EA6 A;  1O78 A;  4IUR A;  3L9A X;  2F0M A;  3MXN A;  3BDO A;  1PDQ A;  1N36 L;  2RSO A;  1J6Q A;  5C44 B;  3OOC A;  3H94 A;  4IUU A;  1BBW A;  3D8G A;  4RCN A;  4RFB A;  4XT1 B;  3T51 B;  4K14 A;  2F0U A;  5M3F H;  5M9O A;  2B29 A;  1ONL A;  5C3E H;  1I4P A;  2XSC A;  1LTA D;  1YJ9 A;  4PZ8 A;  5M5W H;  2ZJR A;  2OCE A;  3K7A H;  4C2M H;  1PH5 A;  3QG1 A;  3X3N A;  1D5X C;  2JXM B;  1J5E L;  4DV0 L;  2PPB C;  4YHH L;  1G8Z D;  4LUZ A;  1IYU A;  1SJH D;  5ISR A;  4LF5 L;  3DEO A;  4LFC Q;  4FF1 A;  4C3H G;  4XIG S;  1C7Y A;  1K83 B;  5EJW A;  3UE1 A;  2ASB A;  3CHB D;  5FLX L;  4DV5 L;  2F0H A;  5GAH C;  1E0B A;  1PTO C;  3CCM A;  2UXC Q;  2KHI A;  4L5S A;  3QJY A;  2KCT A;  3FVQ A;  5EBD A;  4DUZ Q;  2TMP A;  2DGY A;  3LNN A;  2NWG A;  4ID6 A;  5IYC H;  3HOZ B;  4HJ7 A;  1IL2 A;  1TWH B;  1Y1W H;  5C44 H;  3X3M A;  3S2D H;  3J7A V;  1ET9 A;  4A3F B;  1HUN A;  1MSH A;  4IJL A;  4CDC C;  1QNK A;  3U9O A;  1KAB A;  2JEB I;  2HCC A;  4CJ2 C;  1I50 H;  3A55 A;  3DUZ A;  2B2Y A;  1K8M A;  1VQN A;  4DR1 Q;  1F2Z A;  3K0X A;  3OIQ A;  1Z7T A;  4FDB A;  4A3D B;  2R7Z G;  2B8G A;  4C3J H;  5JPM C;  1V43 A;  2H5X A;  2D0P A;  4DR2 L;  5IGC A;  2K01 A;  4J8Q A;  2J0T D;  3NQI A;  3QB3 A;  2KHJ A;  1LAC A;  3S1M B;  4XTC S;  2PNR C;  1RHP A;  5ELC A;  3M4O H;  1M90 C;  3P20 A;  1F9R A;  4LF6 Q;  3K5L A;  2J7Z A;  4DR5 L;  4TQU S;  3OYY A;  3VR2 A;  5E1F A;  2OF1 A;  5C0X J;  1VCI A;  1R4P B;  4KHP Q;  2KBN A;  1HA6 A;  2BDN A;  2R93 H;  1E7Z A;  3HOU B;  1U9R A;  3A74 A;  5KND A;  1Q1E A;  1PRT F;  1DYQ A;  2B3G A;  2TSS A;  2HQE A;  4JOI C;  1QVF A;  2JK8 A;  1P16 A;  1WTQ A;  1Q3L A;  4DUY L;  1MD2 D;  2PZW A;  2D5D A;  4DKA C;  4HAE A;  5IT9 E;  4MHE A;  3Q6S A;  5FO7 B;  4B9X A;  4DV1 L;  4G7Z C;  4A3K H;  1DOK A;  4NXM Q;  3GTO B;  3LX0 A;  5IY0 A;  4OWT B;  4POF A;  2PQA A;  3SK4 A;  1HR0 L;  1L0Y B;  3FKI B;  3GTP H;  3T53 B;  5EKI A;  4QF4 A;  5IOC A;  3CME A;  2Z9H A;  3D4W A;  2F52 A;  4M8A A;  4RGT A;  5C4H A;  2CQA A;  3E3X A;  1XMQ Q;  3ICE A;  4TRD A;  3PIP 3;  2E2J B;  3T1H Q;  1I6H H;  3S1Q H;  5AFW A;  5M5Y H;  3ND9 A;  1VQJ A;  4YWM A;  2UU9 L;  1X6O A;  1WTR A;  2J4X