2M9VA

Structure of saccharomyces cerevisiae est3 protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
STDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKISLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomere replication protein EST3
publication title Structure of Est3 reveals a bimodal surface with differential roles in telomere replication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m9vA00
2M9VA 5I2XA 2I46A 5I2YA
chains in the Genus database with same CATH superfamily
4XXEA 4EVOA 1HQRD 4XTCS 3HOUH 2JA5B 2K1BA 1B9NA 4Y7NH 1AH9A 2EQSA 1VQ7A 1RL2A 4C56C 3CCJA 3CC4A 1H95A 4AYBB 4JI8L 1DOKA 1LUZA 3HOVB 3G4SA 3TQYA 5E4WC 3G71A 1L1OB 3FKIB 1LTBD 3KLSA 2B2YC 4BS9A 5HY6A 1X3QA 2VUMB 5KEEA 2WKCA 4JPBW 3E9HA 2R92B 1WTWA 5CGKA 1JCKB 3I90A 3B6YA 4DR4Q 5CORA 4C2MB 4EQPA 4FVMA 1TWFB 2L12A 3J81i 5LMUL 5GAEC 1FNUA 3RZOB 5KYIA 3NUCA 4ZQ3A 4ZK9B 2BH8A 3E0JA 4CJ2C 4JYAL 3GD7A 5CR3A 1PV4A 2O5JC 1Y8PB 3I8ZA 1SMYC 4LF8Q 4CJ0B 5KNBA 3GTMH 1Y1VH 5IT9c 4LF4L 3KDFB 4RGNA 1SMYD 3MXPA 3O13A 1XNRL 5TSSA 2HDMA 2F0OA 4K8IA 3Q8DA 1SFOH 1I4PA 3GTQH 4KKUA 2OCEA 1DOLA 3RUZA 4BBSG 1V8QA 5JPNC 2B3GA 1UEBA 1MIUA 3PUWA 4HJ7A 2PNRC 1HUMA 3NQIA 1JR0D 2UXBQ 1B4OA 4A3DG 3U9SA 2HCIA 4J1MA 1SNDA 2F0PA 2X69A 5GAHC 1D5MC 4UP7A 3M7NA 1PH6A 3M85A 4XT1B 1JQYD 4GN5A 4KY6A 1BNZA 4A3EG 2K05A 2MO1A 1QUQB 4DNRB 1H9SB 2CWPA 4G7HC 1EIHA 1LTGD 2SOBA 2NN6H 1SNOA 4IPGA 1GHJA 1YVCA 3C3LA 2NVTH 2UXCQ 3S2HB 2Q8RE 2UUAL 1N9WA 4MHEA 3OYYA 3X3MA 1JMCA 1TWAB 4K14A 1S4ZA 3H3VH 4A3FB 3E0EA 3D6WA 1SYFA 4A3GG 2NWGA 2B2WC 1MGSA 4WJWA 3F2UA 5G3LD 3UDGA 3A0JA 1HZBA 4A3BH 3C2PA 3VYSA 1YNJC 1T9HA 4LFBQ 3X3NA 1TWHB 2IW3A 5C3EH 4LFAL 4DV1Q 5DM63 2N8NA 3T51B 5BN4A 1IBML 2JA5G 2A74C 1A8VA 3BZDB 3GP7A 4L8JA 1VS0A 4L5QA 2RQXA 2Z6KC 4ZKBB 4NXNQ 2CH4W 4F88A 1J8IA 3AU7A 4BA2I 4AYBG 1KNAA 4DR1Q 3PQIA 3HOVG 5EKLA 1OXUA 2TMPA 3Q23A 4P74A 1YJNA 3FKIG 1A0IA 2KCMA 3OTOL 2VUMG 1BBUA 2L9HA 1QNUA 2RKSA 3OHXC 1M90C 4KJNA 3RLFA 1H9KA 5I6WA 1HA5A 3NBIA 1EUJA 2F0WA 4O42A 5LL6X 1AN8A 4ZLTF 4YIJA 2GVAA 3BVMA 4BWGB 1QB5D 4BY7H 2SDFA 2FMMA 1L0XB 1NBWA 3DWQA 3P1HA 1ICFB 2AQ2B 1IYJB 2L11A 1PRTC 1PFMA 5E1FA 3RZDH 3GTKH 3C1FA 1PRTD 3H09A 3M3YH 3FVQA 3SDZA 1GUSA 3PMFA 2K5HA 4JI1Q 3RN2A 5T1GA 3E5SA 1IBKQ 2F0LA 1YI2A 1CI3M 5C0XI 5J22A 2HHHL 1IBLL 4IUTA 1WD1A 3JAME 4G57A 3DM3A 2Q2HA 3I7FA 2PI2A 3M4YA 4BXXG 5EJWA 2JA8B 4JK1C 1PTOB 4JI2Q 2VQEL 3LNNA 3BVGA 1H9JA 3S1NB 4R9WA 1L2FA 1KRTA 5FLMG 4A3KH 1EYGA 5ISRA 3NTHA 4DXGA 1R9TB 1F9SA 2WFWA 2KENA 4X65Q 4K2KA 1SEBD 2RF4A 3S2DH 4P2CB 3VR3A 1EU3A 4LF4Q 4TQUS 1E24A 3S15B 4AQYL 1E7ZA 1STNA 2QGQA 1QZHA 3GV3A 2WV6D 4A3FG 2E5LL 4X3KA 4GOPB 1PZKD 4GKJL 4WRDA 2KECA 1Q82C 1KNEA 4CJ1B 4TVAB 1T5EA 2R7FA 1I94L 5AFWA 4ABNA 2ES2A 4K0KL 2RCNA 1GUOA 1OO9B 4Q0FA 2EXDA 5M3MH 4DV4Q 1J9OA 1X9NA 3NTIA 4P75A 2RDHA 2VY3A 3PIP3 2A6HC 2E2JB 5IP9G 3L7ZC 2BE5C 2K5WA 4HJAA 4XQJA 4B3ML 3T53B 2BE5D 1LTLA 1PH9A 1NE3A 4RHRA 2I07B 2R6GA 1PRTB 2DNCA 4PMCA 4IJLA 2KBNA 1MKHA 4KTAA 1XMOQ 3S1RB 4DR6Q 2EYOA 5IGEA 2YTXA 3IFTA 1S3OA 4IUQA 4DV6L 1EFID 4G7OC 4BY1H 4CKBA 2F4VQ 1KTKA 4DV7Q 3SXHA 3ND9A 5JVG3 4NXML 3M4PA 4IQZA 5IYBH 4XIGS 1A2UA 1TY2A 5I2YA 5IYCH 3P75A 1LLRD 5M5YH 3G48A 2C5CA 2VB3X 5K36H 4FP5D 1VQDA 3NK9A 1B53A 2NB0A 1Y8NB 2JJQA 3BU2A 4ULLA 3PO3H 2KEDA 4DV2Q 2A19A 2Q8TA 1IKLA 1TWGB 2NVXB 4OXPA 5E4XA 4L63B 3T16A 1SLJA 3CAMA 1O7LA 2DY8A 3G6JB 1K83H 3M4QA 1VDZA 3J7YW 2DY7A 2NN6I 1CK1A 1WFQA 4DR2L 1CSQA 4OWWB 4B9WA 3KBGA 3MXUA 1JWSD 1A6XA 2VW9A 3GTOH 3H3VI 3ER0A 2JA8G 5AJ3L 1BBWA 3NTKA 4IOAA 1YNNC 2XRSD 3MVVA 3UE1A 1KL9A 3QR8A 1RHPA 2NZ1D 1YNND 1EQTA 3D3RA 5LMNL 3I4NH 1ZKOA 3HOUB 1ET9A 2RCFA 4Y7NB 3SK5A 3AFQA 1LABA 2B8GA 3H6MA 1STHA 1R4PB 1RF2D 2R3ZA 1DXMA 3A55A 3H3VC 3A7LA 3HG9A 1X55A 2ATWA 2SEBD 2F0KA 4BBRB 1NCVA 5JEAG 3DMUA 1Q86C 4WJ4A 4AIMA 2MP1A 4KHPL 2P5ZX 1PXUA 5M3FH 2UUCL 4L6TB 4YY3L 1AZQA 4B3TQ 3G7LA 4GNXA 4ILWA 1SE8A 3KF8B 4GZYC 4RKLA 5FLXc 3S1MH 1HNZL 1FL0A 4C3JH 3UE0A 1CKNA 3TEHB 2ZJRA 1S5DD 4PQXA 3ULLA 3BDLA 1JJGA 4DN4M 2UXDQ 4DV0Q 1FVIA 2QKIC 4JBWA 3MWYW 1NR2A 1Y1VB 2F0NA 3J81c 3CHBD 3GTMB 2CWAA 1HZAA 2VL6A 3DUZA 4RHSA 1PH3A 1AE2A 4P71A 2ENBA 3Q6SA 4YWKA 4DXFA 2OQKA 2XWBB 1SFOB 1Y1WH 3GTQB 2PW5A 1UE7A 1ENFA 2YU9H 1LYLA 4KJOA 4K6DA 2K03A 1G51A 2A6EC 1YHAA 3RLOA 1VQOA 2M00A 1VQ9A 2B29A 2A6ED 2WACA 5C5MA 3AYHB 3T1YQ 1SR3A 3W1BA 1MHWC 1I94Q 3MFYA 2JQOA 5A35A 4JI4L 4K0KQ 2B2UA 2I5LX 2ZXRA 3VR6A 1BVSA 1QVGA 5C4XH 3HOZG 5I9OA 1SMXA 2EXZA 4DR4L 2LXJA 1N36L 1VQ4A 4O1NA 5JJLA 3DHQA 1K73C 3HZXA 3QIAA 5C0XG 2K5QA 2NVTB 1TS3A 2V4DA 4QL5A 1Q3LA 5D3IB 5FJ8G 1ASZA 4IPCA 1KD1C 5G3LF 3CCUA 1D7QA 3N6RA 5DM73 4A3MH 2Q2IA 2F0TA 5E7NA 3ULPA 3L9AX 1EYCA 2GA4B 2X6GA 4UP8A 2UUBQ 4A93H 4EQ5A 1A63A 3MA2B 4I65A 5C5LA 1M8AA 1PH7A 4A3BB 1HA6A 3BYTB 5T1IA 1MJCA 3TSSA 4X64Q 1NR4A 2JEAI 3AQQA 3E9IA 3UDFA 3GTJH 1STYA 4JOIC 1FJGQ 2R7ZH 1SRUA 3T56B 2PPBC 3HOUG 4ZYSA 5EBDA 4POFA 2DUDA 5CV9A 2MUYA 1XPUA 4JG2A 2UXBL 3H91A 1SYCA 1HHVA 1TKWB 2JA7H 2NZOA 4KMUC 1VQ5A 4BBRG 5IOCA 3I4MH 1Z9FA 4FXKC 2UXCL 3PIO3 1E1OA 1F2MA 3JAML 1EL0A 4JC0A 1VQ6A 5AJ3Q 4BY7B 4RH6A 1S5CD 3PUXA 4NW2A 2EPBA 1TY0A 2KCNA 1PRTF 3KF6A 3F8TA 3MHBA 2VQFQ 2D0OA 4QUFA 3EIVA 4IPHA 1ET6A 1Y1VG 3HKSA 4V0BA 1I50H 3RZDB 3GTKB 3PO2H 4C1NI 5GROA 3M3YB 1E1TA 4LFBL 2L4NA 1EY9A 1I6HH 3W2DA 2D62A 1GJXA 2ZJQA 3KJPA 2IPKD 2IX3A 4NB3A 3I3CA 1U9RA 4IALA 2WAQE 2F0SA 4NXNL 2UUCQ 2H4OA 2WB1E 3H15A 1YZ6A 2QDBA 1ESFA 1PYSB 2XTIA 4HSPA 4DR1L 2B2TA 2K6AA 3HGBA 1LV9A 4G7ZC 2LXKA 2NVYH 2N3SA 3S9WA 3LX0A 3SHLA 2F0GA 1HNZQ 2I5HA 2Z0SA 4GLAC 4A3KB 1VQFA 2NYZD 1YIJA 2DNEA 3K57A 3HRZC 4H7BA 3S2DB 2NN6G 1QNKA 2WAQB 1W6KA 2EY6A 2V1CC 4PG3A 2EYPA 3OW2A 2WB1B 1DYQA 5JVH3 4OGQC 3BDOA 3K0YA 2O2LD 1JB7A 1D1KA 2G9DA 3WOEA 4UDUC 4C3HH 1STBA 1G91A 1U5KA 3MXNA 5FO8B 1EYDA 3VYUA 4A3BG 2NTTA 3CRLC 4JI1L 1Q1EA 4F7XA 2EYJA 2RSNA 1D2BA 1PH1A 1IBKL 5M3MB 2EY5A 1W2BA 3U50C 1F9QA 3BDCA 4JI4Q 5EAYA 1HQMC 5IGFA 1B3QA 4A3JH 1Z6HA 4HMIA 1N36Q 2EJFC 1VQKA 4K5VA 1D5XC 4CBVA 1K0SA 5EBCA 1CTMA 4JI2L 2BDNA 3JAMi 4RWSC 1B3AA 1HNWQ 4HCSA 1LT3D 1D6EC 1P16A 3UDIA 2AMCB 2SNSA 4X65L 4BY1B 1XXGA 3I73A 1VQGA 4A3IH 1HFGA 4XT3B 3ONAB 3I70A 3HOXH 3S17H 3R3OA 5IWAL 2F0JA 1VQAA 1RKNA 3HP3A 2HT1A 1QILA 1GOZA 3K5MA 2NZHA 5M5YB 1HZCA 4QIWE 3PSIA 3STBC 3TDQA 4BY7G 1HZ9A 2KCCA 3STBD 2F3VA 5EQ0A 5COYA 1HH2P 3U9OA 3V05A 3U4ZA 1K3RA 3PO3B 3PF4A 2HD3A 3BG3A 2XIWA 3J80E 1PMRA 3QO2A 5KIXA 4DAYA 4DV4L 3IKJA 2C9OA 1K83B 3OW7A 3MZ5A 1SJHD 3K59A 1CHQD 2A1AA 1EQVA 4QIWB 2ZT9C 1B7YB 2DN8A 1AZPA 3EQLC 1EIFA 3FPPA 1SBBB 4JV5Q 2K4KA 2AWOA 3T1HQ 3D4RA 3DM1A 2XNAC 3IAYA 1XMOL 4ME3A 4DR6L 3NEMA 2KCTA 2L15A 4DR3Q 3I4NB 3S16H 4XYOA 4A3KG 1ENCA 4R8NA 4DV5L 2F4VL 3NSWA 4DV7L 2K32A 4PMBA 3I72A 1EY6A 5IE8A 1DCZA 1TQOA 2B2VA 2WAQG 3K80C 3F2DA 3GTGH 3K6OA 3ZJYC 2CVRA 4HEDA 2WB1G 2R93B 5ELNA 1CM9A 4LUVA 2MFIA 4QY7A 3DEOA 4C1NK 2HIXA 1WTPA 1ICWA 1QOHA 4NMZA 5M3FB 2NBFA 3EVQA 1L1OA 3LGJA 2C35B 4DV2L 3WWVA 5DNFA 4FDBA 1VQMA 2G5DA 3F1ZA 1JOQA 1OTCA 3S1MB 3D6CA 1EY0A 4LF6Q 4C3JB 5M3MG 5ELDA 3E3XA 2JA9A 1QWYA 3CQZH 5EPLA 1X3PA 2HDLA 2RA4A 4OO1H 1DOMA 2HCCA 4DNIA 1PH8A 2ICEC 2YTVA 2K28A 1G6PA 1SDFA 5I4DA 2PQAB 1Y1WB 3A5ZB 4S3SA 1FYCA 4L5RC 1STGA 2Q2UA 1HUNA 2YU9B 1ILQA 3V2TA 3VR5A 1FGUA 3BS1A 4BY1G 2VZAA 1F9RA 4LUZA 4K5WA 1HJPA 1LTTD 4FF2A 4KY7A 2CCZA 1BKBA 1TIID 4B3SQ 1XJVA 3BYYB 3KLRA 1LTAD 5IYBG 3QG1A 1U4PA 1SE2A 1CKOA 5IYCG 4GNXC 1CQFA 3EJIA 5I9PA 5C4XB 4IOCA 1F9PA 1RIPA 1ML0D 2D2CC 3K7UC 5K36G 1IW7C 4KLKA 1MI2A 2KOLA 1IW7D 4B3TL 4FF1A 4DUZQ 3PO3G 1II3A 3C1EA 4PV1C 4ZCKA 4OONA 1QUQA 1H9SA 1QZGA 1S5ED 5CYUA 1PHJA 3CCRA 1NY4A 4U673 4A3MB 2LKVA 1NMFA 4ME5A 4OL7A 1F2LA 2UXDL 4KN7C 4DV0L 5KNDA 4A93B 1VF7A 3BZCA 4GKKL 4ODGA 2KA7A 5JPMC 1ONLA 4QGUA 4APVA 3RN5A 5IWAQ 3MEFA 3D4WA 2H5XA 3MAQA 4DF7A 3GTJB 1RTOA 2K7VA 3I4NG 4GLVB 4DA2A 2R7ZB 1JWUD 4C3IH 5A2QE 2B2UC 4IN3A 1O7IA 2K14A 1CHPD 2JA6H 3QOLA 4DAVA 