2M9VA

Structure of saccharomyces cerevisiae est3 protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
b'STDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKISLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomere replication protein EST3
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Structure of Est3 reveals a bimodal surface with differential roles in telomere replication.
pubmed doi rcsb
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m9vA00
5I2YA 5I2XA 2I46A 2M9VA
chains in the Genus database with same CATH superfamily
2A73B 1FGUA 2OTLA 2OXPA 4L5QA 2IX3A 2RHQB 4B3SQ 1WTWA 3AYHB 1I5FA 4DAVA 3AFPA 1H9MA 1LTAD 1AZQA 4DK6C 3PCOB 4JI4L 3SHLA 1YJ9A 1E1TA 1SE2A 2UU9L 4JI5Q 1HZ9A 2CW0D 1S5CD 1SDFA 1BBXC 2DNCA 1FGBD 1QNUA 2K01A 4C1NI 3R8BA 1EIGA 1IL8A 4UAIA 4KY7A 3Q24A 3M7GA 3S2DB 2NYZD 3CPFA 3PUYA 2UUAQ 1QB5D 4JBJA 1LT4D 5EKIA 3Q6SA 5E3FA 3VYUA 5CYUA 2FHTA 1G91A 2EZVA 1LTLA 3BDCA 4P71A 5ELBA 2QDLA 3DEOA 3ITPA 3CCVA 3S1NH 3C1FA 4C1NK 5CBAE 4DV0Q 3TS2A 1EYGA 2NZOA 3CHBD 1YHQA 3QR8A 1QCBD 4IJLA 5DAUA 1M90C 1DM0B 2EJMA 3R2IA 5C4JB 5IGFA 2N55A 1V1PB 3KBGA 1KAWA 4BS9A 5C4JH 2UXBQ 1JWMD 4FDBA 4HSPA 3CD6A 2MO0A 2MPMA 4YCUA 1VMPA 1EQTA 4BXXH 1XNRQ 1YNJD 3OTOL 1TWCH 1YVCA 3GV3A 1LUZA 3ULLA 2F0VA 2L5TA 4DR2L 4NKLA 2ATWA 4HJ8A 1CSQA 2PW5A 1VQOA 1K0RA 2PI2E 3MA2B 1DONA 4ZQ3A 4Q5VA 4LF7L 2EYOA 3CMAA 1Q86C 2A1AA 2FXQA 1HRJA 1GO3E 1WTHA 1IBML 3J7AV 4JCVE 4LJZC 4ZRZA 2E2IB 2KBNA 4CKEA 1NUCA 2PNRC 1D7QA 2ENBA 2L1BA 4QCLA 2EVBA 3WOFA 5LL6S 4BY7G 4OIKA 3S24A 5IIFA 1KC8C 3A0JA 1U0LA 4JI0L 1Q90A 3JAMc 5M3MB 4NW2A 4G7HC 2CWPA 4NXNL 1HNWQ 1KABA 2AUKA 3L2PA 3B6YA 4A4IA 5GAHC 2HDLA 3OPOA 2VXWA 5C0XJ 2XNAC 3QOLA 3HGBA 1E24A 2YTXA 4R9WA 1A15A 4DV4L 3I4NB 3MWYW 4F88A 1NY4A 2NWGA 2EY1A 4JI2L 4KKTA 2MNAA 1SNPA 2IW3A 1EY5A 2B2TA 3K0XA 1Q3LA 5C44B 1QZGA 3I72A 3L9AX 2RCNA 2H5XA 4RKBA 1EIFA 2ZTCA 2I5LX 2HUGA 4A3JB 4P72A 4ALPA 1EIHA 4X66Q 3TS0A 3AB9A 4A93H 3J80E 2VB2X 4UP9A 5BR8Q 4CKBA 1EWIA 1JC7A 5K36G 1HH2P 1W2BA 2F0HA 3BVMA 4A3LG 2JQOA 3L7ZC 3M4OH 3NBIA 2R92G 3Q0AA 1RTNA 2K5WA 2DJGC 1CQVA 4HTHA 4HEDA 2KA7A 1KDBA 1VQ5A 1VF7A 4A3CG 1K8OA 1HXYD 3HZXA 4XIGS 4PNYA 3P75A 1KAAA 2JA6G 3O13A 5JEAG 1CFMA 3GTQH 1ZKOA 4KY5A 1B8AA 1YBYA 2V4DA 1ZEQX 4X3TA 4GOPA 1S4ZA 2J7ZA 2KECA 3KLSX 4UP8A 1VQCA 1QVGA 4DUYQ 4A3EB 2NVTB 2RHSB 3I4MH 1LO5D 3CCUA 4OO1I 2ASBA 3T4AC 3HOUG 4DR7L 5GAEC 4QGUA 1A3TA 3NUCA 