A;  1FNW A;  1EL0 A;  2AQ3 B;  4UAI A;  3BZK A;  3HOY B;  4DAY B;  3I2Z A;  4ME5 A;  1HZA A;  1JJC B;  3VA7 A;  3MWY W;  3MC0 B;  4H7B A;  1CHQ D;  1QIL A;  1O80 A;  2YTX A;  4IPG A;  3WOF A;  3AEV A;  3L7Z C;  5BN3 A;  1GHK A;  2NVY H;  3J81 L;  3J80 L;  3NK9 A;  1IBM L;  1OTC A;  2I5M X;  3GTK H;  1LV9 A;  2AQ1 B;  1TS3 A;  4CKB A;  1WD0 A;  1X3F A;  3HFZ B;  4CKC A;  1F9S A;  1QG7 A;  5CV9 A;  3J7Y W;  2B2V C;  3K5M A;  1CQF A;  2I0Q A;  2LMC B;  1Q8K A;  3NPP A;  5A2Q L;  5GAG C;  1PH6 A;  3K80 C;  1GD7 A;  4A3J H;  1KAW A;  1F2M A;  2SNS A;  1CHP D;  1YJW A;  5LL6 S;  1M1K C;  4QL5 A;  5EPK A;  3I7F A;  3NHH A;  1E24 A;  2QEX A;  4LF9 L;  2JA6 B;  4EQP A;  4BY1 H;  3IL8 A;  1U4R A;  2B8F A;  4NPS A;  1SNP A;  3A5Z B;  1PV4 A;  1ZYR D;  3M7N A;  2KOL A;  5FKA C;  1B7Y B;  4RAU C;  2MQH A;  2EXZ A;  2YTV A;  2EJM A;  3PMF A;  2PZU A;  5G3L D;  1X65 A;  2UUC L;  4IOC A;  2WIN B;  4JC0 A;  2UXB L;  4CKE A;  2R3Z A;  3LGJ A;  3A8K E;  3BDL A;  2M00 A;  2EY6 A;  4LMQ D;  3Q24 A;  1GUG A;  1SRU A;  2A68 D;  3HOZ G;  2E8G A;  4X65 Q;  2JE6 I;  3UDF A;  2R92 G;  1EFI D;  1U4M A;  1VQG A;  4A3F G;  1E2V A;  1EUJ A;  1AE2 A;  1KDB A;  2O4X A;  4FXK C;  1VMC A;  4DU9 A;  3TP5 A;  5J22 A;  2K14 A;  2K33 A;  4RKB A;  5FO9 B;  1KLU D;  4R4I A;  3KLW A;  1HR0 W;  5IWA Q;  1KRT A;  4MZ9 A;  4A3D G;  1VQD A;  4G57 A;  5CC4 A;  1PYW D;  1E2Z A;  3CPF A;  3KFU A;  1EEI D;  2EJG C;  2F0F A;  1K73 C;  1S5E D;  4KKT A;  3N6R A;  2QEJ C;  2JA6 H;  2VXW A;  2YV5 A;  4JI7 Q;  2A69 D;  3T56 B;  1IBL L;  2VQE L;  1PH4 A;  3CC2 A;  4BWG B;  3W5O A;  2JA8 H;  1SND A;  4KKU A;  3J7A F;  1SNQ A;  2OQ0 A;  1I6V C;  2K4K A;  1HZB A;  1J5E Q;  4DV0 Q;  4OO1 I;  3HKS A; 
#chains in the Genus database with same CATH homology
 2QDB A;  2N55 A;  4EQO A;  2F4I A;  4EVO A;  3BVM A;  1FNV A;  2MP1 A;  2NYZ D;  2PZT A;  3S1N B;  3FDT A;  1NUC A;  5DEH A;  3D4D A;  4MIU A;  1B2T A;  1EY4 A;  3U9S A;  2XWJ B;  1PFM A;  1PRT B;  1S5F D;  3FPU B;  1QJO A;  4XQQ A;  1TWC B;  2VUM B;  3BG3 A;  1C4Q A;  5C4J B;  5IIF A;  1GOZ A;  1CFM A;  3DWQ A;  4JK1 C;  4KY5 A;  1KDC A;  2RSN A;  3Q23 A;  1A3V A;  4NP5 A;  4TKO B;  