3T1YL 1I3QH 2R93G 1B50A 4H02A 2JA7B 3GO5A 4YWLA 2BA0A 3DXJC 4OWXB 3GTLH 1C7YA 3I4MB 2PZTA 5M3FG 4KK7A 4TSSA 1L0YB 5BR8L 3K5LA 2IX1A 4N9TA 2D5DA 2A73B 3S1QH 2QILA 1F2YA 1GVPA 3Q0AA 1EQRA 2OEOA 3FRPB 1I5FA 4OWTB 4C3JG 3ZYYX 2RSOA 4CDCC 3CRKC 2VB2X 4GNXB 2UUBL 1OXVA 1KAWA 1B8AA 2R92H 3BZKA 2K04A 4DV5Q 1I4QA 3CU7A 5KGUA 4HTHA 2YV5A 3BJUA 1I50B 1WCMH 1N33L 3PO2B 1CKNB 5M5XH 4X64L 1Q46A 2IX0A 5IP7H 1I6HB 2OTJA 4QQBX 2E2DC 3IFDA 1HR0W 2NTSA 1FJGL 1Y1WG 1JOOA 3EFXD 3HOZB 1V1PB 1B9MA 3C46A 2R7DA 1K28A 4M8AA 2F1MA 2NVQH 5LL6S 4RFBA 2MNAA 5DLQE 2RDGA 1K9MC 1K3BC 3QJYA 3VR2A 3OMGA 3HEJA 4XQQA 2D9UA 2NVYB 5IGDA 3OWEB 1A2TA 2MQHA 2B2WA 4PNYA 5C4XG 1H9RA 1DONA 1X6OA 2F0DA 4N8X1 5LMNW 1PLFA 2K01A 4N9PA 4JI7Q 3A74A 2F0UA 3GTPH 1LT4D 3CKIB 5J39A 4IURA 5DAUA 3EBEA 1WI5A 1VMPA 4LAAA 1U4MA 5IYDH 3IRBA 1RTNA 1SXTA 4A3MG 3OPOA 1EOTA 2VQFL 4ID6A 3KLWA 4A93G 2O5IC 2GN5A 1E2WA 3R93A 1D8LA 2IL8A 4IJHA 4O0AA 2IT1A 1I4RA 4K5XA 2WKDA 4GOPA 2B8FA 1EY5A 4X66Q 1IYUA 3NBHB 2E2HH 5FKAC 2D0PA 5JAVA 4X3SA 2R7ZG 2F4IA 3MC0B 3RNUA 4KHZA 3SK6A 4NKLA 2PNHA 2F0VA 3I55A 3M4OH 2PO4A 1KC8C 1MSHA 1QVFA 3K0XA 5EKIA 4MNOA 4EQOA 3Q24A 2G9HD 1XTCD 2KHSA 4UY8C 1CZWA 2N78A 1BO0A 5CV6A 3J80L 2JA7G 4H13C 1HRJA 1BCPF 1KABA 5ELCA 1CA5A 3WOFA 1KDCA 3I4MG 4OO1I 3W1GA 3NXWA 1G291 4A3IB 2WIIB 4DK3C 1V1QA 4QF4A 3LWUA 2AKWB 3HOXB 4GKKQ 3S17B 5J3BA 2SNMA 4IPDA 3JAMc 1JE4A 2EE1A 2LFNA 3H0GH 3K7AH 1C0AA 5HGQA 2PMZE 5EPJA 4JI6Q 5F2DA 3F2CA 1GXDC 3KYHC 1ILPA 5I6YA 4A75A 4RGTA 4N8FA 3GV6A 2CKZB 1VQCA 4CDDC 2PZWA 1KIXA 3PO2G 3KF6B 4OHJA 3I91A 4DR7L 1DGSA 1SAPA 2ALYB 4GN4B 4NPSA 1X56A 3W3AA 5J1ZA 5LHY1 2PMZB 1W6JA 1JT8A 4IUVA 4OEMB 1X54A 3W5OA 4R4CA 5BR8Q 1BR9A 3TN2A 1FNVA 1HNWL 2KUMA 4Z9CB 1J5EQ 2YTYA 5C44H 3NHHA 4MIUA 1SYDA 1VQIA 4CHTB 2B63H 3S16B 3CCSA 5FO7B 1I4GA 5IT9E 4IFDJ 4ZAIA 3S14H 3E6ZX 3GTGB 2X6LA 3T13A 1S40A 1N33Q 1Z7TA 3GDEA 1CSPA 3TP8A 1PTOH 1UAPA 2EJMA 4LMQD 4NDXA 5C3EB 5FOBB 1TWCH 4RCOA 3CC7A 4QJFA 1NUCA 2KEEA 4MTNA 3J7AV 2LMCB 2EY1A 4Q5VA 5ELFA 5KRUA 1EEFD 5ELBA 5C0XJ 2HQEA 1G2SA 2DJGC 5M5WH 3SVMA 3AEVA 1VQBA 5IY0A 2B39A 1XMQQ 1RCVD 2JN4A 3A54A 3J80i 1V43A 3MXNB 4X62Q 1UE6A 1G8ZD 1KDBA 1HXYD 3KF8A 3OSOA 4A3JG 3R8BA 2WINB 3CQZB 2CW0C 2EY2A 1Q7YC 4JV5L 2EIFA 2XSCA 4HIKA 4ALPA 3T1HL 1VQEA 2CW0D 4A3CH 3M9BA 2K75A 1BF4A 1RDPD 4K8JA 1NTGA 2BA1A 2OTLA 4DR3L 1TS2A 2B2VC 1PA6A 5FLXL 1CQVA 1B70B 1ZXTA 5JJIA 1VQPA 1IL8A 4RGMA 1Q1BA 1EIGA 4DK0A 4DAPA 4A3IG 4O2DA 2ZXPA 4WORA 3ND8A 5K5PA 3TRZA 3HOXG 3PIPA 1EOVA 4KV6A 5C4JH 2BH2A 4H0LC 1L1OC 3J7ZC 4JI0L 1AEXA 1I4XA 1JICA 4JBJA 5L37A 5DEHA 3J7AF 1LO5D 3L3OC 3TS0A 3F2BA 4JI3Q 3DWPA 1N32L 2ZM6Q 1GM5A 2Z6BA 2PW7A 3KJOA 1WTXA 4IFDH 4RAUC 5A2QL 4HR7B 2IJ0A 1AFPA 2VNUD 1KHIA 1XTDA 3HOWH 2L1BA 2K52A 5CBAE 2QCPX 3KOJA 4LF6L 1I4HA 1LACA 3HOYH 2E75C 1VF5C 4X3TA 4DAYB 3K58A 1BXTA 1D5ZC 1XWEA 3CPWA 4HCEA 5H1SE 1EY4A 3CXCA 3R2TA 1EWIA 2Y0SE 2OXPA 1EU4A 3VA5A 3IL8A 2OQ0A 1N34Q 1JB3A 4HIMA 2TSSA 4LK1C 4CDEC 4HN7A 2RHSB 1F2ZA 2Q2TA 3SGIA 4C3IB 4OELB 2WP8J 2UU9Q 4A4IA 2JA6B 2XN9C 2FINB 4B3SL 1DJRD 2H1EA 1EWHA 5HGTA 4K2LA 1VCIA 1H9MA 1R4QB 4GN3B 1PH4A 5C3EG 2KHIA 2CQAA 4DR7Q 3GTLB 2Y0SB 5IIFA 4LF7Q 1KRSA 1K8AC 3CCLA 3DEPA 3NQTA 4DUZL 5IGGA 1G6ZA 1EZ6A 3VR4A 1JJ2A 4PZ7A 3S1QB 1MSGA 1RJTA 1EFWA 1SYEA 3HFZB 5JJZA 3A56A 3MEHA 5EPKA 1PZJD 1SNMA 2K5VA 3KLSX 3ULJA 4BBRH 3NE5B 3DWAA 1BCPC 2JK8A 1XPOA 1WTOA 3KBXA 5M9OA 4IO9A 4DFAA 2ICIA 1BCPD 4OO1G 1WCMB 5M5XB 2MGSA 2F03A 4QMGA 4HIOA 4JBMA 1GUNA 2FXQA 4B08A 1GUGA 4A76A 2MPMA 3CMAA 3MXGA 2ASBA 3TP5A 4KKTA 3N52A 1JC7A 2F3IA 5CV5A 2NVQB 4LFCL 5IGBA 1QE6A 4FO2A 1KLGD 1QCBD 2F0HA 1GHKA 3EA6A 3PUVA 4DUYQ 4WJ3M 4E6IA 2PI2E 4YHHL 2RBMA 1A3VA 3TP7A 4HIDA 3K5OA 2K33A 3OMCA 2AHOB 2F52A 1JJCB 1KAAA 1K8GA 2XWJB 1LT6D 2HIVA 3OIQA 1NJIC 3OOCA 3EROA 1Q8KA 2EYFA 2MHVA 2BOSA 3WDNA 4EGVA 3GTOB 1BBXC 3GTPB 1TS5A 4JOIA 4H44C 3I2ZA 4QB4A 4XDXA 1MD2D 2EDGA 4XYQA 1E2VA 4RMFA 3RR5A 5C3WA 4X6AH 4A3LH 1QJOA 4FF4A 1W3SA 4FNFA 4JBKA 1Z47A 1O80A 3NP8A 4QUCA 2PCFB 2VXWA 4UPAA 2F0QA 2OF1A 2AQ3B 2Q8IB 3RD4A 1LTSD 1Q90A 4EX5A 3S24A 1PH2A 1K8MA 4JI0Q 2J7ZA 2E2HB 1STAA 2BCOA 1O7YA 4LJZC 4U68A 4ZUJA 4C3IG 3M4OB 1AW7A 1A3UA 4LF9Q 2NUCA 3TZUA 1N32Q 2JA6G 1BCPB 2L0CA 4M1UB 1M1KC 1X3GA 1YITA 5CMDA 1PTOC 1YNXA 4TRDA 1EQQA 1XNQL 1T5XD 1PTOD 2KQ3A 2E2IH 2BDOA 4IUNA 1CUKA 1YNJD 1X32A 2Y0SG 2XRQD 2JEBI 3CPFA 4LW1A 1LM0A 5CV7A 2Z1CA 4DR5L 5D14A 2JXMB 4JI7L 1PFNA 1Q81C 4YCUA 1FGBD 4J6HA 4LUOA 5IODA 4LF5Q 4FYDA 3Q22A 2FFKB 4LNQA 3H0GB 1XPRA 4L5TA 5C6AA 3K7AB 4TKOB 4ZKCB 1P8LA 4JW0A 4B3RQ 2CQOA 1QG7A 4OX9Q 3KDFA 1E3PA 2ID0A 1O7ZA 2K50A 4GOPC 2CFMA 4DK6C 3TZDA 2R92G 3D0FA 5I2XA 1WTRA 4DV3Q 3SR1A 3CD6A 1GUTA 2EOTA 3ICEA 1WCMG 5IT9L 3I4LA 4R4IA 4YCWA 5IP7G 4X66L 2AUKA 3PIOA 1RODA 1ASYA 3D8GA 1AP0A 2E8GA 4BBSH 3CCEA 1SSOA 2A68C 4IFDI 1EZ8A 2JP1A 2A68D 3PV0A 2LY7A 1X3EA 1YEZA 2HQLA 2ZTEA 4A3DH 2IHEA 1PZID 4KD4A 4J15A 3UI2A 5FLXE 1WTVA 1SN8A 4CKEA 4HMJA 4JI8Q 5C44B 2RDFA 1EEID 2B63B 3PCOB 2Z8LA 4CKCA 4A3EH 1PVOA 2LS01 3VYTA 2QA4A 1EIYB 2FMCA 3J81E 1C48A 3S14B 3OWFA 1C9OA 4JVZA 3U4VA 2B2YA 1GO3E 5LMUQ 4OIKA 4LWCA 4F87A 2YYZA 4IZ8A 1TWCB 4JI6L 5IYDG 2M9VA 1SE4A 5ELEA 1HNXL 4RCNA 2MJ8A 4A3GH 4JYAQ 1SNPA 3V96A 1A62A 1ZYRC 4KD3A 1PYBA 4ZUIA 1FR3A 4LFCQ 3K81C 5M5WB 1ZYRD 2PYKA 4CGYB 1HPCA 3JC66 1XYIA 1K0RA 1XNRQ 1A15A 4YHHQ 1WJJA 3VDYA 3K8AA 1HCZA 2Z4IA 4FF3A 4MZ9A 4JCVE 3CCQA 2JA5H 1PFSA 4R4QA 3QOJA 1IL2A 3KFUA 1YJWA 2RVLA 1J5EL 4OIJA 3J80c 3HOVH 1HFNA 3FKIH 1TT2A 2VUMH 2IY5B 1EWCA 4JI5L 4HSVA 3I56A 3NELA 2PQAA 1IHZA 5BN3A 3NWTA 4MN3A 2A6HD 4C2MH 1B2TA 1TWFH 3MTSA 5C4JB 1EY7A 2EYHA 2A8VA 1U4LA 3H0GG 1FD7D 3QWNA 2L5TA 3RZOH 3U58A 1TR5A 2KJXA 3LWEA 3CW2C 2UUAQ 5E3FA 2VS1A 4WFN3 5EKKA 4EQNA 1O78A 2E74C 1Y14B 4QCLA 3FHWA 4UHVA 1YBYA 2N88A 3HS0C 5CC4A 3D31A 3HOWB 1CA6A 1NAPA 3NENA 1KDAA 1XMQL 1UEAB 3R2IA 1XNQQ 4X62L 1YJ9A 1C4QA 1Y69U 1PFBA 4FXGC 2CHBD 1ENAA 3HOYB 4LFAQ 4DAMA 1D1IA 3AFPA 4HJ9A 1V1OA 5C3XA 1B1ZA 2I0QA 4IUPA 1BQQT 1IBMQ 1VQNA 5JJKA 3SEBA 4DR5Q 1YHBA 4G4KA 3NPPA 1HR0L 3TMEA 4BXXH 1SROA 4HJ5A 1E22A 2GVBA 1MJEA 1V9PA 3A8JE 1PDQA 1HTLD 1JWMD 3J7A5 5C44G 1X65A 1EYAA 3SK4A 4HJ8A 4BA1I 2B63G 1Y8OB 2Z6KA 3OTOQ 3AB9A 5FLMH 1A3TA 1J6QA 3VYRA 2FJ2A 4C3HB 3EN2A 4I7AA 4PZ6A 3KUPA 1X3FA 2MO0A 4XQNA 4I7ZC 3S2HH 1UWVA 4POGA 3RLNA 1SNQA 4RGOS 1I6VC 1CKMA 4R8IA 3AMUA 1TWAH 2B2TC 2JSOA 1TXYA 4KY5A 4A3FH 5CV4A 4A3JB 4JI3L 2EYLA 2ZM6L 1OXTA 1KXLA 1UE5A 3CF5A 1VQHA 5GADC 1LTRD 1E2ZA 1AE3A 1Q12A 1VQ8A 2IHFA 2F0EA 2R93H 4CDFC 1S5BD 2QEJC 1UNSA 4KI0A 3P7JA 1TWHH 1SYGA 4NP5A 5NUCA 3A7AB 3HKZE 4K6LA 2E76C 4GS3A 3SK8A 4F8MA 5IP9H 4IUUA 1Q8IA 2L55A 4YCVA 2HHHQ 1IBLQ 3NWSA 2KVMA 1STEA 4A3CG 1IXRA 4DGZA 3MFGA 1B44D 1WOCA 3L0OA 1N34L 1GKHA 2EVBA 1VQJA 5JEAJ 3PUZA 4DK1A 5FO9B 2QDLA 2VQEQ 4R4TA 4DKAC 3FDTA 2PZUA 2UU9L 3BVZA 1WTQA 1HNXQ 2R61A 1L0WA 3L2PA 1NMGA 3HKZB 3M7GA 4DU9A 1TU2B 1V1PA 3ERSX 4RKBA 5KNCA 2J4XA 1FNWA 2F0IA 3TBIB 3K5NA 1C8CA 5JOBA 3D4DA 2KHJA 4AQYQ 3QB3A 2AQ1B 5BN5A 4LF7L 1CT1D 2M2LA 3TREA 3CCVA 1CFMA 2Z4HA 2FHTA 2E5LQ 3A8KE 1ESRA 1IYVA 4R4OA 3CP0A 1NNXA 3PGZA 4J8QA 4GKJQ 4IFDG 2HUGA 2RHQB 2XGTA 1G2TA 3HOWG 5CBEE 5C4ZA 3FEWX 3J81j 2ZJPA 1UE1A 5HURA 3HOYG 1IKMA 1U0LA 1YHQA 4JI5Q 2ZTDA 4UP9A 3URYA 1MBYA 1OXSC 4B3MQ 4KN4C 1DD2A 4GLXA 2JA8H 3TS2A 1TS4A 2DGYA 1UUPA 3GQBA 5KYLA 1HTPA 4DNTB 2I5MX 3S1NH 3I4OA 3FP9A 3TP6A 2IWHA 1WYDA 1JOKA 2JYOA 4LF8L 1R9TH 1PTOF 4DV6Q 4C3HG 3NBHA 2ZXOA 3T4AC 3FMCA 3VA7A 1LTID 4DUYL 1SYBA 4NXMQ 3S15H 3P20A 2F0MA 2JE6I 2E2IB 3CMEA 1CZGA 5C4HA 5JEAH 1GD7A 3RMHA 3PF5A 2J0TD 4KKSA 4P72A 5FK9C 2K5NA 4KHVA 4PZ8A 4YWMA 3ITPA 4V190 4L5SA 2AUJD 1BUVT 1KQSA 2EJGC 4B9XA 3KK7A 1GUWA 1KLUD 5CV8A 2OT2A 4RG1A 1DZ1A 3UDXA 1HR0Q 2N49A 1E0BA 2LSSA 4UAIA 2K5DA 2Z9HA 1WVLA 1SNCA 1S5FD 4RA8A 3FPUB 5GQOA 4P73A 1F77A 3A5UA 1QVCA 1JORA 1BOSA 4DR2Q 2E2JH 3H94A 1U4RA 1M4VA 3J81L 1SE3A 4MTKA 5GAGC 1EY8A 2XVSA 3PUYA 2A5HA 1VQLA 5IGCA 2A69C 3S1RH 4BBSB 1WD0A 3ERQA 2A69D 5LMNQ 1ZEQX 1PYWD 4LF9L 1S72A 2OWOA 1NSNS 1LT5D 2PQEA 3A8IE 2O4XA 3HKZG 1VMCA 2F0FA 4A3DB 3G6EA 2I46A 3CCMA 4Y52H 1RD9D 4DV1L 2EZVA 2F3WA 2DJFC 3HOZH 4ZRZA 1K8OA 1SJED 4A3EB 4FXDA 2AWNA 5D65A 1BDOA 1WTHA 1XX8A 4KHPQ 4LF5L 2ZTCA 2EYMA 2QW7A 4PMWA 5C0XH 3SE0A 4YY3Q 1TWGH 4B3RL 2NVXH 5FJ8H 4OX9L 4X3UA 1DM0B 5ELOA 4A3LG 5D3DA 4AH6A 4DPGA 2QEXA 4A3GB 4HAEA 4DV3L 2QF7A 1OXXK 2N55A 4AYBE 1IZ6A 1JE5A 4R1JA 5EGTA 1TVXA 3OIPA 3CC2A 1N8RC 2CH4A 1PH5A 1I3QB 3DLLA