1OXTA 1VQ8A 3I4NG 3T1HQ 1HQRD 2NTTA 3ONAB 1KNAA 2B2WA 5ELCA 1F2LA 1P8LA 3S14H 5KIXA 4F8MA 1MJCA 5DEHA 4U673 3KDFA 5M5XB 1X3GA 2HD3A 4IURA 2Q2UA 3A5ZB 1I4HA 1IW7C 1M4VA 3R3OA 4CDDC 1STHA 2X6GA 1XPRA 4IJHA 4IFDG 1AE3A 2QGQA 4A3KG 1DZ1A 4YWKA 4P2CB 2N3SA 1RCVD 3NBHA 3Q8DA 1BCPC 4POFA 4PMBA 5FO9B 1R9TB 4DR3L 1VQGA 3J81L 1AEXA 1WTRA 1G6ZA 5JPMC 4ZUIA 3CRKC 4MZ9A 3PGZA 3F2UA 2CWAA 4QMGA 4HCEA 3E9IA 1O7YA 5TSSA 2Q8IB 1II3A 3LGJA 5H1SE 4RA8A 2SOBA 2P5ZX 4J15A 2PCFB 3T1YQ 3GTKH 2C9OA 3C2PA 4JBKA 4FXDA 3KF6B 2QEXA 2O5IC 3NP8A 2CH4A 5IT9c 1TS3A 3S9WA 1LABA 4MTNA 4C3HG 2D62A 3BZDB 1L1OA 1YHAA 2F0GA 1YJWA 2QCPX 4DGZA 4N8X1 3NXWA 5JJZA 1BVSA 4LWCA 5LL6X 3GTGB 1PFNA 5IYDG 1MKHA 5M3FB 2R93B 1ICWA 1H9KA 4OX9L 2NVTH 2B63H 2EJGC 5FKAC 1T5EA 2F0PA 4A3BH 4A3GB 3GD7A 2K5HA 4YHHL 2NVXB 2LMCB 3I4NH 3FPPA 4U68A 3HOWB 3OSOA 4B3RQ 2E2DC 1RIPA 1SLJA 1SSOA 3E6ZX 3GO5A 1GJXA 1L2FA 5IOCA 5ELDA 5GROA 3QWNA 1C0AA 1YNJC 3PUWA 1SRUA 4ID6A 1SFOB 4ZKBB 3I56A 1CA5A 4RCOA 4IUTA 1HZBA 1BBWA 5M5XH 1SNOA 1QVFA 4CJ1B 4DA2A 3NTIA 4X64Q 3CCQA 3DM3A 2JXMB 4ZK9B 4DAPA 1ESFA 2JEAI 4LF8Q 2MQHA 4X66L 4A3CH 3BDLA 2K4KA 1STGA 1W6KA 2YV5A 3TP7A 3RZDB 1XMQL 2LY7A 3S17H 4LF9Q 4B3ML 4J6HA 3W5OA 1PZKD 3M4OB 1SMYC 5ELFA 1C7YA 3H91A 3I4LA 3J80i 3E0JA 1NMGA 4E6IA 3K59A 4CJ2C 1KD1C 3SVMA 5M5YB 1QVCA 2Y0SB 3VR5A 2ZM6L 3CCEA 4AQYQ 5IWAL 1YI2A 4WJ4A 1WCMH 4HJ5A 1KL9A 5M5WB 1S72A 1SROA 1WTQA 4XT3B 2R92B 4H7BA 4KN7C 3KYHC 1PH8A 3D31A 4HMJA 2ZT9C 3HOXG 1QUQB 1K8MA 2WINB 3I55A 4JYAQ 4RWSC 3E5SA 4A3DG 4MIUA 4ODGA 3LNNA 4BY7H 1UE5A 3JC66 2NN6I 4OWWB 4FF3A 2Q8TA 1S3OA 2KEEA 1D1IA 3I4MB 3HOXB 3A56A 1HFNA 3NEMA 2PW7A 3S1QB 3BZKA 1TWHB 1LT3D 2XWJB 4IQZA 4RKLA 4RGOS 1G51A 3HOXH 4GNXA 1W3SA 4Q0FA 1KIXA 4OL7A 5ELNA 1HUMA 1PFSA 2LXKA 3N6RA 4L5TA 3A54A 5NUCA 1CKMA 2F0TA 2YU9H 3S1RB 4IPDA 2DN8A 2WAQE 1NR4A 2MHVA 4A76A 1EU3A 3S1MB 3RNUA 4BBRH 2LKVA 4H44C 2ZXPA 2YTVA 3H15A 2K7VA 1F2ZA 3E0EA 1SJED 2KCMA 2LXJA 4A3IG 2N88A 1F9SA 3V2TA 1YITA 3S1MH 1B2TA 3RZOB 3VR6A 3D4WA 4HIOA 2B3GA 3UDGA 3IFTA 3SK6A 1E2ZA 1DOMA 4ME5A 4CDEC 4RGNA 2R61A 1QOHA 1ILPA 4HJ7A 1EWCA 2MUYA 5FO7B 2A74C 3SXHA 3PF5A 1ZXTA 4JK1C 3H0GH 3GTJH 3KFUA 5I4DA 1D8LA 2R7FA 3DHQA 1OTCA 4IFDI 1EYCA 3RLNA 2EJFC 4J1MA 4R4QA 4DV2Q 3GTMH 2F3IA 1PZID 1CHPD 2B29A 2WV6D 5D3IB 5C3EH 1XNRL 2QF7A 1VQ9A 4OO1H 1EY8A 5E7NA 1XTCD 3C1EA 5M3FG 3FMCA 2R93G 5K36H 1SYDA 1E2WA 3U4VA 1WCMB 1EYDA 4DK1A 3HOVB 1PA6A 