1SE4 A;  4XT3 B;  4DAY A;  2KQ3 A;  4O1N A;  1I4H A;  5JVH 3;  4RH6 A;  1Y8P B;  2E74 C;  3V2T A;  2L11 A;  5D65 A;  2XIW A;  3EFX D;  1MGS A;  1STY A;  5M5X B;  1R9T B;  5EPJ A;  3SK8 A;  3M4Y A;  4JBW A;  3H3V C;  1B4O A;  1JC7 A;  1ENC A;  4KMU C;  1TWA B;  2Q8T A;  3GTM B;  4IUV A;  4RHR A;  5EKL A;  1LAB A;  1CTM A;  3S9W A;  1IHZ A;  1SBB B;  1LT3 D;  2M2L A;  4CJ0 B;  1BUV T;  3Q0A A;  1QWY A;  1G2S A;  3H0G B;  3S1R B;  2A5H A;  1MSG A;  3RD4 A;  3RLF A;  1DOL A;  1ZEQ X;  2RBM A;  2A6H C;  2K32 A;  4F88 A;  5K5P A;  2PW7 A;  1EY5 A;  4ZUJ A;  3GTJ B;  3A8I E;  1V1O A;  2NB0 A;  5DM7 3;  1SJE D;  3M3Y B;  3VYU A;  2L9H A;  1Y8O B;  2L1B A;  3AU7 A;  4OO1 H;  4TSS A;  1U4L A;  1M4V A;  3F2U A;  3CQZ B;  1H9S B;  3HRZ C;  2F1M A;  1KNA A;  4FYD A;  1SSO A;  2SDF A;  1BO0 A;  4H13 C;  3TBI B;  4DNT B;  1S5D D;  4G7O C;  3BZD B;  4WRD A;  3DM1 A;  5CGK A;  1J8I A;  4IFD H;  2F0S A;  1RTO A;  3NE5 B;  2AQ2 B;  3VYT A;  1A3T A;  2H4O A;  2LFN A;  1ML0 D;  3BYY B;  3RZD B;  1KLG D;  2ZXO A;  3S2H B;  4RWS C;  2B2Y C;  2VB2 X;  5JAV A;  1F9P A;  1ZYR C;  3BS1 A;  2IJ0 A;  2K1B A;  2BE5 D;  2D9U A;  3IAY A;  4IZ8 A;  2ID0 A;  3ITP A;  1SNM A;  3I70 A;  2IX0 A;  4RCO A;  4PQX A;  3A54 A;  2A68 C;  4XDX A;  4HCS A;  1BCP F;  1B1Z A;  4ZLT F;  1NCV A;  1SDF A;  1FGB D;  2F3V A;  3KLR A;  1EYC A;  2CHB D;  3FMC A;  4NMZ A;  3K7A B;  4C2M B;  1JR0 D;  2MUY A;  4CGY B;  1HQM C;  1TT2 A;  4XYO A;  2F03 A;  3R8B A;  1LT6 D;  1B53 A;  1LTR D;  1I4X A;  3M7G A;  5I6W A;  1NR4 A;  4B9W A;  2WP8 J;  4BA2 I;  4OHJ A;  3HP3 A;  5I2X A;  1S5B D;  3K57 A;  5IGE A;  2FIN B;  4K6D A;  1CZG A;  1RJT A;  1EIH A;  3OPO A;  4AYB B;  3HEJ A;  1Y1W B;  5ELF A;  3OMG A;  3S2D B;  2ZXP A;  4N9T A;  2KUM A;  1BR9 A;  3L3O C;  1I50 B;  2RKS A;  2EDG A;  1VDZ A;  2NN6 G;  1RCV D;  4RA8 A;  5E3F A;  3RMH A;  3CRL C;  2BOS A;  4C3J B;  1C8C A;  1SYE A;  3VR4 A;  1HCZ A;  2ICE C;  1WCM B;  1L0X B;  4CHT B;  5KNB A;  1LT4 D;  4ILW A;  2G9D A;  1STN A;  3M4O B;  4OIJ A;  1HXY D;  1H9S A;  3CKI B;  5HGT A;  2R93 B;  1VMP A;  5I9O A;  4DNR B;  2HUG A;  2Z8L A;  1A3U A;  1OXX K;  3I8Z A;  1X3P A;  1PRT D;  3DMU A;  