chains in the Genus database with same CATH topology
4XXEA 4EVOA 1HQRD 4XTCS 2JA5B 2K1BA 1B9NA 4C56C 4AYBB 1DOKA 3HOVB 5E4WC 3FKIB 1LTBD 3KLSA 2B2YC 4BS9A 1X3QA 2VUMB 5KEEA 2WKCA 2R92B 1WTWA 5CGKA 1JCKB 3I90A 5CORA 4C2MB 4EQPA 4FVMA 1TWFB 2L12A 1FNUA 3RZOB 5KYIA 3NUCA 4ZQ3A 4ZK9B 3E0JA 4CJ2C 3GD7A 5CR3A 2O5JC 1Y8PB 3I8ZA 1SMYC 4CJ0B 5KNBA 4RGNA 1SMYD 3MXPA 3O13A 5TSSA 2HDMA 2F0OA 4K8IA 1I4PA 4KKUA 1DOLA 3RUZA 1V8QA 5JPNC 3PUWA 2PNRC 1HUMA 3NQIA 1JR0D 1B4OA 3U9SA 2HCIA 4J1MA 1SNDA 2F0PA 2X69A 3M7NA 1D5MC 3M85A 4XT1B 1JQYD 4KY6A 1BNZA 2K05A 4DNRB 1H9SB 4G7HC 1EIHA 1LTGD 2SOBA 2NN6H 1SNOA 1GHJA 3C3LA 3S2HB 2Q8RE 4MHEA 3X3MA 1TWAB 4K14A 1S4ZA 4A3FB 3D6WA 1SYFA 2NWGA 2B2WC 1MGSA 4WJWA 3F2UA 5G3LD 3C2PA 3VYSA 1YNJC 3X3NA 1TWHB 2IW3A 5DM63 5BN4A 3T51B 2A74C 3BZDB 3GP7A 4L8JA 2RQXA 4ZKBB 4F88A 1J8IA 3AU7A 4BA2I 1KNAA 5EKLA 1OXUA 2TMPA 3Q23A 2L9HA 1QNUA 2RKSA 3OHXC 4KJNA 3RLFA 1H9KA 5I6WA 1HA5A 3NBIA 2F0WA 4O42A 5LL6X 1AN8A 4ZLTF 4YIJA 3BVMA 4BWGB 1QB5D 2SDFA 2FMMA 1L0XB 3DWQA 3P1HA 2AQ2B 2L11A 1PRTC 1PFMA 5E1FA 3C1FA 1PRTD 3H09A 3FVQA 3SDZA 1GUSA 3PMFA 5T1GA 3E5SA 2F0LA 1CI3M 5C0XI 5J22A 4IUTA 1WD1A 3JAME 4G57A 3M4YA 5EJWA 2JA8B 4JK1C 1PTOB 3LNNA 3BVGA 1H9JA 3S1NB 4R9WA 5ISRA 3NTHA 4DXGA 1R9TB 1F9SA 4K2KA 1SEBD 4P2CB 3VR3A 1EU3A 4TQUS 3S15B 1STNA 3GV3A 2WV6D 4X3KA 1PZKD 4WRDA 2KECA 1KNEA 4CJ1B 1T5EA 5AFWA 4ABNA 1GUOA 1OO9B 4Q0FA 1J9OA 3NTIA 2RDHA 3PIP3 2A6HC 2E2JB 3L7ZC 2BE5C 2K5WA 4XQJA 3T53B 2BE5D 4RHRA 2I07B 2R6GA 1PRTB 2DNCA 4PMCA 4KTAA 3S1RB 2EYOA 5IGEA 3IFTA 4G7OC 4IUQA 1EFID 4CKBA 1KTKA 3SXHA 3ND9A 5JVG3 4IQZA 4XIGS 1A2UA 1TY2A 5I2YA 3P75A 1LLRD 2C5CA 2VB3X 5K36H 4FP5D 3NK9A 1B53A 2NB0A 1Y8NB 4ULLA 2KEDA 2Q8TA 1IKLA 1TWGB 2NVXB 5E4XA 3T16A 4L63B 1O7LA 2DY8A 3G6JB 1VDZA 3J7YW 2DY7A 2NN6I 1CK1A 4B9WA 3KBGA 3MXUA 1JWSD 1A6XA 3NTKA 1YNNC 2XRSD 3MVVA 1RHPA 2NZ1D 1YNND 1EQTA 3D3RA 1ZKOA 3HOUB 1ET9A 4Y7NB 3SK5A 1LABA 2B8GA 3H6MA 1STHA 1R4PB 1RF2D 2R3ZA 1DXMA 3A55A 3H3VC 3A7LA 3HG9A 2SEBD 2F0KA 4BBRB 1NCVA 5JEAG 3DMUA 2MP1A 1PXUA 4L6TB 1AZQA 3G7LA 4ILWA 4GZYC 4RKLA 1S5DD 4PQXA 3BDLA 4DN4M 2QKIC 4JBWA 3MWYW 1NR2A 1Y1VB 2F0NA 3GTMB 3CHBD 3DUZA 4RHSA 2ENBA 3Q6SA 4DXFA 2XWBB 1SFOB 3GTQB 2PW5A 1ENFA 4KJOA 4K6DA 2K03A 2A6EC 2M00A 2A6ED 2WACA 5C5MA 3MFYA 5A35A 2B2UA 2ZXRA 3VR6A 5I9OA 2EXZA 4O1NA 3DHQA 3HZXA 3QIAA 5C0XG 2K5QA 2NVTB 1TS3A 2V4DA 1Q3LA 5D3IB 5G3LF 3N6RA 5DM73 2F0TA 3L9AX 1EYCA 2GA4B 2X6GA 3MA2B 4I65A 5C5LA 1M8AA 4A3BB 1HA6A 3BYTB 5T1IA 3TSSA 1NR4A 2JEAI 1STYA 3T56B 2PPBC 4ZYSA 5EBDA 5CV9A 2MUYA 3H91A 1SYCA 1HHVA 1TKWB 4KMUC 5IOCA 4FXKC 3PIO3 1F2MA 3JAML 1EL0A 4BY7B 4RH6A 1S5CD 3PUXA 4NW2A 2EPBA 1TY0A 2KCNA 1PRTF 3MHBA 4QUFA 1ET6A 4V0BA 3RZDB 3GTKB 4C1NI 3M3YB 2L4NA 1EY9A 3W2DA 2D62A 1GJXA 2IPKD 2IX3A 3I3CA 1U9RA 4IALA 2F0SA 2H4OA 2QDBA 1ESFA 4HSPA 2B2TA 2K6AA 3HGBA 1LV9A 4G7ZC 3S9WA 3LX0A 3SHLA 2F0GA 4A3KB 2NYZD 2DNEA 3K57A 3HRZC 4H7BA 3S2DB 2NN6G 1QNKA 2WAQB 1W6KA 2EY6A 2EYPA 2WB1B 1DYQA 5JVH3 4OGQC 3BDOA 3K0YA 2O2LD 1D1KA 2G9DA 3WOEA 4UDUC 1STBA 1G91A 3MXNA 5FO8B 1EYDA 3VYUA 2NTTA 3CRLC 1Q1EA 4F7XA 2EYJA 2RSNA 1D2BA 5M3MB 2EY5A 1F9QA 3BDCA 1HQMC 5IGFA 1Z6HA 4HMIA 2EJFC 4K5VA 1D5XC 4CBVA 5EBCA 1CTMA 2BDNA 4RWSC 1B3AA 4HCSA 1LT3D 1D6EC 2SNSA 4BY1B 1XXGA 3I73A 1HFGA 4XT3B 3ONAB 3I70A 3R3OA 2F0JA 3HP3A 1RKNA 1QILA 1GOZA 3K5MA 5M5YB 3TDQA 2KCCA 2F3VA 5EQ0A 5COYA 3U9OA 3V05A 3PO3B 3BG3A 2XIWA 3J80E 1PMRA 3QO2A 5KIXA 4DAYA 3IKJA 2C9OA 1K83B 3OW7A 3MZ5A 1SJHD 3K59A 1CHQD 1EQVA 4QIWB 2ZT9C 1AZPA 2DN8A 3EQLC 3FPPA 1SBBB 2AWOA 3D4RA 3DM1A 2XNAC 3IAYA 3I4NB 4XYOA 1ENCA 4R8NA 3NSWA 2K32A 4PMBA 3I72A 1EY6A 1DCZA 1TQOA 2B2VA 3K6OA 2CVRA 4HEDA 2R93B 1CM9A 3DEOA 4C1NK 1WTPA 1ICWA 1QOHA 4NMZA 5M3FB 2NBFA 3EVQA 5DNFA 1JOQA 3S1MB 3D6CA 1EY0A 4C3JB 5ELDA 1QWYA 5EPLA 1X3PA 2HDLA 2RA4A 4OO1H 1DOMA 2HCCA 2ICEC 2K28A 1SDFA 5I4DA 1Y1WB 4S3SA 1FYCA 1STGA 1HUNA 2YU9B 1ILQA 3V2TA 3VR5A 3BS1A 1F9RA 4K5WA 1LTTD 4FF2A 4KY7A 1TIID 3BYYB 3KLRA 1LTAD 3QG1A 1U4PA 1SE2A 1CQFA 3EJIA 5I9PA 5C4XB 1F9PA 2D2CC 1ML0D 5K36G 1IW7C 1MI2A 2KOLA 1IW7D 4FF1A 1II3A 3C1EA 4PV1C 1H9SA 1S5ED 5CYUA 4U673 4A3MB 2LKVA 4ME5A 4OL7A 1F2LA 4KN7C 5KNDA 4A93B 1VF7A 4ODGA 2KA7A 5JPMC 1ONLA 3D4WA 3MAQA 4DF7A 3GTJB 1RTOA 2K7VA 4DA2A 2R7ZB 1JWUD 5A2QE 2B2UC 4IN3A 1CHPD 3QOLA 4DAVA 1B50A 2JA7B 3GO5A 2BA0A 3DXJC 3I4MB 2PZTA 4KK7A 4TSSA 1L0YB 3K5LA 2IX1A 4N9TA 2D5DA 2A73B 2QILA 1F2YA 3Q0AA 2OEOA 3FRPB 4C3JG 3ZYYX 2RSOA 3CRKC 2VB2X 1OXVA 2K04A 1I4QA 3CU7A 5KGUA 4HTHA 1I50B 3PO2B 2IX0A 1I6HB 2E2DC 3IFDA 2NTSA 1JOOA 3EFXD 3HOZB 1V1PB 1B9MA 3C46A 4M8AA 2F1MA 5LL6S 4RFBA 2RDGA 3QJYA 3VR2A 3OMGA 3HEJA 4XQQA 2D9UA 2NVYB 5IGDA 3OWEB 1A2TA 2B2WA 4PNYA 1H9RA 1DONA 2F0DA 1PLFA 2K01A 4N9PA 2F0UA 1LT4D 3CKIB 5J39A 4IURA 5DAUA 1VMPA 4LAAA 1U4MA 1RTNA 1SXTA 3OPOA 1EOTA 4ID6A 2O5IC 1E2WA 3R93A 2IL8A 2IT1A 1I4RA 4K5XA 2WKDA 2B8FA 1EY5A 1IYUA 5FKAC 5JAVA 4X3SA 2F4IA 3MC0B 4KHZA 3SK6A 4NKLA 2F0VA 2PO4A 1MSHA 5EKIA 4EQOA 3Q24A 2G9HD 1XTCD 2KHSA 1CZWA 1BO0A 5CV6A 3J80L 4H13C 1HRJA 1BCPF 1KABA 5ELCA 1CA5A 3WOFA 1KDCA 4OO1I 3NXWA 1G291 4A3IB 2WIIB 4QF4A 3LWUA 3HOXB 3S17B 2SNMA 1JE4A 2EE1A 2LFNA 5EPJA 5F2DA 1GXDC 1ILPA 5I6YA 4RGTA 3GV6A 2PZWA 4OHJA 3I91A 1SAPA 3W3AA 5J1ZA 5LHY1 2PMZB 1W6JA 4IUVA 1BR9A 3TN2A 1FNVA 2KUMA 4Z9CB 3NHHA 4MIUA 1SYDA 4CHTB 3S16B 5FO7B 1I4GA 5IT9E 4IFDJ 4ZAIA 3E6ZX 3GTGB 2X6LA 3T13A 1Z7TA 3TP8A 1PTOH 1UAPA 2EJMA 4LMQD 4NDXA 5C3EB 5FOBB 4RCOA 1NUCA 2KEEA 3J7AV 2LMCB 2EY1A 4Q5VA 5ELFA 5KRUA 1EEFD 5ELBA 5C0XJ 2HQEA 1G2SA 3SVMA 2B39A 1RCVD 3A54A 1V43A 1G8ZD 1KDBA 1HXYD 3KF8A 3OSOA 3R8BA 2WINB 3CQZB 2CW0C 2EY2A 2XSCA 2CW0D 1BF4A 1RDPD 4K8JA 2BA1A 1TS2A 2B2VC 5FLXL 1CQVA 1ZXTA 1IL8A 4RGMA 1Q1BA 1EIGA 4DK0A 4DAPA 2ZXPA 4WORA 3ND8A 5K5PA 4KV6A 4H0LC 1AEXA 1I4XA 1JICA 5DEHA 3J7AF 1LO5D 3L3OC 3DWPA 2PW7A 1WTXA 4IFDH 4RAUC 5A2QL 4HR7B 2IJ0A 1AFPA 2VNUD 2L1BA 5CBAE 2QCPX 1I4HA 1LACA 2E75C 1VF5C 4X3TA 3K58A 1BXTA 1D5ZC 1XWEA 4HCEA 1EY4A 3R2TA 2OXPA 1EU4A 3VA5A 3IL8A 1JB3A 2TSSA 4LK1C 4HN7A 1F2ZA 4C3IB 2WP8J 2JA6B 2XN9C 2FINB 1DJRD 2H1EA 1EWHA 5HGTA 4K2LA 1VCIA 1H9MA 1R4QB 2CQAA 3GTLB 2Y0SB 5IIFA 3DEPA 3NQTA 5IGGA 1G6ZA 1EZ6A 3VR4A 3S1QB 1MSGA 1RJTA 1SYEA 5JJZA 5EPKA 3A56A 3MEHA 1PZJD 1SNMA 3KLSX 3NE5B 3DWAA 1BCPC 1WTOA 3KBXA 5M9OA 4DFAA 2ICIA 1BCPD 4OO1G 1WCMB 5M5XB 2MGSA 2F03A 4QMGA 1GUNA 4B08A 1GUGA 2MPMA 3MXGA 3TP5A 4KKTA 3N52A 1JC7A 5CV5A 2NVQB 5IGBA 1QE6A 4FO2A 1KLGD 1QCBD 2F0HA 1GHKA 3EA6A 3PUVA 4E6IA 2RBMA 1A3VA 3TP7A 3K5OA 2K33A 3OMCA 1KAAA 2XWJB 1LT6D 3OIQA 3OOCA 3EROA 2EYFA 2MHVA 2BOSA 3WDNA 4EGVA 3GTOB 1BBXC 3GTPB 1TS5A 4H44C 4QB4A 4XDXA 1MD2D 2EDGA 4XYQA 1E2VA 5C3WA 1QJOA 4FF4A 4FNFA 1Z47A 1O80A 3NP8A 4QUCA 2PCFB 2VXWA 2F0QA 2OF1A 2AQ3B 2Q8IB 3RD4A 1LTSD 1Q90A 1K8MA 2J7ZA 2E2HB 1STAA 2BCOA 1O7YA 4LJZC 4U68A 4ZUJA 4C3IG 3M4OB 1AW7A 1A3UA 2NUCA 3TZUA 1BCPB 2L0CA 4M1UB 5CMDA 1PTOC 4TRDA 1T5XD 1PTOD 2KQ3A 2BDOA 4IUNA 1YNJD 1X32A 2XRQD 2JEBI 5CV7A 2Z1CA 5D14A 2JXMB 1PFNA 1FGBD 4J6HA 5IODA 4FYDA 3Q22A 2FFKB 3H0GB 5C6AA 3K7AB 4TKOB 4ZKCB 1QG7A 2ID0A 1O7ZA 3TZDA 5I2XA 1WTRA 3SR1A 1GUTA 2EOTA 5IT9L 3I4LA 2AUKA 1RODA 3D8GA 1AP0A 1SSOA 2A68C 4IFDI 1EZ8A 2JP1A 2A68D 3PV0A 2LY7A 1PZID 4KD4A 3UI2A 5FLXE 1WTVA 4CKEA 4HMJA 5C44B 2RDFA 1EEID 2B63B 2Z8LA 4CKCA 2LS01 3VYTA 2FMCA 3J81E 1C48A 3S14B 3OWFA 2B2YA 4OIKA 4F87A 2YYZA 4IZ8A 1TWCB 2M9VA 1SE4A 