1CSPA 3IL8A 4ABNA 2TSSA 4A3IB 5F2DA 1JB7A 2L15A 3CPWA 3S16B 3CKIB 4OELB 2ZJQA 3F1ZA 1M1KC 1STEA 2JA9A 1NSNS 3MXUA 4B9WA 5AJ3L 1LTSD 4UDUC 1G2SA 2N78A 1G291 2EYJA 1HR0W 4JI4Q 4C56C 1AP0A 1GUNA 1TT2A 4BY1B 2CFMA 3U9OA 2JA7B 4UPAA 3HKZG 1JORA 4BBSB 2OCEA 3HOWG 1GM5A 3H3VH 1BBUA 1CKNA 2F4VQ 5AJ3Q 4DR3Q 4GKKL 3D4RA 2XTIA 4FF2A 2F0NA 4IN3A 1IBMQ 1NE3A 4PZ7A 1EIYB 3OMGA 3PUVA 3QG1A 1XNQL 4XXEA 3CCRA 2KVMA 3PIO3 4K0KL 3K5OA 3FEWX 3TDQA 3K81C 1K83H 1XX8A 1OXUA 2OQKA 4N9PA 1IZ6A 4C3HB 4DUYL 3I8ZA 3BZCA 2E5LQ 1CM9A 2SEBD 1VQHA 3J81E 1VQ4A 1DCZA 5D65A 3ICEA 1X9NA 1QZHA 3KF8A 2KHSA 2QKIC 2F4IA 4B3MQ 1AE2A 4WRDA 4HSVA 2WACA 3K57A 3FPUB 2Q2TA 1A8VA 1BDOA 3PQIA 4BXXG 1V43A 1VQAA 2F3VA 4OIJA 3IAYA 5C44G 2JA5G 4DV1Q 1ZYRC 2MJ8A 1J9OA 1EUJA 1IBKL 2RF4A 2J0TD 1O78A 4YIJA 1B1ZA 1K0SA 3C46A 3TP5A 1XWEA 1I4PA 4WFN3 1VQ6A 5JJIA 1XTDA 4ME3A 1X3PA 2D0PA 3GV6A 3WOEA 4YWMA 3HOYB 4A3FG 1UE7A 3UDFA 1STBA 4NXMQ 3D3RA 2WB1E 3RMHA 5EGTA 3SR1A 5IGDA 2PNHA 5KEEA 1HUNA 4A3BG 4LMQD 1PYSB 2GA4B 5C0XH 3M7NA 2VNUD 1GUWA 4GLVB 1PFBA 4V0BA 4K5WA 4GKJL 1S5BD 2B8FA 1Z7TA 2EE1A 2QILA 4JV5L 1KRTA 1TWCB 1PH6A 4POGA 4L6TB 1IKMA 5EJWA 1E22A 2E2HH 1I6VC 1B7YB 3S2HB 2AMCB 5BN3A 4NDXA 1K3BC 3OW7A 2DY8A 4N8FA 1WI5A 2PQEA 4JBWA 4DR1L 4FF4A 4K8IA 5KNBA 4QB4A 3CF5A 2R7ZG 3D0FA 2NN6H 2ALYB 3STBD 1KQSA 4UHVA 3S2DH 1LTRD 3WWVA 5C0XG 4DR5L 4EX5A 1ZYRD 1N33L 4ZAIA 2F0MA 4EQNA 5CMDA 2JE6I 3I91A 3I2ZA 3U4ZA 3F2CA 1SE4A 3BG3A 2OEOA 3EA6A 4X3UA 1UEAB 3TBIB 2EDGA 1RJTA 3PIOA 2QEJC 1VMCA 1ENAA 1ILQA 4YCVA 3DEPA 3MAQA 3OWEB 2NZHA 3KBXA 5EPKA 5EPLA 4DU9A 3MXPA 3OTOQ 1OXXK 1Y8NB 2MFIA 1MSGA 4A3DH 2EYHA 1F2YA 3I73A 1PH5A 4OWXB 2VUMB 4LFCL 1B9NA 1TY2A 4MHEA 3CXCA 5C4XB 4DV3L 3M3YB 1I4QA 3PO3G 2Z0SA 3VYTA 3BYYB 5C4XH 3PV0A 3DXJC 1B70B 3VYRA 2MP1A 3CQZB 1K83B 1ET6A 2K14A 1K9MC 5ELEA 4CBVA 1BKBA 2UXCQ 4O42A 3MTSA 3K80C 4JI3L 3SE0A 1KXLA 1X3FA 3A7AB 3N52A 1GXDC 3PO3B 4IUPA 5JPNC 2Z9HA 2UXBL 2G5DA 2J4XA 4L8JA 2XGTA 1MSHA 2HDMA 1HFGA 2PI2A 5E4XA 4JI5L 3DWQA 2R7ZH 1AW7A 3J7YW 1BQQT 1XMOL 4NB3A 4HMIA 1MGSA 4OHJA 4C3IB 5IT9L 3D6CA 2DJFC 2F0QA 5KGUA 3MEFA 4EQOA 4JI1L 4LUOA 1TXYA 1EQQA 1X3QA 1U5KA 4L63B 3ZJYC 1B4OA 1RDPD 4OWTB 4BBRB 1GD7A 4DFAA 5IY0A 4X3KA 1KNEA 1I3QB 2EPBA 3AQQA 5D3DA 3SGIA 4A3EG 3L3OC 1OO9B 1TY0A 3X3NA 1HZAA 2HCCA 4R4CA 3GTPB 4RGTA 3VR3A 4H02A 3M4YA 1GHKA 4B3SL 4DK3C 2K1BA 1BCPD 2FMCA 1S40A 1XNQQ 4GN4B 4DV5L 5FK9C 2E75C 4C3JB 2I46A 