3R2T A;  5K36 H;  1EWH A;  1PTO B;  2CVR A;  1BF4 A;  4NDX A;  1T5E A;  2CW0 D;  5J1Z A;  1IW7 D;  1IKM A;  3T16 A;  2NBF A;  4A3K B;  5NUC A;  1W6K A;  4KK7 A;  3OHX C;  1HTL D;  3ERQ A;  3T13 A;  5E4W C;  4KD3 A;  4V19 0;  1HRJ A;  3VR6 A;  4R8I A;  3GTP B;  5CV7 A;  4HED A;  3KBG A;  3C3L A;  4X3K A;  1Q1B A;  1JWS D;  1FYC A;  1SMY D;  1OO9 B;  1SE3 A;  1I6H B;  3S1Q B;  1CA6 A;  4XQJ A;  2Z4I A;  5M5Y B;  2F0T A;  2FFK B;  2IPK D;  4LJZ C;  1LO5 D;  2FJ2 A;  2EY5 A;  1BBX C;  1PTO H;  2FMM A;  2X6L A;  5CV8 A;  2R6G A;  2H1E A;  3SR1 A;  2HCI A;  1A2U A;  2NVY B;  3MXU A;  3H6M A;  5TSS A;  3GTK B;  1HTP A;  1YNN C;  2K7V A;  1O7L A;  5C0X H;  2A6H D;  2EY1 A;  4IUQ A;  3NP8 A;  1X3Q A;  4WOR A;  4HTH A;  4A3J B;  1SEB D;  2I07 B;  1BCP B;  4L6T B;  4C56 C;  5EPL A;  2F3W A;  4KN4 C;  3SVM A;  3TP7 A;  1QOH A;  1ENF A;  2ZT9 C;  3A7L A;  3I4L A;  5CV6 A;  4BY1 B;  2F0I A;  2AWO A;  3NTK A;  1GHJ A;  1OXV A;  1EY9 A;  3UI2 A;  4WFN 3;  2F0O A;  1Q90 A;  1XXG A;  4BA1 I;  4RKL A;  1PFN A;  1OXT A;  1RF2 D;  5BN5 A;  3C2P A;  2QF7 A;  3K59 A;  2BE5 C;  2O2L D;  2B2U A;  3NSW A;  5FOB B;  5BN4 A;  3TN2 A;  1F2L A;  3JAM E;  1I4R A;  3MEH A;  4Q0F A;  5EBC A;  1SYD A;  2X6G A;  2K5W A;  4KHZ A;  1EOT A;  2O5J C;  5IGG A;  2G9H D;  1O7Y A;  2PQE A;  4X3T A;  5I6Y A;  3ONA B;  5IGD A;  1PZJ D;  2EYL A;  4C3J G;  5C4Z A;  3FPP A;  2B2T A;  3GV6 A;  1WTW A;  3E5S A;  2E2D C;  1Z6H A;  5ELE A;  1NAP A;  3T4A C;  2JA8 B;  2RQX A;  3I73 A;  2PMZ B;  1PMR A;  4ZQ3 A;  3Q22 A;  2JEA I;  1EY7 A;  4A3G B;  1I4Q A;  3BYT B;  1JQY D;  2JSO A;  4O42 A;  4RGM A;  1LTS D;  4FO2 A;  1CZW A;  1AEX A;  4FXD A;  2RDF A;  1NSN S;  3GV3 A;  3HGB A;  5CR3 A;  4G7H C;  3AMU A;  2KEC A;  2JA5 B;  4U67 3;  1QB5 D;  1AW7 A;  1FR3 A;  3WDN A;  5IT9 L;  5KGU A;  4HR7 B;  1G6Z A;  3HOV B;  4EQN A;  5JPN C;  2Y0S B;  1S5C D;  2E76 C;  1ESR A;  4ZK9 B;  1GUO A;  1TII D;  1UAP A;  1CK1 A;  2EYP A;  1RD9 D;  2K5Q A;  1TKW B;  3KK7 A;  5JJZ A;  1A2T A;  1EYD A;  3NTH A;  4K2K A;  1STH A;  2MHV A;  3OMC A;  5ELB A;  1DOM A;  3NBI A;  2IX3 A;  1DM0 B;  2BDO A;  3HKZ B;  4ZKC B;  4PMC A;  3D4R A;  1LTG D;  1WTV