5ELEA 4RCNA 2MJ8A 1SNPA 3V96A 1ZYRC 4KD3A 4ZUIA 1FR3A 5M5WB 1ZYRD 2PYKA 4CGYB 1HPCA 1XYIA 1A15A 1HCZA 2Z4IA 4FF3A 3QOJA 2RVLA 4OIJA 1HFNA 1TT2A 1EWCA 4HSVA 1IHZA 5BN3A 3NWTA 4MN3A 2A6HD 1B2TA 3MTSA 5C4JB 1EY7A 2EYHA 1U4LA 1FD7D 3QWNA 2L5TA 1TR5A 2KJXA 3LWEA 5E3FA 4WFN3 5EKKA 4EQNA 1O78A 2E74C 4QCLA 2N88A 3HS0C 5CC4A 3D31A 3HOWB 1CA6A 1NAPA 1KDAA 1UEAB 3R2IA 1C4QA 1Y69U 1PFBA 4FXGC 2CHBD 1ENAA 3HOYB 1D1IA 1V1OA 5C3XA 1B1ZA 4IUPA 1BQQT 3SEBA 4G4KA 3NPPA 3TMEA 3A8JE 1PDQA 1HTLD 1JWMD 1EYAA 3SK4A 4BA1I 1Y8OB 3AB9A 1A3TA 3VYRA 2FJ2A 4C3HB 3KUPA 4XQNA 4I7ZC 1SNQA 4RGOS 1I6VC 4R8IA 3AMUA 2B2TC 2JSOA 4KY5A 5CV4A 4A3JB 2EYLA 1OXTA 1LTRD 1E2ZA 1Q12A 2F0EA 1S5BD 2QEJC 1UNSA 4KI0A 3P7JA 1SYGA 4NP5A 5NUCA 3A7AB 4K6LA 2E76C 3SK8A 4F8MA 4IUUA 1Q8IA 2L55A 3NWSA 2KVMA 1STEA 4DGZA 3MFGA 1B44D 2EVBA 5JEAJ 3PUZA 4DK1A 5FO9B 3FDTA 2PZUA 3BVZA 1WTQA 2R61A 3HKZB 3M7GA 4DU9A 1TU2B 1V1PA 4RKBA 5KNCA 2J4XA 1FNWA 2F0IA 3TBIB 3K5NA 1C8CA 5JOBA 3D4DA 3QB3A 2AQ1B 5BN5A 1CT1D 2M2LA 1CFMA 2Z4HA 2FHTA 3A8KE 1ESRA 1IYVA 4J8QA 4IFDG 2HUGA 1G2TA 5CBEE 5C4ZA 3FEWX 5HURA 1IKMA 3URYA 1MBYA 1OXSC 4KN4C 1DD2A 1TS4A 1UUPA 3GQBA 5KYLA 1HTPA 4DNTB 3TP6A 2IWHA 1JOKA 2JYOA 1PTOF 4C3HG 3NBHA 2ZXOA 3T4AC 3FMCA 3VA7A 1LTID 1SYBA 3P20A 2F0MA 2JE6I 2E2IB 1CZGA 5C4HA 5JEAH 3RMHA 2J0TD 4KKSA 5FK9C 4KHVA 3ITPA 4V190 2AUJD 1BUVT 2EJGC 4B9XA 3KK7A 1GUWA 1KLUD 5CV8A 2OT2A 1DZ1A 1E0BA 4UAIA 2K5DA 1WVLA 1SNCA 1S5FD 4RA8A 3FPUB 1F77A 1JORA 1BOSA 3H94A 1U4RA 1M4VA 3J81L 1SE3A 1EY8A 2XVSA 3PUYA 2A5HA 5IGCA 2A69C 4BBSB 1WD0A 3ERQA 2A69D 1ZEQX 1PYWD 1NSNS 1LT5D 2PQEA 3A8IE 2O4XA 1VMCA 2F0FA 4A3DB 2I46A 1RD9D 2EZVA 2F3WA 4ZRZA 1K8OA 1SJED 4A3EB 4FXDA 2AWNA 5D65A 1BDOA 1XX8A 2EYMA 4PMWA 5C0XH 3SE0A 4X3UA 1DM0B 5D3DA 4A3GB 4HAEA 2QF7A 1OXXK 2N55A 5EGTA 1TVXA 3OIPA 1I3QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9V A;  5I2X A;  2I46 A;  5I2Y A; 
#chains in the Genus database with same CATH topology
 4XXE A;  4EVO A;  1HQR D;  4XTC S;  3HOU H;  2JA5 B;  2K1B A;  1B9N A;  4Y7N H;  1AH9 A;  2EQS A;  1VQ7 A;  1RL2 A;  4C56 C;  3CCJ A;  3CC4 A;  1H95 A;  4AYB B;  4JI8 L;  1DOK A;  1LUZ A;  3HOV B;  3G4S A;  3TQY A;  5E4W C;  3G71 A;  1L1O B;  3FKI B;  1LTB D;  3KLS A;  2B2Y C;  4BS9 A;  5HY6 A;  1X3Q A;  2VUM B;  5KEE A;  2WKC A;  4JPB W;  3E9H A;  2R92 B;  1WTW A;  5CGK A;  1JCK B;  3I90 A;  3B6Y A;  4DR4 Q;  5COR A;  4C2M B;  4EQP A;  4FVM A;  1TWF B;  2L12 A;  3J81 i;  5LMU L;  5GAE C;  1FNU A;  3RZO B;  5KYI A;  3NUC A;  4ZQ3 A;  4ZK9 B;  2BH8 A;  3E0J A;  4CJ2 C;  4JYA L;  3GD7 A;  5CR3 A;  1PV4 A;  2O5J C;  1Y8P B;  3I8Z A;  1SMY C;  4LF8 Q;  4CJ0 B;  5KNB A;  3GTM H;  1Y1V H;  5IT9 c;  4LF4 L;  3KDF B;  4RGN A;  1SMY D;  3MXP A;  3O13 A;  1XNR L;  5TSS A;  2HDM A;  2F0O A;  4K8I A;  3Q8D A;  1SFO H;  1I4P A;  3GTQ H;  4KKU A;  2OCE A;  1DOL A;  3RUZ A;  4BBS G;  1V8Q A;  5JPN C;  2B3G A;  1UEB A;  1MIU A;  3PUW A;  4HJ7 A;  2PNR C;  1HUM A;  3NQI A;  1JR0 D;  2UXB Q;  1B4O A;  4A3D G;  3U9S A;  2HCI A;  4J1M A;  1SND A;  2F0P A;  2X69 A;  5GAH C;  1D5M C;  4UP7 A;  3M7N A;  1PH6 A;  3M85 A;  4XT1 B;  1JQY D;  4GN5 A;  4KY6 A;  1BNZ A;  4A3E G;  2K05 A;  2MO1 A;  1QUQ B;  4DNR B;  1H9S B;  2CWP A;  4G7H C;  1EIH A;  1LTG D;  2SOB A;  2NN6 H;  1SNO A;  4IPG A;  1GHJ A;  1YVC A;  3C3L A;  2NVT H;  2UXC Q;  3S2H B;  2Q8R E;  2UUA L;  1N9W A;  4MHE A;  3OYY A;  3X3M A;  1JMC A;  1TWA B;  4K14 A;  1S4Z A;  3H3V H;  4A3F B;  3E0E A;  3D6W A;  1SYF A;  4A3G G;  2NWG A;  2B2W C;  1MGS A;  4WJW A;  3F2U A;  5G3L D;  3UDG A;  3A0J A;  1HZB A;  4A3B H;  3C2P A;  3VYS A;  1YNJ C;  1T9H A;  4LFB Q;  3X3N A;  1TWH B;  2IW3 A;  5C3E H;  4LFA L;  4DV1 Q;  5DM6 3;  2N8N A;  3T51 B;  5BN4 A;  1IBM L;  2JA5 G;  2A74 C;  1A8V A;  3BZD B;  3GP7 A;  4L8J A;  1VS0 A;  4L5Q A;  2RQX A;  2Z6K C;  4ZKB B;  4NXN Q;  2CH4 W;  4F88 A;  1J8I A;  3AU7 A;  4BA2 I;  4AYB G;  1KNA A;  4DR1 Q;  3PQI A;  3HOV G;  5EKL A;  1OXU A;  2TMP A;  3Q23 A;  4P74 A;  1YJN A;  3FKI G;  1A0I A;  2KCM A;  3OTO L;  2VUM G;  1BBU A;  2L9H A;  1QNU A;  2RKS A;  3OHX C;  1M90 C;  4KJN A;  3RLF A;  1H9K A;  5I6W A;  1HA5 A;  3NBI A;  1EUJ A;  2F0W A;  4O42 A;  5LL6 X;  1AN8 A;  4ZLT F;  4YIJ A;  2GVA A;  3BVM A;  4BWG B;  1QB5 D;  4BY7 H;  2SDF A;  2FMM A;  1L0X B;  1NBW A;  3DWQ A;  3P1H A;  1ICF B;  2AQ2 B;  1IYJ B;  2L11 A;  1PRT C;  1PFM A;  5E1F A;  3RZD H;  3GTK H;  3C1F A;  1PRT D;  3H09 A;  3M3Y H;  3FVQ A;  3SDZ A;  1GUS A;  3PMF A;  2K5H A;  4JI1 Q;  3RN2 A;  5T1G A;  3E5S A;  1IBK Q;  2F0L A;  1YI2 A;  1CI3 M;  5C0X I;  5J22 A;  2HHH L;  1IBL L;  4IUT A;  1WD1 A;  3JAM E;  4G57 A;  3DM3 A;  2Q2H A;  3I7F A;  2PI2 A;  3M4Y A;  4BXX G;  5EJW A;  2JA8 B;  4JK1 C;  1PTO B;  4JI2 Q;  2VQE L;  3LNN A;  3BVG A;  1H9J A;  3S1N B;  4R9W A;  1L2F A;  1KRT A;  5FLM G;  4A3K H;  1EYG A;  5ISR A;  3NTH A;  4DXG A;  1R9T B;  1F9S A;  2WFW A;  2KEN A;  4X65 Q;  4K2K A;  1SEB D;  2RF4 A;  3S2D H;  4P2C B;  3VR3 A;  1EU3 A;  4LF4 Q;  4TQU S;  1E24 A;  3S15 B;  4AQY L;  1E7Z A;  1STN A;  2QGQ A;  1QZH A;  3GV3 A;  2WV6 D;  4A3F G;  2E5L L;  4X3K A;  4GOP B;  1PZK D;  4GKJ L;  4WRD A;  2KEC A;  1Q82 C;  1KNE A;  4CJ1 B;  4TVA B;  1T5E A;  2R7F A;  1I94 L;  5AFW A;  4ABN A;  2ES2 A;  4K0K L;  2RCN A;  1GUO A;  1OO9 B;  4Q0F A;  2EXD A;  5M3M H;  4DV4 Q;  1J9O A;  1X9N A;  3NTI A;  4P75 A;  2RDH A;  2VY3 A;  3PIP 3;  2A6H C;  2E2J B;  5IP9 G;  3L7Z C;  2BE5 C;  2K5W A;  4HJA A;  4XQJ A;  4B3M L;  3T53 B;  2BE5 D;  1LTL A;  1PH9 A;  1NE3 A;  4RHR A;  2I07 B;  2R6G A;  1PRT B;  2DNC A;  4PMC A;  4IJL A;  2KBN A;  1MKH A;  4KTA A;  1XMO Q;  3S1R B;  4DR6 Q;  2EYO A;  5IGE A;  2YTX A;  3IFT A;  1S3O A;  4IUQ A;  4DV6 L;  1EFI D;  4G7O C;  4BY1 H;  4CKB A;  2F4V Q;  1KTK A;  4DV7 Q;  3SXH A;  3ND9 A;  5JVG 3;  4NXM L;  3M4P A;  4IQZ A;  5IYB H;  4XIG S;  1A2U A;  1TY2 A;  5I2Y A;  5IYC H;  3P75 A;  1LLR D;  5M5Y H;  3G48 A;  2C5C A;  2VB3 X;  5K36 H;  4FP5 D;  1VQD A;  3NK9 A;  1B53 A;  2NB0 A;  1Y8N B;  2JJQ A;  3BU2 A;  4ULL A;  3PO3 H;  2KED A;  4DV2 Q;  2A19 A;  2Q8T A;  1IKL A;  1TWG B;  2NVX B;  4OXP A;  5E4X A;  4L63 B;  3T16 A;  1SLJ A;  3CAM A;  1O7L A;  2DY8 A;  3G6J B;  1K83 H;  3M4Q A;  1VDZ A;  3J7Y W;  2DY7 A;  2NN6 I;  1CK1 A;  1WFQ A;  4DR2 L;  1CSQ A;  4OWW B;  4B9W A;  3KBG A;  3MXU A;  1JWS D;  1A6X A;  2VW9 A;  3GTO H;  3H3V I;  3ER0 A;  2JA8 G;  5AJ3 L;  1BBW A;  3NTK A;  4IOA A;  1YNN C;  2XRS D;  3MVV A;  3UE1 A;  1KL9 A;  3QR8 A;  1RHP A;  2NZ1 D;  1YNN D;  1EQT A;  3D3R A;  5LMN L;  3I4N H;  1ZKO A;  3HOU B;  1ET9 A;  2RCF A;  4Y7N B;  3SK5 A;  3AFQ A;  1LAB A;  2B8G A;  3H6M A;  1STH A;  1R4P B;  1RF2 D;  2R3Z A;  1DXM A;  3A55 A;  3H3V C;  3A7L A;  3HG9 A;  1X55 A;  2ATW A;  2SEB D;  2F0K A;  4BBR B;  1NCV A;  5JEA G;  3DMU A;  1Q86 C;  4WJ4 A;  4AIM A;  2MP1 A;  4KHP L;  2P5Z X;  1PXU A;  5M3F H;  2UUC L;  4L6T B;  4YY3 L;  1AZQ A;  4B3T Q;  3G7L A;  4GNX A;  4ILW A;  1SE8 A;  3KF8 B;  4GZY C;  4RKL A;  5FLX c;  3S1M H;  1HNZ L;  1FL0 A;  4C3J H;  3UE0 A;  1CKN A;  3TEH B;  2ZJR A;  1S5D D;  4PQX A;  3ULL A;  3BDL A;  1JJG A;  4DN4 M;  2UXD Q;  4DV0 Q;  1FVI A;  2QKI C;  4JBW A;  3MWY W;  1NR2 A;  1Y1V B;  2F0N A;  3J81 c;  3CHB D;  3GTM B;  2CWA A;  1HZA A;  2VL6 A;  3DUZ A;  4RHS A;  1PH3 A;  1AE2 A;  4P71 A;  2ENB A;  3Q6S A;  4YWK A;  4DXF A;  2OQK A;  2XWB B;  1SFO B;  1Y1W H;  3GTQ B;  2PW5 A;  1UE7 A;  1ENF A;  2YU9 H;  1LYL A;  4KJO A;  4K6D A;  2K03 A;  1G51 A;  2A6E C;  1YHA A;  3RLO A;  1VQO A;  2M00 A;  1VQ9 A;  2B29 A;  2A6E D;  2WAC A;  5C5M A;  3AYH B;  3T1Y Q;  1SR3 A;  3W1B A;  1MHW C;  1I94 Q;  3MFY A;  2JQO A;  5A35 A;  4JI4 L;  4K0K Q;  2B2U A;  2I5L X;  2ZXR A;  3VR6 A;  1BVS A;  1QVG A;  5C4X H;  3HOZ G;  5I9O A;  1SMX A;  2EXZ A;  