1K3RA 4GZYC 1B53A 1H9SA 1UEBA 5A35A 3T13A 1LT5D 1FJGL 4ZLTF 5I9PA 1SR3A 2CW0C 2K52A 3OIPA 4EVOA 2K33A 2E2JH 4X65L 1Y1VH 4C3HH 5D14A 3BDOA 3OW2A 4BBSG 3V96A 3PIP3 1SNCA 4KD3A 2A19A 2C35B 1XJVA 3D8GA 3G6EA 3HOYG 1RKNA 2F0EA 4XYOA 1HZCA 2L0CA 1H9RA 1VDZA 2JN4A 4KTAA 1L1OC 1Z47A 3Q23A 1CHQD 5CV7A 3G4SA 1CKOA 1CTMA 1TWFB 2F0IA 1PTOH 4BWGB 1HNZQ 5J1ZA 2K5DA 2O2LD 3K7UC 3WDNA 2IPKD 2IT1A 4QL5A 3TN2A 2ZTDA 2BA0A 1G8ZD 3CAMA 2KEDA 3EVQA 3I7FA 1STNA 1BCPF 4DKAC 3FKIG 3OHXC 5IYCH 5BR8L 2OF1A 1Q1BA 1VQNA 5JAVA 3MXNA 1EFID 3DLLA 3EQLC 1HR0Q 3T1YL 2B2VA 3JAML 1PDQA 1Z6HA 4PZ6A 2MO1A 4IO9A 5BN5A 5CC4A 2EYPA 3SK4A 3S1RH 2ES2A 2F0OA 3BJUA 1F9RA 1G6PA 3GTLB 1BNZA 4RMFA 1SFOH 1SYCA 3ERQA 3R93A 1OXVA 2CCZA 3GTPH 1PH9A 1PRTF 4LFAL 4LFAQ 3TP6A 2EY2A 4X64L 4KV6A 4KD4A 2NBFA 3HKZB 3KF6A 4GN3B 2NUCA 3NQIA 4FXKC 4ZCKA 3HOUH 2F0UA 3UI2A 3VYSA 3TREA 1A63A 3EIVA 4A3MB 4IPHA 4HN7A 1Y1WH 1PVOA 3K5LA 4LF5L 3BYTB 2VB3X 4OO1G 3OYYA 3GQBA 1BOSA 4OGQC 4AH6A 1FD7D 2WAQG 2R3ZA 4KHPQ 1C9OA 1HA5A 2VW9A 2VY3A 4G57A 1S5ED 2Q2IA 3E3XA 2TMPA 3HOVG 5C3XA 4GKJQ 1I50B 1U4PA 4X6AH 3NK9A 1SNMA 4JI6Q 3LWUA 2A6HC 2K75A 2YTYA 1TWFH 4JI8Q 1O7IA 1WTVA 3MC0B 4CJ0B 5C5MA 1YIJA 2EIFA 4A3GG 3OOCA 1GUOA 4GKKQ 1JE5A 1DJRD 2IHFA 1KLUD 1JOQA 1GOZA 3F2BA 4A3KB 1D2BA 4DNRB 3P1HA 2WIIB 4KJNA 1BO0A 1KRSA 4XDXA 4DAYB 1STYA 4KJOA 2LS01 2ICIA 4LUZA 2D9UA 2KENA 1XMQQ 1JB3A 4A3FB 3M9BA 3TMEA 5IP7G 1YJNA 1FL0A 1SNQA 1ENFA 2A69C 1C48A 1R9TH 5FOBB 5LMNW 4DXGA 2JP1A 2XVSA 1AFPA 4R4TA 1BF4A 4DR5Q 2E2JB 5J22A 4HIDA 4WJ3M 2UXDQ 3NSWA 4DN4M 4R1JA 3QB3A 1WVLA 3FRPB 1V8QA 2UUAL 5CV8A 2F3WA 2JA8G 3KUPA 3PO3H 3HOVH 1KHIA 2HCIA 3PUZA 2KHJA 3GTMB 4DV7Q 3UDIA 2PQAA 1A2TA 5IYBH 2A69D 2SNSA 3BU2A 4WJWA 1D5XC 3QO2A 2VQEQ 2JK8A 2F1MA 3C3LA 4DR7Q 2RKSA 3PO2B 2XSCA 4IPCA 3HOZG 1YNNC 4JI8L 4CKCA 2R7ZB 1BCPB 3MZ5A 5M9OA 1LV9A 4A3DB 1CUKA 4F7XA 1JWSD 2NN6G 1ML0D 4XQJA 4BY7B 4FNFA 5T1IA 4FYDA 4IFDJ 5IT9E 2ZJPA 2WB1B 2RSOA 1YEZA 3RUZA 4KHPL 4LAAA 3HOWH 2NVQB 4G4KA 3GTOB 3CC4A 2KCCA 5JVG3 3TP8A 1VQFA 2IX0A 3SK8A 4LUVA 2Z1CA 2F52A 1FNUA 1WTOA 3D6WA 1ET9A 2QDBA 4EGVA 1VQIA 2KCNA 3RN2A 1XXGA 2NB0A 5J39A 1VQKA 2AWOA 4MTKA 4QIWB 1YNND 3TSSA 1F2MA 2Q8RE 3RD4A 4LF7Q 3GTLH 1K73C 1EEFD 1X65A 2CQAA 2EY5A 3ERSX 2UUBL 2BE5C 4RHSA 4JI3Q 1SMYD 3A8JE 1IW7D 3HOZH 5JJKA 3HFZB 2K50A 3OIQA 1PH1A 3J81c 5ELOA 4R4OA 4YY3L 2EYFA 3UE1A 1G2TA 2A68D 2HT1A 1I4XA 1VQJA 2SDFA 4AYBE 1MHWC 2EYMA 5C0XI 