A;  5IOD A;  4FXG C;  1TVX A;  5C6A A;  4BBS B;  1UNS A;  1EEF D;  1O7Z A;  3C1F A;  4J1M A;  4BY7 B;  1V1P B;  2F0J A;  2OT2 A;  4IFD I;  4Y7N B;  1PRT C;  3C1E A;  3GO5 A;  3OIP A;  5JEA G;  3DEP A;  2CW0 C;  1IW7 C;  4E6I A;  3JAM L;  4KV6 A;  5I4D A;  3N52 A;  1WTO A;  4K8J A;  2OEO A;  2JYO A;  1PZI D;  1CI3 M;  1TU2 B;  1T5X D;  5CV5 A;  4OL7 A;  2RDG A;  5T1I A;  1SMY C;  1ENA A;  4XQN A;  3GP7 A;  4DFA A;  2JA7 B;  3TDQ A;  1IYV A;  3E6Z X;  1ZKO A;  1SE2 A;  1A15 A;  4IUP A;  1STB A;  1J9O A;  1JOQ A;  1EQV A;  3K5N A;  4C3I B;  1JB3 A;  1D5M C;  1ROD A;  4H0L C;  4QIW B;  5EKK A;  2WAC A;  4KN7 C;  3PUW A;  4M1U B;  4PNY A;  5EQ0 A;  4LK1 C;  3NWT A;  3WOE A;  4B08 A;  1I3Q B;  2B2W A;  4A3E B;  3OW7 A;  3MFG A;  1EWC A;  1BQQ T;  4R8N A;  1PTO F;  2C9O A;  3D6C A;  3MXP A;  4X3U A;  2PO4 A;  1HUM A;  2F0V A;  1QCB D;  1YNN D;  4RHS A;  3VR5 A;  4J6H A;  4KI0 A;  3HZX A;  1EY0 A;  1HPC A;  5HUR A;  3LWE A;  4C1N K;  1H9M A;  1XTC D;  5E4X A;  1S4Z A;  3I91 A;  1EU4 A;  5T1G A;  5C3X A;  2XVS A;  3M85 A;  1AN8 A;  1JWM D;  2VB3 X;  2IT1 A;  1BCP D;  4WJW A;  1TS4 A;  3I72 A;  4ZKB B;  4PMB A;  3HOX B;  2R61 A;  2AUK A;  4L8J A;  2NN6 H;  1JWU D;  2K03 A;  1IKL A;  3HS0 C;  2XRS D;  3K58 A;  4QB4 A;  1FNU A;  1ESF A;  1V1P A;  1AFP A;  2QIL A;  2HDL A;  3MFY A;  2BA1 A;  4ZRZ A;  4YIJ A;  3V96 A;  4QUC A;  1STA A;  2EY2 A;  2D62 A;  3EJI A;  1AP0 A;  1MI2 A;  1TY2 A;  2KED A;  2SOB A;  1RKN A;  3NQT A;  3P75 A;  2LS0 1;  1HHV A;  2K5D A;  3SXH A;  2PYK A;  1AZP A;  3URY A;  4L63 B;  3FRP B;  3O13 A;  1KTK A;  3VA5 A;  1JIC A;  2DN8 A;  1H9J A;  1D5Z C;  2Z1C A;  2EJF C;  3SEB A;  2V4D A;  2B39 A;  1YNJ D;  3KLS A;  1TY0 A;  5M3M B;  1D2B A;  1X32 A;  3BDC A;  2KJX A;  1SXT A;  3RZO B;  1TQO A;  3A8J E;  4I65 A;  4KTA A;  4IQZ A;  3NTI A;  4Z9C B;  1QE6 A;  5C0X I;  3GTQ B;  1B9N A;  5ELD A;  2NTS A;  2KCN A;  5KYI A;  4C3I G;  3VYS A;  3CRK C;  2L5T A;  1KDA A;  2WII B;  1F2Y A;  5C3W A;  3GQB A;  3GD7 A;  4OO1 G;  2F0G A;  4UDU C;  2IL8 A;  1TWG B;  3QIA A;  4RGN A;  5CV4 A;  1C48 A;  1UUP A;  2LY7 A;  1G2T A;  4K5V A;  1EZ8 A;  4DAV A;  2B2U C;  1LLR D;  2NVT B;  