4DR4 L;  2LXJ A;  1N36 L;  1VQ4 A;  4O1N A;  5JJL A;  3DHQ A;  1K73 C;  3HZX A;  3QIA A;  5C0X G;  2K5Q A;  2NVT B;  1TS3 A;  2V4D A;  4QL5 A;  1Q3L A;  5D3I B;  5FJ8 G;  1ASZ A;  4IPC A;  1KD1 C;  5G3L F;  3CCU A;  1D7Q A;  3N6R A;  5DM7 3;  4A3M H;  2Q2I A;  2F0T A;  5E7N A;  3ULP A;  3L9A X;  1EYC A;  2GA4 B;  2X6G A;  4UP8 A;  2UUB Q;  4A93 H;  4EQ5 A;  1A63 A;  3MA2 B;  4I65 A;  5C5L A;  1M8A A;  1PH7 A;  4A3B B;  1HA6 A;  3BYT B;  5T1I A;  1MJC A;  3TSS A;  4X64 Q;  1NR4 A;  2JEA I;  3AQQ A;  3E9I A;  3UDF A;  3GTJ H;  1STY A;  4JOI C;  1FJG Q;  2R7Z H;  1SRU A;  3T56 B;  2PPB C;  3HOU G;  4ZYS A;  5EBD A;  4POF A;  2DUD A;  5CV9 A;  2MUY A;  1XPU A;  4JG2 A;  2UXB L;  3H91 A;  1SYC A;  1HHV A;  1TKW B;  2JA7 H;  2NZO A;  4KMU C;  1VQ5 A;  4BBR G;  5IOC A;  3I4M H;  1Z9F A;  4FXK C;  2UXC L;  3PIO 3;  1E1O A;  1F2M A;  3JAM L;  1EL0 A;  4JC0 A;  1VQ6 A;  5AJ3 Q;  4BY7 B;  4RH6 A;  1S5C D;  3PUX A;  4NW2 A;  2EPB A;  1TY0 A;  2KCN A;  1PRT F;  3KF6 A;  3F8T A;  3MHB A;  2VQF Q;  2D0O A;  4QUF A;  3EIV A;  4IPH A;  1ET6 A;  1Y1V G;  3HKS A;  4V0B A;  1I50 H;  3RZD B;  3GTK B;  3PO2 H;  4C1N I;  5GRO A;  3M3Y B;  1E1T A;  4LFB L;  2L4N A;  1EY9 A;  1I6H H;  3W2D A;  2D62 A;  1GJX A;  2ZJQ A;  3KJP A;  2IPK D;  2IX3 A;  4NB3 A;  3I3C A;  1U9R A;  4IAL A;  2WAQ E;  2F0S A;  4NXN L;  2UUC Q;  2H4O A;  2WB1 E;  3H15 A;  1YZ6 A;  2QDB A;  1ESF A;  1PYS B;  2XTI A;  4HSP A;  4DR1 L;  2B2T A;  2K6A A;  3HGB A;  1LV9 A;  4G7Z C;  2LXK A;  2NVY H;  2N3S A;  3S9W A;  3LX0 A;  3SHL A;  2F0G A;  1HNZ Q;  2I5H A;  2Z0S A;  4GLA C;  4A3K B;  1VQF A;  2NYZ D;  1YIJ A;  2DNE A;  3K57 A;  3HRZ C;  4H7B A;  3S2D B;  2NN6 G;  1QNK A;  2WAQ B;  1W6K A;  2EY6 A;  2V1C C;  4PG3 A;  2EYP A;  3OW2 A;  2WB1 B;  1DYQ A;  5JVH 3;  4OGQ C;  3BDO A;  3K0Y A;  2O2L D;  1JB7 A;  1D1K A;  2G9D A;  3WOE A;  4UDU C;  4C3H H;  1STB A;  1G91 A;  1U5K A;  3MXN A;  5FO8 B;  1EYD A;  3VYU A;  4A3B G;  2NTT A;  3CRL C;  4JI1 L;  1Q1E A;  4F7X A;  2EYJ A;  2RSN A;  1D2B A;  1PH1 A;  1IBK L;  5M3M B;  2EY5 A;  1W2B A;  3U50 C;  1F9Q A;  3BDC A;  4JI4 Q;  5EAY A;  1HQM C;  5IGF A;  1B3Q A;  4A3J H;  1Z6H A;  4HMI A;  1N36 Q;  2EJF C;  1VQK A;  4K5V A;  1D5X C;  4CBV A;  1K0S A;  5EBC A;  1CTM A;  4JI2 L;  2BDN A;  3JAM i;  4RWS C;  1B3A A;  1HNW Q;  4HCS A;  1LT3 D;  1D6E C;  1P16 A;  3UDI A;  2AMC B;  2SNS A;  4X65 L;  4BY1 B;  1XXG A;  3I73 A;  1VQG A;  4A3I H;  1HFG A;  4XT3 B;  3ONA B;  3I70 A;  3HOX H;  3S17 H;  3R3O A;  5IWA L;  2F0J A;  1VQA A;  1RKN A;  3HP3 A;  2HT1 A;  1QIL A;  1GOZ A;  3K5M A;  2NZH A;  5M5Y B;  1HZC A;  4QIW E;  3PSI A;  3STB C;  3TDQ A;  4BY7 G;  1HZ9 A;  2KCC A;  3STB D;  2F3V A;  5EQ0 A;  5COY A;  1HH2 P;  3U9O A;  3V05 A;  3U4Z A;  1K3R A;  3PO3 B;  3PF4 A;  2HD3 A;  3BG3 A;  2XIW A;  3J80 E;  1PMR A;  3QO2 A;  5KIX A;  4DAY A;  4DV4 L;  3IKJ A;  2C9O A;  1K83 B;  3OW7 A;  3MZ5 A;  1SJH D;  3K59 A;  1CHQ D;  2A1A A;  1EQV A;  4QIW B;  2ZT9 C;  1B7Y B;  2DN8 A;  1AZP A;  3EQL C;  1EIF A;  3FPP A;  1SBB B;  4JV5 Q;  2K4K A;  2AWO A;  3T1H Q;  3D4R A;  3DM1 A;  2XNA C;  3IAY A;  1XMO L;  4ME3 A;  4DR6 L;  3NEM A;  2KCT A;  2L15 A;  4DR3 Q;  3I4N B;  3S16 H;  4XYO A;  4A3K G;  1ENC A;  4R8N A;  4DV5 L;  2F4V L;  3NSW A;  4DV7 L;  2K32 A;  4PMB A;  3I72 A;  1EY6 A;  5IE8 A;  1DCZ A;  1TQO A;  2B2V A;  2WAQ G;  3K80 C;  3F2D A;  3GTG H;  3K6O A;  3ZJY C;  2CVR A;  4HED A;  2WB1 G;  2R93 B;  5ELN A;  1CM9 A;  4LUV A;  2MFI A;  4QY7 A;  3DEO A;  4C1N K;  2HIX A;  1WTP A;  1ICW A;  1QOH A;  4NMZ A;  5M3F B;  2NBF A;  3EVQ A;  1L1O A;  3LGJ A;  2C35 B;  4DV2 L;  3WWV A;  5DNF A;  4FDB A;  1VQM A;  2G5D A;  3F1Z A;  1JOQ A;  1OTC A;  3S1M B;  3D6C A;  1EY0 A;  4LF6 Q;  4C3J B;  5M3M G;  5ELD A;  3E3X A;  2JA9 A;  1QWY A;  3CQZ H;  5EPL A;  1X3P A;  2HDL A;  2RA4 A;  4OO1 H;  1DOM A;  2HCC A;  4DNI A;  1PH8 A;  2ICE C;  2YTV A;  2K28 A;  1G6P A;  1SDF A;  5I4D A;  2PQA B;  1Y1W B;  3A5Z B;  4S3S A;  1FYC A;  4L5R C;  1STG A;  2Q2U A;  1HUN A;  2YU9 B;  1ILQ A;  3V2T A;  3VR5 A;  1FGU A;  3BS1 A;  4BY1 G;  2VZA A;  1F9R A;  4LUZ A;  4K5W A;  1HJP A;  1LTT D;  4FF2 A;  4KY7 A;  2CCZ A;  1BKB A;  1TII D;  4B3S Q;  1XJV A;  3BYY B;  3KLR A;  1LTA D;  5IYB G;  3QG1 A;  1U4P A;  1SE2 A;  1CKO A;  5IYC G;  4GNX C;  1CQF A;  3EJI A;  5I9P A;  5C4X B;  4IOC A;  1F9P A;  1RIP A;  1ML0 D;  2D2C C;  3K7U C;  5K36 G;  1IW7 C;  4KLK A;  1MI2 A;  2KOL A;  1IW7 D;  4B3T L;  4FF1 A;  4DUZ Q;  3PO3 G;  1II3 A;  3C1E A;  4PV1 C;  4ZCK A;  4OON A;  1QUQ A;  1H9S A;  1QZG A;  1S5E D;  5CYU A;  1PHJ A;  3CCR A;  1NY4 A;  4U67 3;  4A3M B;  2LKV A;  1NMF A;  4ME5 A;  4OL7 A;  1F2L A;  2UXD L;  4KN7 C;  4DV0 L;  5KND A;  4A93 B;  1VF7 A;  3BZC A;  4GKK L;  4ODG A;  2KA7 A;  5JPM C;  1ONL A;  4QGU A;  4APV A;  3RN5 A;  5IWA Q;  3MEF A;  3D4W A;  2H5X A;  3MAQ A;  4DF7 A;  3GTJ B;  1RTO A;  2K7V A;  3I4N G;  4GLV B;  4DA2 A;  2R7Z B;  1JWU D;  4C3I H;  5A2Q E;  2B2U C;  4IN3 A;  1O7I A;  2K14 A;  1CHP D;  2JA6 H;  3QOL A;  4DAV A;  3T1Y L;  1I3Q H;  2R93 G;  1B50 A;  4H02 A;  2JA7 B;  3GO5 A;  4YWL A;  2BA0 A;  3DXJ C;  4OWX B;  3GTL H;  1C7Y A;  3I4M B;  2PZT A;  5M3F G;  4KK7 A;  4TSS A;  1L0Y B;  5BR8 L;  3K5L A;  2IX1 A;  4N9T A;  2D5D A;  2A73 B;  3S1Q H;  2QIL A;  1F2Y A;  1GVP A;  3Q0A A;  1EQR A;  2OEO A;  3FRP B;  1I5F A;  4OWT B;  4C3J G;  3ZYY X;  2RSO A;  4CDC C;  3CRK C;  2VB2 X;  4GNX B;  2UUB L;  1OXV A;  1KAW A;  1B8A A;  2R92 H;  3BZK A;  2K04 A;  4DV5 Q;  1I4Q A;  3CU7 A;  5KGU A;  4HTH A;  2YV5 A;  3BJU A;  1I50 B;  1WCM H;  1N33 L;  3PO2 B;  1CKN B;  5M5X H;  4X64 L;  1Q46 A;  2IX0 A;  5IP7 H;  1I6H B;  2OTJ A;  4QQB X;  2E2D C;  3IFD A;  1HR0 W;  2NTS A;  1FJG L;  1Y1W G;  1JOO A;  3EFX D;  3HOZ B;  1V1P B;  1B9M A;  3C46 A;  2R7D A;  1K28 A;  4M8A A;  2F1M A;  2NVQ H;  5LL6 S;  4RFB A;  2MNA A;  5DLQ E;  2RDG A;  1K9M C;  1K3B C;  3QJY A;  3VR2 A;  3OMG A;  3HEJ A;  4XQQ A;  2D9U A;  2NVY B;  5IGD A;  3OWE B;  1A2T A;  2MQH A;  2B2W A;  4PNY A;  5C4X G;  1H9R A;  1DON A;  1X6O A;  2F0D A;  4N8X 1;  5LMN W;  1PLF A;  2K01 A;  4N9P A;  4JI7 Q;  3A74 A;  2F0U A;  3GTP H;  1LT4 D;  3CKI B;  5J39 A;  4IUR A;  5DAU A;  3EBE A;  1WI5 A;  1VMP A;  4LAA A;  1U4M A;  5IYD H;  3IRB A;  1RTN A;  1SXT A;  4A3M G;  3OPO A;  1EOT A;  2VQF L;  4ID6 A;  3KLW A;  4A93 G;  2O5I C;  2GN5 A;  1E2W A;  3R93 A;  1D8L A;  2IL8 A;  4IJH A;  4O0A A;  2IT1 A;  1I4R A;  4K5X A;  2WKD A;  4GOP A;  2B8F A;  1EY5 A;  4X66 Q;  1IYU A;  3NBH B;  2E2H H;  5FKA C;  2D0P A;  5JAV A;  4X3S A;  2R7Z G;  2F4I A;  3MC0 B;  3RNU A;  4KHZ A;  3SK6 A;  4NKL A;  2PNH A;  2F0V A;  3I55 A;  3M4O H;  2PO4 A;  1KC8 C;  1MSH A;  1QVF A;  3K0X A;  5EKI A;  4MNO A;  4EQO A;  3Q24 A;  2G9H D;  1XTC D;  2KHS A;  4UY8 C;  1CZW A;  2N78 A;  1BO0 A;  5CV6 A;  3J80 L;  2JA7 G;  4H13 C;  1HRJ A;  1BCP F;  1KAB A;  5ELC A;  1CA5 A;  3WOF A;  1KDC A;  3I4M G;  4OO1 I;  3W1G A;  3NXW A;  1G29 1;  4A3I B;  2WII B;  4DK3 C;  1V1Q A;  4QF4 A;  3LWU A;  2AKW B;  3HOX B;  4GKK Q;  3S17 B;  5J3B A;  2SNM A;  4IPD A;  3JAM c;  1JE4 A;  2EE1 A;  2LFN A;  3H0G H;  3K7A H;  1C0A A;  5HGQ A;  2PMZ E;  5EPJ A;  4JI6 Q;  5F2D A;  3F2C A;  1GXD C;  3KYH C;  1ILP A;  5I6Y A;  4A75 A;  4RGT A;  4N8F A;  3GV6 A;  2CKZ B;  1VQC A;  4CDD C;  2PZW A;  1KIX A;  3PO2 G;  3KF6 B;  4OHJ A;  3I91 A;  4DR7 L;  1DGS A;  1SAP A;  2ALY B;  4GN4 B;  4NPS A;  1X56 A;  3W3A A;  5J1Z A;  5LHY 1;  2PMZ B;  1W6J A;  1JT8 A;  4IUV A;  4OEM B;  1X54 A;  3W5O A;  4R4C A;  5BR8 Q;  1BR9 A;  3TN2 A;  1FNV A;  1HNW L;  2KUM A;  4Z9C B;  1J5E Q;  2YTY A;  5C44 H;  3NHH A;  4MIU A;  1SYD A;  1VQI A;  4CHT B;  2B63 H;  3S16 B;  3CCS A;  5FO7 B;  1I4G A;  5IT9 E;  4IFD J;  4ZAI A;  3S14 