2PPBC 5FJ8G 1Y69U 2ZTEA 3FVQA 4QY7A 4IUQA 3T56B 2IJ0A 3I3CA 4IZ8A 1ENCA 5GQOA 1NJIC 2D2CC 3OWFA 4NPSA 1J5EL 1SYBA 1JR0D 4QF4A 4P75A 3F2DA 1TS4A 1E2VA 2Z6KC 2A8VA 1TR5A 5FO8B 2E76C 4JG2A 5T1GA 1L0WA 3W1GA 4CHTB 1PH3A 1PMRA 1QNKA 1N36Q 2ID0A 2K28A 3K8AA 3KK7A 4DV2L 1E0BA 4AQYL 2WFWA 1EL0A 2EY6A 2I07B 2ZXRA 4DR4L 2NVYB 3J7AF 4DV4Q 4RHRA 3T53B 2F0LA 3ULPA 1ESRA 3SK5A 1IYVA 4HR7B 4QUCA 3NPPA 3S1NB 3HKZE 2PZUA 1MJEA 2CH4W 5E1FA 3STBC 4LF9L 1TIID 2O5JC 5IP7H 2R6GA 2JYOA 1HCZA 3S1QH 3DUZA 4K6LA 4ULLA 1Q12A 3ER0A 1B3QA 4HJAA 1EZ6A 3I70A 1LACA 3HOYH 3PIPA 4HAEA 4H0LC 1D6EC 4YWLA 4P74A 4EQ5A 1T5XD 2B2YC 5KRUA 1NAPA 1X56A 3MEHA 1EYAA 2F0DA 4HCSA 2VQFL 1LT6D 4O0AA 1T9HA 2B2UC 1VQBA 5IGCA 4A3KH 1V1QA 4X65Q 4QUFA 3EJIA 2RCFA 1RODA 4BBSH 1S5DD 2NZ1D 1TS2A 1GUTA 4K5VA 1E3PA 3MHBA 4B3RL 1X3EA 3J81i 5I2XA 4DV3Q 1S5FD 4EQPA 2PMZB 1JOKA 2M00A 4GNXB 2Y0SE 5A2QL 2E2IH 3FDTA 2EQSA 1CKNB 5C6AA 1QG7A 4UP7A 4Z9CB 3PUXA 1WYDA 2K5QA 3NELA 4R8NA 4X62Q 4B3TQ 4L5SA 3GTKB 3ND9A 4LFBQ 2RDFA 1EY6A 1H9SB 4DR6Q 1TU2B 5M3MH 2R92H 2GN5A 2B2YA 1UE1A 1N34Q 5LMUQ 2WAQB 4RH6A 4A93G 5CV9A 4GNXC 3EN2A 5L37A 3KF8B 3PO2H 5CORA 5IGGA 1CQFA 4DV6L 2A68C 4RG1A 5HGTA 1JT8A 1NNXA 2V1CC 1N32Q 1XYIA 3KLSA 4KKUA 4C2MH 1I50H 3G7LA 3Q22A 4ILWA 1O80A 4KI0A 3H94A 4RGMA 1F77A 4XTCS 4BBRG 1VCIA 4PZ8A 2AWNA 2JA6B 1Z9FA 1U4RA 5LHY1 1JOOA 4DR6L 3RZDH 3G71A 1DYQA 3G48A 3AMUA 3PMFA 1TVXA 1SJHD 1IKLA 4JI6L 1SYFA 1PV4A 1PFMA 1TWGH 2A5HA 1K8GA 2XRQD 3HRZC 1PRTD 3KLWA 2K04A 2CKZB 3RN5A 1XPOA 1SNDA 4OONA 3MXGA 3HOZB 1RL2A 4HIKA 2K03A 4BY1G 3S17B 1WOCA 1C8CA 2EXZA 4A3JG 1A6XA 3J7A5 4RCNA 3H0GB 4IALA 1UAPA 4LW1A 2E8GA 2WKCA 2B2TC 1RHPA 1VS0A 2BOSA 2RDGA 1VF5C 3OMCA 4IUNA 4KLKA 1L1OB 3K7AH 4PQXA 3TZDA 3U9SA 1P16A 3MVVA 2UUCQ 4DV6Q 1QUQA 2HIXA 3G6JB 3EROA 3TQYA 4IFDH 2EXDA 3SEBA 4RFBA 5DM73 5IODA 3CCSA 4KKSA 5I6WA 4LF8L 3MFYA 3K58A 1JWUD 4K8JA 4K2LA 1CK1A 1IBLQ 2IL8A 2K5NA 1DXMA 4FVMA 5DLQE 1SYGA 3KOJA 4JYAL 3CRLC 1TWHH 4N9TA 1R4PB 3W1BA 3HG9A 3U58A 1SN8A 2XN9C 1IBKQ 1U9RA 1N33Q 4CGYB 1Q8IA 1KLGD 2VL6A 1I94L 1F9PA 3BVGA 1KDAA 2L12A 5A2QE 2DNEA 3T1HL 2PMZE 1X32A 2ZM6Q 5I9OA 4KMUC 4OXPA 4C2MB 2NVQH 1UNSA 1JICA 2B8GA 4A3GH 4OX9Q 4DR1Q 1X6OA 2XWBB 4Y7NB 1J6QA 2BDOA 1IYJB 2WB1G 4O2DA 4LF6Q 4JI2Q 3ZYYX 1K28A 1HNWL 1FR3A 1EWHA 1JJCB 3W2DA 5C3EB 3CMEA 4JI0Q 2B2UA 2VZAA 5CR3A 3MFGA 2O4XA 5KNDA 1N8RC 4X3SA 3M4PA 3F8TA 1XMOQ 4DPGA 3IRBA 4DK0A 3CCJA 4JV5Q 