2NVQ B;  4IFD G;  1GJX A;  3NBH A;  2F0P A;  3BVG A;  5KYL A;  3KUP A;  2L0C A;  1TS2 A;  1ET6 A;  2RDH A;  2M9V A;  4GZY C;  2Z4H A;  3OWF A;  5D14 A;  1EIG A;  5I9P A;  2B2T C;  3J81 E;  3HOW B;  3J80 E;  5DNF A;  5KRU A;  2IW3 A;  5FK9 C;  1JOR A;  3E0J A;  1PFB A;  4IUN A;  1SNC A;  4ABN A;  3MA2 B;  1V8Q A;  4DN4 M;  5A2Q E;  1CM9 A;  2WKC A;  4A93 B;  1A6X A;  3NXW A;  4A3I B;  2R92 B;  5DAU A;  1ILP A;  3S17 B;  2L12 A;  5KEE A;  3H09 A;  1XX8 A;  4ODG A;  4XYQ A;  4DK1 A;  3MTS A;  2BCO A;  1JOK A;  2VNU D;  1Y1V B;  2DNE A;  3C46 A;  2EPB A;  2WAQ B;  2KVM A;  4PMW A;  4F87 A;  2KA7 A;  1KAA A;  4FVM A;  4ZAI A;  2DNC A;  2A74 C;  5CMD A;  4DXG A;  2BA0 A;  3DXJ C;  3G6J B;  1Y69 U;  3PUZ A;  1TR5 A;  1SYF A;  2Q8R E;  1XYI A;  2PCF B;  1HA5 A;  3NUC A;  1DXM A;  1CA5 A;  5KIX A;  3AB9 A;  3BVZ A;  2F0N A;  2NVX B;  3IFT A;  1BXT A;  1BCP C;  1WD1 A;  2IX1 A;  4OGQ C;  3NWS A;  3TP6 A;  4K5W A;  3QOJ A;  3MVV A;  4ZUI A;  3HG9 A;  1D6E C;  3KLS X;  3P1H A;  3SK5 A;  2QCP X;  2RVL A;  2ENB A;  2SNM A;  5CBE E;  2A6E C;  4OIK A;  5JEA J;  1I4G A;  1WVL A;  3I90 A;  3SK6 A;  2E2I B;  1GXD C;  3KBX A;  1GUN A;  5C5L A;  3ERO A;  2EYH A;  1E2W A;  2EVB A;  5LL6 X;  5K36 G;  5C4X B;  2N88 A;  3D31 A;  1DD2 A;  3MHB A;  1UEA B;  4DAP A;  2RA4 A;  1VF7 A;  5I2Y A;  3DWP A;  3LWU A;  1B3A A;  2DY8 A;  3PO3 B;  1Z47 A;  2NUC A;  1STE A;  1STG A;  4Q5V A;  4KJN A;  2KHS A;  4C1N I;  5JEA H;  3PIO 3;  3PO2 B;  2K04 A;  2YYZ A;  4KHV A;  2D2C C;  5D3D A;  3G7L A;  1F77 A;  1KNE A;  3IFD A;  3S16 B;  2NTT A;  1YNJ C;  1JOO A;  1SAP A;  1SYC A;  2C5C A;  2XNA C;  2E2H B;  2EYF A;  1JE4 A;  5JVG 3;  5CBA E;  5JOB A;  2YU9 B;  2B2W C;  4A3M B;  1MBY A;  4QMG A;  1ILQ A;  4NKL A;  5A35 A;  3I3C A;  2WKD A;  4H44 C;  5C0X G;  2IWH A;  2A73 B;  1BOS A;  2GA4 B;  3V05 A;  3TP8 A;  4KY6 A;  1II3 A;  1ICW A;  3KF8 A;  2JP1 A;  2XRQ D;  2K05 A;  3DWA A;  4PV1 C;  2X69 A;  1EU3 A;  1WTX A;  3H91 A;  2WB1 B;  3D3R A;  1CQV A;  4ZYS A;  1Q8I A;  2F0D A;  5G3L F;  5KNC A;  2EOT A;  1PLF A;  1FD7 D;  4DK0 A;  2EYM A;  5IGF A;  4I7Z C;  1EY8 A;  4HMJ A;  3OSO A;  1B50 A;  1H9R A;  1SYG A;  2NN6 