H;  3E6Z X;  3GTG B;  2X6L A;  3T13 A;  1S40 A;  1N33 Q;  1Z7T A;  3GDE A;  1CSP A;  3TP8 A;  1PTO H;  1UAP A;  2EJM A;  4LMQ D;  4NDX A;  5C3E B;  5FOB B;  1TWC H;  4RCO A;  3CC7 A;  4QJF A;  1NUC A;  2KEE A;  4MTN A;  3J7A V;  2LMC B;  2EY1 A;  4Q5V A;  5ELF A;  5KRU A;  1EEF D;  5ELB A;  5C0X J;  2HQE A;  1G2S A;  2DJG C;  5M5W H;  3SVM A;  3AEV A;  1VQB A;  5IY0 A;  2B39 A;  1XMQ Q;  1RCV D;  2JN4 A;  3A54 A;  3J80 i;  1V43 A;  3MXN B;  4X62 Q;  1UE6 A;  1G8Z D;  1KDB A;  1HXY D;  3KF8 A;  3OSO A;  4A3J G;  3R8B A;  2WIN B;  3CQZ B;  2CW0 C;  2EY2 A;  1Q7Y C;  4JV5 L;  2EIF A;  2XSC A;  4HIK A;  4ALP A;  3T1H L;  1VQE A;  2CW0 D;  4A3C H;  3M9B A;  2K75 A;  1BF4 A;  1RDP D;  4K8J A;  1NTG A;  2BA1 A;  2OTL A;  4DR3 L;  1TS2 A;  2B2V C;  1PA6 A;  5FLX L;  1CQV A;  1B70 B;  1ZXT A;  5JJI A;  1VQP A;  1IL8 A;  4RGM A;  1Q1B A;  1EIG A;  4DK0 A;  4DAP A;  4A3I G;  4O2D A;  2ZXP A;  4WOR A;  3ND8 A;  5K5P A;  3TRZ A;  3HOX G;  3PIP A;  1EOV A;  4KV6 A;  5C4J H;  2BH2 A;  4H0L C;  1L1O C;  3J7Z C;  4JI0 L;  1AEX A;  1I4X A;  1JIC A;  4JBJ A;  5L37 A;  5DEH A;  3J7A F;  1LO5 D;  3L3O C;  3TS0 A;  3F2B A;  4JI3 Q;  3DWP A;  1N32 L;  2ZM6 Q;  1GM5 A;  2Z6B A;  2PW7 A;  3KJO A;  1WTX A;  4IFD H;  4RAU C;  5A2Q L;  4HR7 B;  2IJ0 A;  1AFP A;  2VNU D;  1KHI A;  1XTD A;  3HOW H;  2L1B A;  2K52 A;  5CBA E;  2QCP X;  3KOJ A;  4LF6 L;  1I4H A;  1LAC A;  3HOY H;  2E75 C;  1VF5 C;  4X3T A;  4DAY B;  3K58 A;  1BXT A;  1D5Z C;  1XWE A;  3CPW A;  4HCE A;  5H1S E;  1EY4 A;  3CXC A;  3R2T A;  1EWI A;  2Y0S E;  2OXP A;  1EU4 A;  3VA5 A;  3IL8 A;  2OQ0 A;  1N34 Q;  1JB3 A;  4HIM A;  2TSS A;  4LK1 C;  4CDE C;  4HN7 A;  2RHS B;  1F2Z A;  2Q2T A;  3SGI A;  4C3I B;  4OEL B;  2WP8 J;  2UU9 Q;  4A4I A;  2JA6 B;  2XN9 C;  2FIN B;  4B3S L;  1DJR D;  2H1E A;  1EWH A;  5HGT A;  4K2L A;  1VCI A;  1H9M A;  1R4Q B;  4GN3 B;  1PH4 A;  5C3E G;  2KHI A;  2CQA A;  4DR7 Q;  3GTL B;  2Y0S B;  5IIF A;  4LF7 Q;  1KRS A;  1K8A C;  3CCL A;  3DEP A;  3NQT A;  4DUZ L;  5IGG A;  1G6Z A;  1EZ6 A;  3VR4 A;  1JJ2 A;  4PZ7 A;  3S1Q B;  1MSG A;  1RJT A;  1EFW A;  1SYE A;  3HFZ B;  5JJZ A;  3A56 A;  3MEH A;  5EPK A;  1PZJ D;  1SNM A;  2K5V A;  3KLS X;  3ULJ A;  4BBR H;  3NE5 B;  3DWA A;  1BCP C;  2JK8 A;  1XPO A;  1WTO A;  3KBX A;  5M9O A;  4IO9 A;  4DFA A;  2ICI A;  1BCP D;  4OO1 G;  1WCM B;  5M5X B;  2MGS A;  2F03 A;  4QMG A;  4HIO A;  4JBM A;  1GUN A;  2FXQ A;  4B08 A;  1GUG A;  4A76 A;  2MPM A;  3CMA A;  3MXG A;  2ASB A;  3TP5 A;  4KKT A;  3N52 A;  1JC7 A;  2F3I A;  5CV5 A;  2NVQ B;  4LFC L;  5IGB A;  1QE6 A;  4FO2 A;  1KLG D;  1QCB D;  2F0H A;  1GHK A;  3EA6 A;  3PUV A;  4DUY Q;  4WJ3 M;  4E6I A;  2PI2 E;  4YHH L;  2RBM A;  1A3V A;  3TP7 A;  4HID A;  3K5O A;  2K33 A;  3OMC A;  2AHO B;  2F52 A;  1JJC B;  1KAA A;  1K8G A;  2XWJ B;  1LT6 D;  2HIV A;  3OIQ A;  1NJI C;  3OOC A;  3ERO A;  1Q8K A;  2EYF A;  2MHV A;  2BOS A;  3WDN A;  4EGV A;  3GTO B;  1BBX C;  3GTP B;  1TS5 A;  4JOI A;  4H44 C;  3I2Z A;  4QB4 A;  4XDX A;  1MD2 D;  2EDG A;  4XYQ A;  1E2V A;  4RMF A;  3RR5 A;  5C3W A;  4X6A H;  4A3L H;  1QJO A;  4FF4 A;  1W3S A;  4FNF A;  4JBK A;  1Z47 A;  1O80 A;  3NP8 A;  4QUC A;  2PCF B;  2VXW A;  4UPA A;  2F0Q A;  2OF1 A;  2AQ3 B;  2Q8I B;  3RD4 A;  1LTS D;  1Q90 A;  4EX5 A;  3S24 A;  1PH2 A;  1K8M A;  4JI0 Q;  2J7Z A;  2E2H B;  1STA A;  2BCO A;  1O7Y A;  4LJZ C;  4U68 A;  4ZUJ A;  4C3I G;  3M4O B;  1AW7 A;  1A3U A;  4LF9 Q;  2NUC A;  3TZU A;  1N32 Q;  2JA6 G;  1BCP B;  2L0C A;  4M1U B;  1M1K C;  1X3G A;  1YIT A;  5CMD A;  1PTO C;  1YNX A;  4TRD A;  1EQQ A;  1XNQ L;  1T5X D;  1PTO D;  2KQ3 A;  2E2I H;  2BDO A;  4IUN A;  1CUK A;  1YNJ D;  1X32 A;  2Y0S G;  2XRQ D;  2JEB I;  3CPF A;  4LW1 A;  1LM0 A;  5CV7 A;  2Z1C A;  4DR5 L;  5D14 A;  2JXM B;  4JI7 L;  1PFN A;  1Q81 C;  4YCU A;  1FGB D;  4J6H A;  4LUO A;  5IOD A;  4LF5 Q;  4FYD A;  3Q22 A;  2FFK B;  4LNQ A;  3H0G B;  1XPR A;  4L5T A;  5C6A A;  3K7A B;  4TKO B;  4ZKC B;  1P8L A;  4JW0 A;  4B3R Q;  2CQO A;  1QG7 A;  4OX9 Q;  3KDF A;  1E3P A;  2ID0 A;  1O7Z A;  2K50 A;  4GOP C;  2CFM A;  4DK6 C;  3TZD A;  2R92 G;  3D0F A;  5I2X A;  1WTR A;  4DV3 Q;  3SR1 A;  3CD6 A;  1GUT A;  2EOT A;  3ICE A;  1WCM G;  5IT9 L;  3I4L A;  4R4I A;  4YCW A;  5IP7 G;  4X66 L;  2AUK A;  3PIO A;  1ROD A;  1ASY A;  3D8G A;  1AP0 A;  2E8G A;  4BBS H;  3CCE A;  1SSO A;  2A68 C;  4IFD I;  1EZ8 A;  2JP1 A;  2A68 D;  3PV0 A;  2LY7 A;  1X3E A;  1YEZ A;  2HQL A;  2ZTE A;  4A3D H;  2IHE A;  1PZI D;  4KD4 A;  4J15 A;  3UI2 A;  5FLX E;  1WTV A;  1SN8 A;  4CKE A;  4HMJ A;  4JI8 Q;  5C44 B;  2RDF A;  1EEI D;  2B63 B;  3PCO B;  2Z8L A;  4CKC A;  4A3E H;  1PVO A;  2LS0 1;  3VYT A;  2QA4 A;  1EIY B;  2FMC A;  3J81 E;  1C48 A;  3S14 B;  3OWF A;  1C9O A;  4JVZ A;  3U4V A;  2B2Y A;  1GO3 E;  5LMU Q;  4OIK A;  4LWC A;  4F87 A;  2YYZ A;  4IZ8 A;  1TWC B;  4JI6 L;  5IYD G;  2M9V A;  1SE4 A;  5ELE A;  1HNX L;  4RCN A;  2MJ8 A;  4A3G H;  4JYA Q;  1SNP A;  3V96 A;  1A62 A;  1ZYR C;  4KD3 A;  1PYB A;  4ZUI A;  1FR3 A;  4LFC Q;  3K81 C;  5M5W B;  1ZYR D;  2PYK A;  4CGY B;  1HPC A;  3JC6 6;  1XYI A;  1K0R A;  1XNR Q;  1A15 A;  4YHH Q;  1WJJ A;  3VDY A;  3K8A A;  1HCZ A;  2Z4I A;  4FF3 A;  4MZ9 A;  4JCV E;  3CCQ A;  2JA5 H;  1PFS A;  4R4Q A;  3QOJ A;  1IL2 A;  3KFU A;  1YJW A;  2RVL A;  1J5E L;  4OIJ A;  3J80 c;  3HOV H;  1HFN A;  3FKI H;  1TT2 A;  2VUM H;  2IY5 B;  1EWC A;  4JI5 L;  4HSV A;  3I56 A;  3NEL A;  2PQA A;  1IHZ A;  5BN3 A;  3NWT A;  4MN3 A;  2A6H D;  4C2M H;  1B2T A;  1TWF H;  3MTS A;  5C4J B;  1EY7 A;  2EYH A;  2A8V A;  1U4L A;  3H0G G;  1FD7 D;  3QWN A;  2L5T A;  3RZO H;  3U58 A;  1TR5 A;  2KJX A;  3LWE A;  3CW2 C;  2UUA Q;  5E3F A;  2VS1 A;  4WFN 3;  5EKK A;  4EQN A;  1O78 A;  2E74 C;  1Y14 B;  4QCL A;  3FHW A;  4UHV A;  1YBY A;  2N88 A;  3HS0 C;  5CC4 A;  3D31 A;  3HOW B;  1CA6 A;  1NAP A;  3NEN A;  1KDA A;  1XMQ L;  1UEA B;  3R2I A;  1XNQ Q;  4X62 L;  1YJ9 A;  1C4Q A;  1Y69 U;  1PFB A;  4FXG C;  2CHB D;  1ENA A;  3HOY B;  4LFA Q;  4DAM A;  1D1I A;  3AFP A;  4HJ9 A;  1V1O A;  5C3X A;  1B1Z A;  2I0Q A;  4IUP A;  1BQQ T;  1IBM Q;  1VQN A;  5JJK A;  3SEB A;  4DR5 Q;  1YHB A;  4G4K A;  3NPP A;  1HR0 L;  3TME A;  4BXX H;  1SRO A;  4HJ5 A;  1E22 A;  2GVB A;  1MJE A;  1V9P A;  3A8J E;  1PDQ A;  1HTL D;  1JWM D;  3J7A 5;  5C44 G;  1X65 A;  1EYA A;  3SK4 A;  4HJ8 A;  4BA1 I;  2B63 G;  1Y8O B;  2Z6K A;  3OTO Q;  3AB9 A;  5FLM H;  1A3T A;  1J6Q A;  3VYR A;  2FJ2 A;  4C3H B;  3EN2 A;  4I7A A;  4PZ6 A;  3KUP A;  1X3F A;  2MO0 A;  4XQN A;  4I7Z C;  3S2H H;  1UWV A;  4POG A;  3RLN A;  1SNQ A;  4RGO S;  1I6V C;  1CKM A;  4R8I A;  3AMU A;  1TWA H;  2B2T C;  2JSO A;  1TXY A;  4KY5 A;  4A3F H;  5CV4 A;  4A3J B;  4JI3 L;  2EYL A;  2ZM6 L;  1OXT A;  1KXL A;  1UE5 A;  3CF5 A;  1VQH A;  5GAD C;  1LTR D;  1E2Z A;  1AE3 A;  1Q12 A;  1VQ8 A;  2IHF A;  2F0E A;  2R93 H;  4CDF C;  1S5B D;  2QEJ C;  1UNS A;  4KI0 A;  3P7J A;  1TWH H;  1SYG A;  4NP5 A;  5NUC A;  3A7A B;  3HKZ E;  4K6L A;  2E76 C;  4GS3 A;  3SK8 A;  4F8M A;  5IP9 H;  4IUU A;  1Q8I A;  2L55 A;  4YCV A;  2HHH Q;  1IBL Q;  3NWS A;  2KVM A;  1STE A;  4A3C G;  1IXR A;  4DGZ A;  3MFG A;  1B44 D;  1WOC A;  3L0O A;  1N34 L;  1GKH A;  2EVB A;  1VQJ A;  5JEA J;  3PUZ A;  4DK1 A;  5FO9 B;  2QDL A;  2VQE Q;  4R4T A;  4DKA C;  3FDT A;  2PZU A;  2UU9 L;  3BVZ A;  1WTQ A;  1HNX Q;  2R61 A;  1L0W A;  3L2P A;  1NMG A;  3HKZ B;  3M7G A;  4DU9 A;  1TU2 B;  1V1P A;  3ERS X;  4RKB A;  5KNC A;  2J4X A;  1FNW A;  2F0I A;  3TBI B;  3K5N A;  1C8C A;  5JOB A;  3D4D A;  2KHJ A;  4AQY Q;  3QB3 A;  2AQ1 B;  5BN5 A;  4LF7 L;  1CT1 D;  2M2L A;  3TRE A;  3CCV A;  1CFM A;  2Z4H A;  2FHT A;  2E5L Q;  3A8K E;  1ESR A;  1IYV A;  4R4O A;  3CP0 A;  1NNX A;  3PGZ A;  4J8Q A;  4GKJ Q;  4IFD G;  2HUG A;  