3J7ZC 3H3VI 5ISRA 4DUZL 3CC2A 2UUCL 1Y1WG 1QE6A 1HNXL 1SMXA 3CW2C 2G9HD 5C3EG 3GTQB 3P20A 1D5MC 4I7ZC 5M3FH 2R93H 4APVA 3EBEA 2AHOB 4TRDA 4BA2I 3NTHA 1PYWD 3L0OA 1UWVA 1PRTC 4I7AA 3KLRA 1MD2D 3H6MA 5EQ0A 4GS3A 4C3IH 2PZTA 3SDZA 1AN8A 4M8AA 3QOJA 5EPJA 1W6JA 4TVAB 1PTOB 1N34L 1RTOA 2NVYH 4KK7A 4GOPC 2X69A 5EBCA 1DGSA 1CT1D 3FKIH 5IYCG 1E1OA 2JSOA 3FP9A 5IP9G 1VQLA 1EU4A 5BN4A 1AH9A 3DWAA 1CZWA 2RVLA 3TZUA 4BA1I 4ZUJA 4JI7Q 3LWEA 2RA4A 2IHEA 1XPUA 3M3YH 4G7ZC 5M5YH 1PTOC 4RAUC 3AEVA 4YCWA 3T16A 3VR4A 1HNZL 2LFNA 3CP0A 3CQZH 2DUDA 2MGSA 5DM63 2UXDL 1Y1VG 3NQTA 3M85A 4LNQA 4IUVA 1GHJA 4QQBX 4Y7NH 3H09A 1I4RA 5CBEE 5EAYA 2F0WA 1FNVA 2FJ2A 3I4OA 2B2VC 1HJPA 4K6DA 1C4QA 2HHHQ 2HHHL 1NMFA 2YYZA 1VQ7A 1JCKB 5FLMG 1JQYD 1NBWA 1EY9A 2GVAA 2BH8A 1DD2A 4R4IA 1X55A 1A2UA 2I5MX 4A3EH 1SE3A 1EFWA 1YHBA 4QJFA 3E9HA 3QJYA 3CU7A 5HURA 2IX1A 1IXRA 1VQDA 2B2WC 1EOVA 1FYCA 1ASYA 3RLFA 5J3BA 1NTGA 5G3LD 2B63B 2XIWA 3I90A 2FINB 4P73A 4GLAC 2CVRA 2Z6KA 3S14B 3ND8A 1V9PA 1B44D 1Y14B 3UE0A 1WJJA 2BA1A 3GTGH 1JMCA 1HPCA 4QIWE 2DY7A 2C5CA 4PV1C 1Q81C 4A93B 2A6EC 3PF4A 5HY6A 2NVXH 2ZJRA 1TQOA 1N32L 4PMCA 4MNOA 2JA6H 2PQAB 3CC7A 1PTOD 3KDFB 4J8QA 4LF4Q 5KYLA 3QIAA 1MI2A 2AQ3B 3HEJA 4JI1Q 3IFDA 1EOTA 1Y1VB 2E2HB 1YZ6A 1JJGA 1SAPA 3S2HH 3DWPA 4GN5A 2JA5B 4DV0L 1D1KA 2BCOA 4M1UB 4FF1A 1N36L 1ASZA 1QJOA 4TQUS 5CGKA 2JA5H 5FLXE 4XQQA 1IL2A 2RDHA 4Y52H 3ULJA 3H0GG 1ONLA 1PH7A 1PXUA 2OT2A 2Z4HA 4PMWA 2RQXA 1LM0A 4IOCA 4DNTB 5FLMH 1BR9A 3MXNB 2Y0SG 2Z8LA 5C4XG 2ICEC 1HNXQ 3VA5A 5EKKA 2M2LA 1Q1EA 5DNFA 1K8AC 5JEAJ 2QW7A 4A3IH 3NBHB 3GP7A 2F0KA 3TEHB 4DR2Q 1CZGA 3M4QA 2JA8H 2M9VA 5GADC 2F4VL 4AYBB 5IGBA 2JEBI 4IUUA 3LX0A 1I6HB 2K6AA 4LF5Q 4V190 5C44H 4K5XA 1PTOF 3W3AA 1HQMC 4XYQA 2KJXA 4NMZA 3URYA 2WKDA 2Q2HA 3CCMA 4CDFC 1ICFB 2IWHA 4AYBG 1PZJD 4BY1H 1Q8KA 1BXTA 4DXFA 2AQ2B 1VQEA 1WFQA 5IP9H 1MIUA 2Z6BA 2FFKB 3K6OA 1TWAH 4C3IG 4H13C 4FP5D 5C4ZA 5K5PA 3K5NA 1PRTB 2K05A 2B39A 1O7ZA 2F0SA 5FLXL 1TWAB 1HA6A 5COYA 1V1PA 1IHZA 1BUVT 4IOAA 2Z4IA 4LFBL 4A3MG 1KTKA 3DM1A 4JBMA 3JAMi 1GKHA 3GTJB 1OXSC 3HP3A 5I6YA 3K7AB 5FJ8H 1FNWA 3K0YA 4DV5Q 1D5ZC 3AFQA 5LMUL 4YHHQ 2RBMA 3A7LA 4ZYSA 2H1EA 4DV7L 2EYLA 2PYKA 2EOTA 1Y8OB 5I2YA 4PG3A 2HIVA 4G7OC 2E5LL 2BH2A 1IYUA 1SBBB 5HGQA 4A3LH 2L4NA 3RR5A 3CCLA 3KJPA 2N8NA 2L9HA 1R4QB 4KHVA 2GVBA 4C3JG 4FO2A 4HIMA 1SEBD 1L0YB 4K0KQ 2K5VA 1LTGD 1A3VA 2D0OA 3PO2G 2A6HD 4S3SA 1HTLD 1L0XB 3VR2A 