I;  4CBV A;  5DM6 3;  4F8M A;  4KD4 A;  1EYA A;  1K8O A;  3PUX A;  3K6O A;  1D1K A;  4KY7 A;  1WTP A;  1GUT A;  3I4M B;  1LTB D;  4HSV A;  1G29 1;  1ZXT A;  4QCL A;  1G91 A;  4DXF A;  3R3O A;  3S14 B;  3EQL C;  1LTT D;  2B63 B;  1TWF B;  3MAQ A;  4HN7 A;  3TZD A;  1F9Q A;  1B44 D;  5COY A;  1BNZ A;  2L4N A;  2F0W A;  3RUZ A;  3GTL B;  2I46 A;  4FF3 A;  2ZXR A;  1OXU A;  2MJ8 A;  1DON A;  2B2V A;  3GTG B;  3W3A A;  1PTO D;  4QUF A;  1BDO A;  2XN9 C;  1U4P A;  4BBR B;  2K6A A;  1PZK D;  1JCK B;  4RGO S;  1DZ1 A;  4U68 A;  3TZU A;  2FMC A;  1RTN A;  3TSS A;  4P2C B;  2EZV A;  1IL8 A;  3K5O A;  5IGB A;  4FF2 A;  2NZ1 D;  4K6L A;  3S15 B;  4KJO A;  2MGS A;  4DF7 A;  1D1I A;  1HQR D;  3CU7 A;  1LT5 D;  3I4N B;  4HCE A;  2ICI A;  2L55 A;  4K2L A;  4LAA A;  1GUS A;  4BS9 A;  4C3H B;  3A7A B;  3PUY A;  1TS5 A;  3P7J A;  4EGV A;  1QNU A;  1HFG A;  2KEE A;  3PUV A;  3R2I A;  4CJ1 B;  2F0E A;  2EE1 A;  2SEB D;  3FEW X;  4IFD J;  2QKI C;  5D3I B;  4F7X A;  4N9P A;  1NR2 A;  3K0Y A;  4G4K A;  1DJR D;  3QOL A;  4MN3 A;  3W2D A;  5J39 A;  4IUT A;  5LHY 1;  4XXE A;  4R9W A;  1PXU A;  3TME A;  2EYJ A;  4K8I A;  2R7Z B;  2XWB B;  3MZ5 A;  2A6E D;  5FLX E;  2WV6 D;  1Q12 A;  1RDP D;  3SDZ A;  1W6J A;  1XWE A;  3SE0 A;  2E75 C;  5F2D A;  3VYR A;  3IKJ A;  3QWN A;  1EY6 A;  4X3S A;  3SHL A;  3DHQ A;  4A3B B;  1EZ6 A;  3ND8 A;  1B9M A;  3ZYY X;  2HDM A;  2F0L A;  3VR3 A;  2F0Q A;  2OXP A;  2FHT A;  4K5X A;  4HSP A;  4FNF A;  4FP5 D;  2F0K A;  4S3S A;  2AUJ D;  2MPM A;  5FO8 B;  1DCZ A;  4HMI A;  1H9K A;  2K28 A;  2AWN A;  5M3F B;  1M8A A;  4IAL A;  3QO2 A;  5C3E B;  2LKV A;  3MXG A;  4FF4 A;  4IN3 A;  1CT1 D;  5CYU A;  5M5W B;  1VF5 C;  1EQT A;  1LTI D;  5C5M A;  2PW5 A;  3OWE B;  4V0B A;  5EGT A;  2A69 C;  1GUW A;  3A56 A;  1OXS C;  1Y8N B;  3PV0 A;  4NW2 A;  3EVQ A;  2EYO A;  1AZQ A;  1SFO B;  3D6W A;  4DA2 A;  1R4Q B;  4ULL A;  1HFN A;  1SNO A;  3R93 A;  4KKS A;  2O5I C;  4DGZ A;  5COR A;  1SYB A;  2KCC A;  2Q8I B;  2DY7 A;  3EA6 A;  1O78 A;  4IUR A;  3L9A X;  2F0M A;  3MXN A;  3BDO A;  1PDQ A;  2RSO A;  5C44 B;  3OOC A;  3H94 A;  4IUU A;  3D8G A;  4RCN A;  4RFB A;  4XT1 B;  3T51 B;  4K14 A;  2F0U