2RHQ B;  2XGT A;  1G2T A;  3HOW G;  5CBE E;  5C4Z A;  3FEW X;  3J81 j;  2ZJP A;  1UE1 A;  5HUR A;  3HOY G;  1IKM A;  1U0L A;  1YHQ A;  4JI5 Q;  2ZTD A;  4UP9 A;  3URY A;  1MBY A;  1OXS C;  4B3M Q;  4KN4 C;  1DD2 A;  4GLX A;  2JA8 H;  3TS2 A;  1TS4 A;  2DGY A;  1UUP A;  3GQB A;  5KYL A;  1HTP A;  4DNT B;  2I5M X;  3S1N H;  3I4O A;  3FP9 A;  3TP6 A;  2IWH A;  1WYD A;  1JOK A;  2JYO A;  4LF8 L;  1R9T H;  1PTO F;  4DV6 Q;  4C3H G;  3NBH A;  2ZXO A;  3T4A C;  3FMC A;  3VA7 A;  1LTI D;  4DUY L;  1SYB A;  4NXM Q;  3S15 H;  3P20 A;  2F0M A;  2JE6 I;  2E2I B;  3CME A;  1CZG A;  5C4H A;  5JEA H;  1GD7 A;  3RMH A;  3PF5 A;  2J0T D;  4KKS A;  4P72 A;  5FK9 C;  2K5N A;  4KHV A;  4PZ8 A;  4YWM A;  3ITP A;  4V19 0;  4L5S A;  2AUJ D;  1BUV T;  1KQS A;  2EJG C;  4B9X A;  3KK7 A;  1GUW A;  1KLU D;  5CV8 A;  2OT2 A;  4RG1 A;  1DZ1 A;  3UDX A;  1HR0 Q;  2N49 A;  1E0B A;  2LSS A;  4UAI A;  2K5D A;  2Z9H A;  1WVL A;  1SNC A;  1S5F D;  4RA8 A;  3FPU B;  5GQO A;  4P73 A;  1F77 A;  3A5U A;  1QVC A;  1JOR A;  1BOS A;  4DR2 Q;  2E2J H;  3H94 A;  1U4R A;  1M4V A;  3J81 L;  1SE3 A;  4MTK A;  5GAG C;  1EY8 A;  2XVS A;  3PUY A;  2A5H A;  1VQL A;  5IGC A;  2A69 C;  3S1R H;  4BBS B;  1WD0 A;  3ERQ A;  2A69 D;  5LMN Q;  1ZEQ X;  1PYW D;  4LF9 L;  1S72 A;  2OWO A;  1NSN S;  1LT5 D;  2PQE A;  3A8I E;  2O4X A;  3HKZ G;  1VMC A;  2F0F A;  4A3D B;  3G6E A;  2I46 A;  3CCM A;  4Y52 H;  1RD9 D;  4DV1 L;  2EZV A;  2F3W A;  2DJF C;  3HOZ H;  4ZRZ A;  1K8O A;  1SJE D;  4A3E B;  4FXD A;  2AWN A;  5D65 A;  1BDO A;  1WTH A;  1XX8 A;  4KHP Q;  4LF5 L;  2ZTC A;  2EYM A;  2QW7 A;  4PMW A;  5C0X H;  3SE0 A;  4YY3 Q;  1TWG H;  4B3R L;  2NVX H;  5FJ8 H;  4OX9 L;  4X3U A;  1DM0 B;  5ELO A;  4A3L G;  5D3D A;  4AH6 A;  4DPG A;  2QEX A;  4A3G B;  4HAE A;  4DV3 L;  2QF7 A;  1OXX K;  2N55 A;  4AYB E;  1IZ6 A;  1JE5 A;  4R1J A;  5EGT A;  1TVX A;  3OIP A;  3CC2 A;  1N8R C;  2CH4 A;  1PH5 A;  1I3Q B;  3DLL A; 
#chains in the Genus database with same CATH homology
 4XXE A;  4EVO A;  1HQR D;  4XTC S;  2JA5 B;  2K1B A;  1B9N A;  4C56 C;  4AYB B;  1DOK A;  3HOV B;  5E4W C;  3FKI B;  1LTB D;  3KLS A;  2B2Y C;  4BS9 A;  1X3Q A;  2VUM B;  5KEE A;  2WKC A;  2R92 B;  1WTW A;  5CGK A;  1JCK B;  3I90 A;  5COR A;  4C2M B;  4EQP A;  4FVM A;  1TWF B;  2L12 A;  1FNU A;  3RZO B;  5KYI A;  3NUC A;  4ZQ3 A;  4ZK9 B;  3E0J A;  4CJ2 C;  3GD7 A;  5CR3 A;  2O5J C;  1Y8P B;  3I8Z A;  1SMY C;  4CJ0 B;  5KNB A;  4RGN A;  1SMY D;  3MXP A;  3O13 A;  5TSS A;  2HDM A;  2F0O A;  4K8I A;  1I4P A;  4KKU A;  1DOL A;  3RUZ A;  1V8Q A;  5JPN C;  3PUW A;  2PNR C;  1HUM A;  3NQI A;  1JR0 D;  1B4O A;  3U9S A;  2HCI A;  4J1M A;  1SND A;  2F0P A;  2X69 A;  3M7N A;  1D5M C;  3M85 A;  4XT1 B;  1JQY D;  4KY6 A;  1BNZ A;  2K05 A;  4DNR B;  1H9S B;  4G7H C;  1EIH A;  1LTG D;  2SOB A;  2NN6 H;  1SNO A;  1GHJ A;  3C3L A;  3S2H B;  2Q8R E;  4MHE A;  3X3M A;  1TWA B;  4K14 A;  1S4Z A;  4A3F B;  3D6W A;  1SYF A;  2NWG A;  2B2W C;  1MGS A;  4WJW A;  3F2U A;  5G3L D;  3C2P A;  3VYS A;  1YNJ C;  3X3N A;  1TWH B;  2IW3 A;  5DM6 3;  5BN4 A;  3T51 B;  2A74 C;  3BZD B;  3GP7 A;  4L8J A;  2RQX A;  4ZKB B;  4F88 A;  1J8I A;  3AU7 A;  4BA2 I;  1KNA A;  5EKL A;  1OXU A;  2TMP A;  3Q23 A;  2L9H A;  1QNU A;  2RKS A;  3OHX C;  4KJN A;  3RLF A;  1H9K A;  5I6W A;  1HA5 A;  3NBI A;  2F0W A;  4O42 A;  5LL6 X;  1AN8 A;  4ZLT F;  4YIJ A;  3BVM A;  4BWG B;  1QB5 D;  2SDF A;  2FMM A;  1L0X B;  3DWQ A;  3P1H A;  2AQ2 B;  2L11 A;  1PRT C;  1PFM A;  5E1F A;  3C1F A;  1PRT D;  3H09 A;  3FVQ A;  3SDZ A;  1GUS A;  3PMF A;  5T1G A;  3E5S A;  2F0L A;  1CI3 M;  5C0X I;  5J22 A;  4IUT A;  1WD1 A;  3JAM E;  4G57 A;  3M4Y A;  5EJW A;  2JA8 B;  4JK1 C;  1PTO B;  3LNN A;  3BVG A;  1H9J A;  3S1N B;  4R9W A;  5ISR A;  3NTH A;  4DXG A;  1R9T B;  1F9S A;  4K2K A;  1SEB D;  4P2C B;  3VR3 A;  1EU3 A;  4TQU S;  3S15 B;  1STN A;  3GV3 A;  2WV6 D;  4X3K A;  1PZK D;  4WRD A;  2KEC A;  1KNE A;  4CJ1 B;  1T5E A;  5AFW A;  4ABN A;  1GUO A;  1OO9 B;  4Q0F A;  1J9O A;  3NTI A;  2RDH A;  3PIP 3;  2A6H C;  2E2J B;  3L7Z C;  2BE5 C;  2K5W A;  4XQJ A;  3T53 B;  2BE5 D;  4RHR A;  2I07 B;  2R6G A;  1PRT B;  2DNC A;  4PMC A;  4KTA A;  3S1R B;  2EYO A;  5IGE A;  3IFT A;  4G7O C;  4IUQ A;  1EFI D;  4CKB A;  1KTK A;  3SXH A;  3ND9 A;  5JVG 3;  4IQZ A;  4XIG S;  1A2U A;  1TY2 A;  5I2Y A;  3P75 A;  1LLR D;  2C5C A;  2VB3 X;  5K36 H;  4FP5 D;  3NK9 A;  1B53 A;  2NB0 A;  1Y8N B;  4ULL A;  2KED A;  2Q8T A;  1IKL A;  1TWG B;  2NVX B;  5E4X A;  3T16 A;  4L63 B;  1O7L A;  2DY8 A;  3G6J B;  1VDZ A;  3J7Y W;  2DY7 A;  2NN6 I;  1CK1 A;  4B9W A;  3KBG A;  3MXU A;  1JWS D;  1A6X A;  3NTK A;  1YNN C;  2XRS D;  3MVV A;  1RHP A;  2NZ1 D;  1YNN D;  1EQT A;  3D3R A;  1ZKO A;  3HOU B;  1ET9 A;  4Y7N B;  3SK5 A;  1LAB A;  2B8G A;  3H6M A;  1STH A;  1R4P B;  1RF2 D;  2R3Z A;  1DXM A;  3A55 A;  3H3V C;  3A7L A;  3HG9 A;  2SEB D;  2F0K A;  4BBR B;  1NCV A;  5JEA G;  3DMU A;  2MP1 A;  1PXU A;  4L6T B;  1AZQ A;  3G7L A;  4ILW A;  4GZY C;  4RKL A;  1S5D D;  4PQX A;  3BDL A;  4DN4 M;  2QKI C;  4JBW A;  3MWY W;  1NR2 A;  1Y1V B;  2F0N A;  3GTM B;  3CHB D;  3DUZ A;  4RHS A;  2ENB A;  3Q6S A;  4DXF A;  2XWB B;  1SFO B;  3GTQ B;  2PW5 A;  1ENF A;  4KJO A;  4K6D A;  2K03 A;  2A6E C;  2M00 A;  2A6E D;  2WAC A;  5C5M A;  3MFY A;  5A35 A;  2B2U A;  2ZXR A;  3VR6 A;  5I9O A;  2EXZ A;  4O1N A;  3DHQ A;  3HZX A;  3QIA A;  5C0X G;  2K5Q A;  2NVT B;  1TS3 A;  2V4D A;  1Q3L A;  5D3I B;  5G3L F;  3N6R A;  5DM7 3;  2F0T A;  3L9A X;  1EYC A;  2GA4 B;  2X6G A;  3MA2 B;  4I65 A;  5C5L A;  1M8A A;  4A3B B;  1HA6 A;  3BYT B;  5T1I A;  3TSS A;  1NR4 A;  2JEA I;  1STY A;  3T56 B;  2PPB C;  4ZYS A;  5EBD A;  5CV9 A;  2MUY A;  3H91 A;  1SYC A;  1HHV A;  1TKW B;  4KMU C;  5IOC A;  4FXK C;  3PIO 3;  1F2M A;  3JAM L;  1EL0 A;  4BY7 B;  4RH6 A;  1S5C D;  3PUX A;  4NW2 A;  2EPB A;  1TY0 A;  2KCN A;  1PRT F;  3MHB A;  4QUF A;  1ET6 A;  4V0B A;  3RZD B;  3GTK B;  4C1N I;  3M3Y B;  2L4N A;  1EY9 A;  3W2D A;  2D62 A;  1GJX A;  2IPK D;  2IX3 A;  3I3C A;  1U9R A;  4IAL A;  2F0S A;  2H4O A;  2QDB A;  1ESF A;  4HSP A;  2B2T A;  2K6A A;  3HGB A;  1LV9 A;  4G7Z C;  3S9W A;  3LX0 A;  3SHL A;  2F0G A;  4A3K B;  2NYZ D;  2DNE A;  3K57 A;  3HRZ C;  4H7B A;  3S2D B;  2NN6 G;  1QNK A;  2WAQ B;  1W6K A;  2EY6 A;  2EYP A;  2WB1 B;  1DYQ A;  5JVH 3;  4OGQ C;  3BDO A;  3K0Y A;  2O2L D;  1D1K A;  2G9D A;  3WOE A;  4UDU C;  1STB A;  1G91 A;  3MXN A;  5FO8 B;  1EYD A;  3VYU A;  2NTT A;  3CRL C;  1Q1E A;  4F7X A;  2EYJ A;  2RSN A;  1D2B A;  5M3M B;  2EY5 A;  1F9Q A;  3BDC A;  1HQM C;  5IGF A;  1Z6H A;  4HMI A;  2EJF C;  4K5V A;  1D5X C;  4CBV A;  5EBC A;  1CTM A;  2BDN A;  4RWS C;  1B3A A;  4HCS A;  1LT3 D;  1D6E C;  2SNS A;  4BY1 B;  1XXG A;  3I73 A;  1HFG A;  4XT3 B;  3ONA B;  3I70 A;  3R3O A;  2F0J A;  3HP3 A;  1RKN A;  1QIL A;  1GOZ A;  3K5M A;  5M5Y B;  3TDQ A;  2KCC A;  2F3V A;  5EQ0 A;  5COY A;  3U9O A;  3V05 A;  3PO3 B;  3BG3 A;  2XIW A;  3J80 E;  1PMR A;  3QO2 A;  5KIX A;  4DAY A;  3IKJ A;  2C9O A;  1K83 B;  3OW7 A;  3MZ5 A;  1SJH D;  3K59 A;  1CHQ D;  1EQV A;  4QIW B;  2ZT9 C;  1AZP A;  2DN8 A;  3EQL C;  3FPP A;  1SBB B;  2AWO A;  3D4R A;  3DM1 A;  2XNA C;  3IAY A;  3I4N B;  4XYO A;  1ENC A;  4R8N A;  3NSW A;  2K32 A;  4PMB A;  3I72 A;  1EY6 A;  1DCZ A;  1TQO A;  2B2V A;  3K6O A;  2CVR A;  4HED A;  2R93 B;  1CM9 A;  3DEO A;  4C1N K;  1WTP A;  1ICW A;  1QOH A;  4NMZ A;  5M3F B;  2NBF A;  3EVQ A;  5DNF A;  1JOQ A;  3S1M B;  3D6C A;  1EY0 A;  4C3J B;  5ELD A;  1QWY A;  5EPL A;  1X3P A;  2HDL A;  2RA4 A;  4OO1 H;  1DOM A;  2HCC A;  2ICE C;  2K28 A;  1SDF A;  5I4D A;  1Y1W B;  4S3S A;  1FYC A;  1STG A;  1HUN A;  2YU9 B;  1ILQ A;  3V2T A;  3VR5 A;  3BS1 A;  1F9R A;  4K5W A;  1LTT D;  4FF2 A;  4KY7 A;  