1WD1A 2AKWB 1FVIA 4JC0A 4NP5A 4K2KA 1EQVA 3A8KE 2CQOA 3AU7A 2RSNA 4CDCC 4TKOB 4WORA 4DAMA 4L5RC 1CI3M 1F9QA 2JA8B 1B9MA 3A8IE 5CV6A 1JE4A 4A3FH 5G3LF 1I6HH 3S15H 2NTSA 4TSSA 1FJGQ 3GTOH 1LYLA 1Q82C 2JA7H 1JJ2A 5JJLA 4NXML 2UU9Q 5AFWA 1EY0A 1E7ZA 5KYIA 1A0IA 2PZWA 4FXGC 4DR4Q 5FLXc 5IYBG 5EBDA 2R7DA 2A6ED 4K14A 1LTTD 4GOPB 1Y8PB 1HHVA 1EZ8A 2FMMA 1SE8A 4KN4C 1SYEA 3T51B 1H95A 1VQMA 3HKSA 1EEID 3KJOA 1J5EQ 4JI7L 4O1NA 1H9JA 1M8AA 2QA4A 3P7JA 1U4MA 3RLOA 1Q7YC 2PO4A 1B50A 3NE5B 2WP8J 4ZKCB 3NWSA 1RD9D 5CV5A 3NTKA 4YY3Q 3I4MG 3NWTA 4X62L 4B3TL 3R2TA 2JA7G 1LTID 1NCVA 1I4GA 3NHHA 1KDCA 2UUBQ 2I5HA 3A5UA 2BE5D 5IGEA 2K32A 4B08A 1EY4A 3JAME 1PH2A 5M5WH 1IBLL 3FKIB 1Y1WB 3H3VC 1PLFA 2I0QA 1U4LA 4A3BB 4GLXA 2VQFQ 4JW0A 1STAA 2LSSA 4DNIA 4JVZA 1UE6A 5C5LA 1J8IA 1TKWB 2E74C 4LK1C 2N49A 2YU9B 1NR2A 1LTBD 1LLRD 2JJQA 1HTPA 1I3QH 3J81j 3J80L 2KUMA 1WCMG 3VA7A 4JPBW 3U50C 1GVPA 5LMNL 4XQNA 4KY6A 1HR0L 3TRZA 1Q46A 1TS5A 1A3UA 3RZOH 4XT1B 4DF7A 5IYDH 2IY5B 4UY8C 3D4DA 4IPGA 3A55A 3GDEA 3J80c 2BDNA 4R8IA 4A3MH 5EKLA 5C3WA 4LF6L 4F87A 1TWGB 4C3JH 2KQ3A 1CA6A 5KNCA 3A74A 2VS1A 5E4WC 1PH4A 5JEAH 2H4OA 2D5DA 1GUGA 2UXCL 4JOIA 3HOUB 1WTXA 1WTPA 5IE8A 5M3MG 3X3MA 5GAGC 2OQ0A 2VQEL 1X54A 1RF2D 5LMNQ 1QILA 3EFXD 2F0JA 1EY7A 5IWAQ 1V1OA 1AZPA 4B9XA 1EQRA 2XRSD 1DOLA 1DOKA 2CHBD 3FHWA 1I94Q 4LFCQ 4DAYA 1WD0A 2X6LA 4OEMB 2B63G 3BVZA 4NXNQ 1YNXA 1PYBA 4MN3A 5CV4A 4A75A 2VUMG 4DV1L 5JOBA 3S16H 2KOLA 1PHJA 2KCTA 2AQ1B 4I65A 1B3AA 3IKJA 2OWOA 2F0FA 1VQPA 3V05A 2HQEA 3S15B 2L55A 2L11A 3K5MA 4AIMA 4LF4L 2G9DA 2F03A 1GUSA 2SNMA 3DMUA 1QWYA 1SXTA 1MBYA 3VDYA 4HJ9A 2VUMH 5C4HA 2DGYA 4JOIC 3BS1A 2ZXOA 1UUPA 1N9WA 4DUZQ 2KHIA 2HQLA 3HS0C 3UDXA 1A62A 2AUJD 4KHZA 5JVH3 4A3JH 3NENA 2OTJA 1O7LA 3PSIA
chains in the Genus database with same CATH topology
2A73B 2OXPA 2IX3A 1WTWA 4DAVA 1AZQA 1H9MA 1LTAD 3SHLA 1SE2A 2CW0D 1S5CD 1SDFA 1BBXC 2DNCA 1FGBD 1QNUA 2K01A 4C1NI 3R8BA 1EIGA 1IL8A 4UAIA 4KY7A 3Q24A 3M7GA 3S2DB 2NYZD 3PUYA 1QB5D 1LT4D 5EKIA 3Q6SA 5E3FA 3VYUA 5CYUA 2FHTA 1G91A 2EZVA 3BDCA 5ELBA 3DEOA 3ITPA 3C1FA 4C1NK 5CBAE 3CHBD 1QCBD 5DAUA 1DM0B 2EJMA 3R2IA 5C4JB 5IGFA 2N55A 1V1PB 3KBGA 4BS9A 1JWMD 4HSPA 2MPMA 1VMPA 1EQTA 1YNJD 3GV3A 2F0VA 2L5TA 4NKLA 2PW5A 3MA2B 1DONA 4ZQ3A 4Q5VA 2EYOA 1HRJA 3J7AV 4LJZC 4ZRZA 2E2IB 4CKEA 1NUCA 2PNRC 2ENBA 2L1BA 4QCLA 2EVBA 3WOFA 5LL6S 4OIKA 5IIFA 1Q90A 5M3MB 4NW2A 4G7HC 1KABA 