A;  5M9O A;  1ONL A;  1I4P A;  2XSC A;  1LTA D;  3QG1 A;  3X3N A;  1D5X C;  2JXM B;  2PPB C;  1G8Z D;  1IYU A;  1SJH D;  5ISR A;  3DEO A;  4FF1 A;  4C3H G;  4XIG S;  1K83 B;  5EJW A;  3CHB D;  5FLX L;  2F0H A;  1E0B A;  1PTO C;  3QJY A;  3FVQ A;  5EBD A;  2TMP A;  3LNN A;  2NWG A;  4ID6 A;  3HOZ B;  1TWH B;  3X3M A;  3J7A V;  1ET9 A;  4A3F B;  1HUN A;  1MSH A;  1QNK A;  3U9O A;  1KAB A;  2JEB I;  2HCC A;  4CJ2 C;  3A55 A;  3DUZ A;  2B2Y A;  1K8M A;  1F2Z A;  3OIQ A;  1Z7T A;  4A3D B;  2B8G A;  5JPM C;  1V43 A;  5IGC A;  2K01 A;  4J8Q A;  2J0T D;  3NQI A;  3QB3 A;  1LAC A;  3S1M B;  4XTC S;  2PNR C;  1RHP A;  5ELC A;  3P20 A;  1F9R A;  3K5L A;  2J7Z A;  4TQU S;  3VR2 A;  5E1F A;  2OF1 A;  5C0X J;  1VCI A;  1R4P B;  1HA6 A;  2BDN A;  3HOU B;  1U9R A;  5KND A;  1Q1E A;  1PRT F;  1DYQ A;  2TSS A;  2HQE A;  1WTQ A;  1Q3L A;  1MD2 D;  2PZW A;  2D5D A;  4HAE A;  5IT9 E;  4MHE A;  3Q6S A;  5FO7 B;  4B9X A;  4G7Z C;  1DOK A;  3GTO B;  3LX0 A;  3SK4 A;  1L0Y B;  3FKI B;  3T53 B;  5EKI A;  4QF4 A;  5IOC A;  3D4W A;  4M8A A;  4RGT A;  5C4H A;  2CQA A;  4TRD A;  3PIP 3;  2E2J B;  5AFW A;  3ND9 A;  1WTR A;  2J4X A;  1FNW A;  1EL0 A;  2AQ3 B;  4UAI A;  3HOY B;  4ME5 A;  3VA7 A;  3MWY W;  3MC0 B;  4H7B A;  1CHQ D;  1QIL A;  1O80 A;  3WOF A;  3L7Z C;  5BN3 A;  1GHK A;  3J81 L;  3J80 L;  3NK9 A;  1LV9 A;  2AQ1 B;  1TS3 A;  4CKB A;  1WD0 A;  4CKC A;  1F9S A;  1QG7 A;  5CV9 A;  3J7Y W;  2B2V C;  3K5M A;  1CQF A;  2LMC B;  3NPP A;  5A2Q L;  1F2M A;  2SNS A;  1CHP D;  5LL6 S;  5EPK A;  3NHH A;  2JA6 B;  4EQP A;  3IL8 A;  1U4R A;  2B8F A;  1SNP A;  1ZYR D;  3M7N A;  2KOL A;  5FKA C;  4RAU C;  2EXZ A;  2EJM A;  3PMF A;  2PZU A;  5G3L D;  2WIN B;  4CKE A;  2R3Z A;  3A8K E;  3BDL A;  2M00 A;  2EY6 A;  4LMQ D;  3Q24 A;  1GUG A;  2A68 D;  2JE6 I;  1EFI D;  1U4M A;  1E2V A;  1KDB A;  2O4X A;  4FXK C;  1VMC A;  4DU9 A;  3TP5 A;  5J22 A;  2K33 A;  4RKB A;  5FO9 B;  1KLU D;  4G57 A;  5CC4 A;  1PYW D;  1E2Z A;  1EEI D;  2EJG C;  2F0F A;  1S5E D;  4KKT A;  3N6R A;  2QEJ C;  2VXW A;  2A69 D;  3T56 B;  4BWG B;  1SND A;  4KKU A;  3J7A F;  1SNQ A;  1I6V C;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...