1TII D;  3BYY B;  3KLR A;  1LTA D;  3QG1 A;  1U4P A;  1SE2 A;  1CQF A;  3EJI A;  5I9P A;  5C4X B;  1F9P A;  2D2C C;  1ML0 D;  5K36 G;  1IW7 C;  1MI2 A;  2KOL A;  1IW7 D;  4FF1 A;  1II3 A;  3C1E A;  4PV1 C;  1H9S A;  1S5E D;  5CYU A;  4U67 3;  4A3M B;  2LKV A;  4ME5 A;  4OL7 A;  1F2L A;  4KN7 C;  5KND A;  4A93 B;  1VF7 A;  4ODG A;  2KA7 A;  5JPM C;  1ONL A;  3D4W A;  3MAQ A;  4DF7 A;  3GTJ B;  1RTO A;  2K7V A;  4DA2 A;  2R7Z B;  1JWU D;  5A2Q E;  2B2U C;  4IN3 A;  1CHP D;  3QOL A;  4DAV A;  1B50 A;  2JA7 B;  3GO5 A;  2BA0 A;  3DXJ C;  3I4M B;  2PZT A;  4KK7 A;  4TSS A;  1L0Y B;  3K5L A;  2IX1 A;  4N9T A;  2D5D A;  2A73 B;  2QIL A;  1F2Y A;  3Q0A A;  2OEO A;  3FRP B;  4C3J G;  3ZYY X;  2RSO A;  3CRK C;  2VB2 X;  1OXV A;  2K04 A;  1I4Q A;  3CU7 A;  5KGU A;  4HTH A;  1I50 B;  3PO2 B;  2IX0 A;  1I6H B;  2E2D C;  3IFD A;  2NTS A;  1JOO A;  3EFX D;  3HOZ B;  1V1P B;  1B9M A;  3C46 A;  4M8A A;  2F1M A;  5LL6 S;  4RFB A;  2RDG A;  3QJY A;  3VR2 A;  3OMG A;  3HEJ A;  4XQQ A;  2D9U A;  2NVY B;  5IGD A;  3OWE B;  1A2T A;  2B2W A;  4PNY A;  1H9R A;  1DON A;  2F0D A;  1PLF A;  2K01 A;  4N9P A;  2F0U A;  1LT4 D;  3CKI B;  5J39 A;  4IUR A;  5DAU A;  1VMP A;  4LAA A;  1U4M A;  1RTN A;  1SXT A;  3OPO A;  1EOT A;  4ID6 A;  2O5I C;  1E2W A;  3R93 A;  2IL8 A;  2IT1 A;  1I4R A;  4K5X A;  2WKD A;  2B8F A;  1EY5 A;  1IYU A;  5FKA C;  5JAV A;  4X3S A;  2F4I A;  3MC0 B;  4KHZ A;  3SK6 A;  4NKL A;  2F0V A;  2PO4 A;  1MSH A;  5EKI A;  4EQO A;  3Q24 A;  2G9H D;  1XTC D;  2KHS A;  1CZW A;  1BO0 A;  5CV6 A;  3J80 L;  4H13 C;  1HRJ A;  1BCP F;  1KAB A;  5ELC A;  1CA5 A;  3WOF A;  1KDC A;  4OO1 I;  3NXW A;  1G29 1;  4A3I B;  2WII B;  4QF4 A;  3LWU A;  3HOX B;  3S17 B;  2SNM A;  1JE4 A;  2EE1 A;  2LFN A;  5EPJ A;  5F2D A;  1GXD C;  1ILP A;  5I6Y A;  4RGT A;  3GV6 A;  2PZW A;  4OHJ A;  3I91 A;  1SAP A;  3W3A A;  5J1Z A;  5LHY 1;  2PMZ B;  1W6J A;  4IUV A;  1BR9 A;  3TN2 A;  1FNV A;  2KUM A;  4Z9C B;  3NHH A;  4MIU A;  1SYD A;  4CHT B;  3S16 B;  5FO7 B;  1I4G A;  5IT9 E;  4IFD J;  4ZAI A;  3E6Z X;  3GTG B;  2X6L A;  3T13 A;  1Z7T A;  3TP8 A;  1PTO H;  1UAP A;  2EJM A;  4LMQ D;  4NDX A;  5C3E B;  5FOB B;  4RCO A;  1NUC A;  2KEE A;  3J7A V;  2LMC B;  2EY1 A;  4Q5V A;  5ELF A;  5KRU A;  1EEF D;  5ELB A;  5C0X J;  2HQE A;  1G2S A;  3SVM A;  2B39 A;  1RCV D;  3A54 A;  1V43 A;  1G8Z D;  1KDB A;  1HXY D;  3KF8 A;  3OSO A;  3R8B A;  2WIN B;  3CQZ B;  2CW0 C;  2EY2 A;  2XSC A;  2CW0 D;  1BF4 A;  1RDP D;  4K8J A;  2BA1 A;  1TS2 A;  2B2V C;  5FLX L;  1CQV A;  1ZXT A;  1IL8 A;  4RGM A;  1Q1B A;  1EIG A;  4DK0 A;  4DAP A;  2ZXP A;  4WOR A;  3ND8 A;  5K5P A;  4KV6 A;  4H0L C;  1AEX A;  1I4X A;  1JIC A;  5DEH A;  3J7A F;  1LO5 D;  3L3O C;  3DWP A;  2PW7 A;  1WTX A;  4IFD H;  4RAU C;  5A2Q L;  4HR7 B;  2IJ0 A;  1AFP A;  2VNU D;  2L1B A;  5CBA E;  2QCP X;  1I4H A;  1LAC A;  2E75 C;  1VF5 C;  4X3T A;  3K58 A;  1BXT A;  1D5Z C;  1XWE A;  4HCE A;  1EY4 A;  3R2T A;  2OXP A;  1EU4 A;  3VA5 A;  3IL8 A;  1JB3 A;  2TSS A;  4LK1 C;  4HN7 A;  1F2Z A;  4C3I B;  2WP8 J;  2JA6 B;  2XN9 C;  2FIN B;  1DJR D;  2H1E A;  1EWH A;  5HGT A;  4K2L A;  1VCI A;  1H9M A;  1R4Q B;  2CQA A;  3GTL B;  2Y0S B;  5IIF A;  3DEP A;  3NQT A;  5IGG A;  1G6Z A;  1EZ6 A;  3VR4 A;  3S1Q B;  1MSG A;  1RJT A;  1SYE A;  5JJZ A;  5EPK A;  3A56 A;  3MEH A;  1PZJ D;  1SNM A;  3KLS X;  3NE5 B;  3DWA A;  1BCP C;  1WTO A;  3KBX A;  5M9O A;  4DFA A;  2ICI A;  1BCP D;  4OO1 G;  1WCM B;  5M5X B;  2MGS A;  2F03 A;  4QMG A;  1GUN A;  4B08 A;  1GUG A;  2MPM A;  3MXG A;  3TP5 A;  4KKT A;  3N52 A;  1JC7 A;  5CV5 A;  2NVQ B;  5IGB A;  1QE6 A;  4FO2 A;  1KLG D;  1QCB D;  2F0H A;  1GHK A;  3EA6 A;  3PUV A;  4E6I A;  2RBM A;  1A3V A;  3TP7 A;  3K5O A;  2K33 A;  3OMC A;  1KAA A;  2XWJ B;  1LT6 D;  3OIQ A;  3OOC A;  3ERO A;  2EYF A;  2MHV A;  2BOS A;  3WDN A;  4EGV A;  3GTO B;  1BBX C;  3GTP B;  1TS5 A;  4H44 C;  4QB4 A;  4XDX A;  1MD2 D;  2EDG A;  4XYQ A;  1E2V A;  5C3W A;  1QJO A;  4FF4 A;  4FNF A;  1Z47 A;  1O80 A;  3NP8 A;  4QUC A;  2PCF B;  2VXW A;  2F0Q A;  2OF1 A;  2AQ3 B;  2Q8I B;  3RD4 A;  1LTS D;  1Q90 A;  1K8M A;  2J7Z A;  2E2H B;  1STA A;  2BCO A;  1O7Y A;  4LJZ C;  4U68 A;  4ZUJ A;  4C3I G;  3M4O B;  1AW7 A;  1A3U A;  2NUC A;  3TZU A;  1BCP B;  2L0C A;  4M1U B;  5CMD A;  1PTO C;  4TRD A;  1T5X D;  1PTO D;  2KQ3 A;  2BDO A;  4IUN A;  1YNJ D;  1X32 A;  2XRQ D;  2JEB I;  5CV7 A;  2Z1C A;  5D14 A;  2JXM B;  1PFN A;  1FGB D;  4J6H A;  5IOD A;  4FYD A;  3Q22 A;  2FFK B;  3H0G B;  5C6A A;  3K7A B;  4TKO B;  4ZKC B;  1QG7 A;  2ID0 A;  1O7Z A;  3TZD A;  5I2X A;  1WTR A;  3SR1 A;  1GUT A;  2EOT A;  5IT9 L;  3I4L A;  2AUK A;  1ROD A;  3D8G A;  1AP0 A;  1SSO A;  2A68 C;  4IFD I;  1EZ8 A;  2JP1 A;  2A68 D;  3PV0 A;  2LY7 A;  1PZI D;  4KD4 A;  3UI2 A;  5FLX E;  1WTV A;  4CKE A;  4HMJ A;  5C44 B;  2RDF A;  1EEI D;  2B63 B;  2Z8L A;  4CKC A;  2LS0 1;  3VYT A;  2FMC A;  3J81 E;  1C48 A;  3S14 B;  3OWF A;  2B2Y A;  4OIK A;  4F87 A;  2YYZ A;  4IZ8 A;  1TWC B;  2M9V A;  1SE4 A;  5ELE A;  4RCN A;  2MJ8 A;  1SNP A;  3V96 A;  1ZYR C;  4KD3 A;  4ZUI A;  1FR3 A;  5M5W B;  1ZYR D;  2PYK A;  4CGY B;  1HPC A;  1XYI A;  1A15 A;  1HCZ A;  2Z4I A;  4FF3 A;  3QOJ A;  2RVL A;  4OIJ A;  1HFN A;  1TT2 A;  1EWC A;  4HSV A;  1IHZ A;  5BN3 A;  3NWT A;  4MN3 A;  2A6H D;  1B2T A;  3MTS A;  5C4J B;  1EY7 A;  2EYH A;  1U4L A;  1FD7 D;  3QWN A;  2L5T A;  1TR5 A;  2KJX A;  3LWE A;  5E3F A;  4WFN 3;  5EKK A;  4EQN A;  1O78 A;  2E74 C;  4QCL A;  2N88 A;  3HS0 C;  5CC4 A;  3D31 A;  3HOW B;  1CA6 A;  1NAP A;  1KDA A;  1UEA B;  3R2I A;  1C4Q A;  1Y69 U;  1PFB A;  4FXG C;  2CHB D;  1ENA A;  3HOY B;  1D1I A;  1V1O A;  5C3X A;  1B1Z A;  4IUP A;  1BQQ T;  3SEB A;  4G4K A;  3NPP A;  3TME A;  3A8J E;  1PDQ A;  1HTL D;  1JWM D;  1EYA A;  3SK4 A;  4BA1 I;  1Y8O B;  3AB9 A;  1A3T A;  3VYR A;  2FJ2 A;  4C3H B;  3KUP A;  4XQN A;  4I7Z C;  1SNQ A;  4RGO S;  1I6V C;  4R8I A;  3AMU A;  2B2T C;  2JSO A;  4KY5 A;  5CV4 A;  4A3J B;  2EYL A;  1OXT A;  1LTR D;  1E2Z A;  1Q12 A;  2F0E A;  1S5B D;  2QEJ C;  1UNS A;  4KI0 A;  3P7J A;  1SYG A;  4NP5 A;  5NUC A;  3A7A B;  4K6L A;  2E76 C;  3SK8 A;  4F8M A;  4IUU A;  1Q8I A;  2L55 A;  3NWS A;  2KVM A;  1STE A;  4DGZ A;  3MFG A;  1B44 D;  2EVB A;  5JEA J;  3PUZ A;  4DK1 A;  5FO9 B;  3FDT A;  2PZU A;  3BVZ A;  1WTQ A;  2R61 A;  3HKZ B;  3M7G A;  4DU9 A;  1TU2 B;  1V1P A;  4RKB A;  5KNC A;  2J4X A;  1FNW A;  2F0I A;  3TBI B;  3K5N A;  1C8C A;  5JOB A;  3D4D A;  3QB3 A;  2AQ1 B;  5BN5 A;  1CT1 D;  2M2L A;  1CFM A;  2Z4H A;  2FHT A;  3A8K E;  1ESR A;  1IYV A;  4J8Q A;  4IFD G;  2HUG A;  1G2T A;  5CBE E;  5C4Z A;  3FEW X;  5HUR A;  1IKM A;  3URY A;  1MBY A;  1OXS C;  4KN4 C;  1DD2 A;  1TS4 A;  1UUP A;  3GQB A;  5KYL A;  1HTP A;  4DNT B;  3TP6 A;  2IWH A;  1JOK A;  2JYO A;  1PTO F;  4C3H G;  3NBH A;  2ZXO A;  3T4A C;  3FMC A;  3VA7 A;  1LTI D;  1SYB A;  3P20 A;  2F0M A;  2JE6 I;  2E2I B;  1CZG A;  5C4H A;  5JEA H;  3RMH A;  2J0T D;  4KKS A;  5FK9 C;  4KHV A;  3ITP A;  4V19 0;  2AUJ D;  1BUV T;  2EJG C;  4B9X A;  3KK7 A;  1GUW A;  1KLU D;  5CV8 A;  2OT2 A;  1DZ1 A;  1E0B A;  4UAI A;  2K5D A;  1WVL A;  1SNC A;  1S5F D;  4RA8 A;  3FPU B;  1F77 A;  1JOR A;  1BOS A;  3H94 A;  1U4R A;  1M4V A;  3J81 L;  1SE3 A;  1EY8 A;  2XVS A;  3PUY A;  2A5H A;  5IGC A;  2A69 C;  4BBS B;  1WD0 A;  3ERQ A;  2A69 D;  1ZEQ X;  1PYW D;  1NSN S;  1LT5 D;  2PQE A;  3A8I E;  2O4X A;  1VMC A;  2F0F A;  4A3D B;  2I46 A;  1RD9 D;  2EZV A;  2F3W A;  4ZRZ A;  1K8O A;  1SJE D;  4A3E B;  4FXD A;  2AWN A;  5D65 A;  1BDO A;  1XX8 A;  2EYM A;  4PMW A;  5C0X H;  3SE0 A;  4X3U A;  1DM0 B;  5D3D A;  4A3G B;  4HAE A;  2QF7 A;  1OXX K;  2N55 A;  5EGT A;  1TVX A;  3OIP A;  1I3Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...