2AUKA 2HDLA 3OPOA 2VXWA 5C0XJ 2XNAC 3HGBA 3QOLA 4R9WA 1A15A 3I4NB 3MWYW 4F88A 2NWGA 2EY1A 4KKTA 1SNPA 2IW3A 1EY5A 2B2TA 1Q3LA 5C44B 3I72A 3L9AX 4RKBA 2HUGA 4A3JB 1EIHA 3AB9A 3J80E 2VB2X 4CKBA 1JC7A 5K36G 2F0HA 3BVMA 3L7ZC 3NBIA 3Q0AA 1RTNA 2K5WA 1CQVA 4HTHA 4HEDA 2KA7A 1KDBA 1VF7A 1K8OA 1HXYD 3HZXA 4XIGS 4PNYA 3P75A 1KAAA 3O13A 5JEAG 1CFMA 1ZKOA 4KY5A 4X3TA 2V4DA 1ZEQX 1S4ZA 2J7ZA 2KECA 3KLSX 4A3EB 2NVTB 1LO5D 4OO1I 3T4AC 1A3TA 3NUCA 1OXTA 1HQRD 2NTTA 3ONAB 1KNAA 2B2WA 5ELCA 1F2LA 5KIXA 4F8MA 5DEHA 4U673 5M5XB 4IURA 1I4HA 1IW7C 1M4VA 3R3OA 1STHA 2X6GA 4IFDG 1DZ1A 4P2CB 3NBHA 1RCVD 1BCPC 4PMBA 5FO9B 1R9TB 3J81L 1AEXA 1WTRA 1G6ZA 5JPMC 4ZUIA 3CRKC 3F2UA 4QMGA 4HCEA 1O7YA 5TSSA 2Q8IB 1II3A 4RA8A 2SOBA 2PCFB 2C9OA 3C2PA 4FXDA 2O5IC 3NP8A 1TS3A 3S9WA 1LABA 4C3HG 2D62A 3BZDB 2F0GA 2QCPX 4DGZA 3NXWA 5JJZA 5LL6X 3GTGB 1PFNA 5M3FB 2R93B 1ICWA 1H9KA 2EJGC 5FKAC 1T5EA 2F0PA 4A3GB 3GD7A 2NVXB 2LMCB 3FPPA 3HOWB 4U68A 3OSOA 2E2DC 1SSOA 3E6ZX 3GO5A 1GJXA 5IOCA 5ELDA 3QWNA 1YNJC 3PUWA 4ID6A 1SFOB 4ZKBB 1CA5A 4RCOA 4IUTA 1SNOA 4CJ1B 4DA2A 3NTIA 2JXMB 4ZK9B 4DAPA 1ESFA 2JEAI 3BDLA 1STGA 1W6KA 3TP7A 3RZDB 2LY7A 4J6HA 1PZKD 3M4OB 1SMYC 5ELFA 3H91A 3I4LA 3E0JA 4E6IA 3K59A 4CJ2C 3SVMA 5M5YB 2Y0SB 3VR5A 5M5WB 1WTQA 4XT3B 2R92B 4H7BA 4KN7C 3D31A 4HMJA 2ZT9C 1K8MA 2WINB 4RWSC 3E5SA 4MIUA 4ODGA 3LNNA 2NN6I 4FF3A 2Q8TA 2KEEA 1D1IA 3I4MB 3HOXB 3A56A 1HFNA 2PW7A 3S1QB 1TWHB 1LT3D 2XWJB 4IQZA 4RKLA 4RGOS 4Q0FA 4OL7A 1HUMA 3N6RA 3A54A 5NUCA 2F0TA 3S1RB 2DN8A 1NR4A 2MHVA 1EU3A 3S1MB 2LKVA 4H44C 2ZXPA 2K7VA 1F2ZA 1SJED 2N88A 1F9SA 3V2TA 1B2TA 3RZOB 3VR6A 3D4WA 3IFTA 3SK6A 1E2ZA 1DOMA 4ME5A 4RGNA 2R61A 1QOHA 1ILPA 1EWCA 2MUYA 5FO7B 2A74C 3SXHA 1ZXTA 4JK1C 5I4DA 3DHQA 4IFDI 1EYCA 2EJFC 4J1MA 1PZID 1CHPD 2WV6D 5D3IB 2QF7A 4OO1H 1EY8A 1XTCD 3C1EA 3FMCA 5K36H 1SYDA 1E2WA 1WCMB 1EYDA 4DK1A 3HOVB 3IL8A 4ABNA 2TSSA 4A3IB 5F2DA 3S16B 3CKIB 1STEA 1NSNS 3MXUA 4B9WA 1LTSD 4UDUC 1G2SA 1G291 2EYJA 4C56C 1AP0A 1GUNA 1TT2A 4BY1B 3U9OA 2JA7B 1JORA 4BBSB 3D4RA 4FF2A 2F0NA 4IN3A 3OMGA 3PUVA 3QG1A 4XXEA 2KVMA 3PIO3 3K5OA 3FEWX 3TDQA 1XX8A 1OXUA 4N9PA 4C3HB 3I8ZA 1CM9A 2SEBD 3J81E 1DCZA 5D65A 3KF8A 2KHSA 2QKIC 2F4IA 4WRDA 4HSVA 2WACA 3K57A 3FPUB 1BDOA 1V43A 2F3VA 4OIJA 3IAYA 1ZYRC 2MJ8A 1J9OA 2J0TD 1O78A 4YIJA 1B1ZA 3C46A 3TP5A 1XWEA 1I4PA 4WFN3 1X3PA 3GV6A 3WOEA 3HOYB 1STBA 3D3RA 3RMHA 5IGDA 5EGTA 3SR1A 5KEEA 1HUNA 4LMQD 2GA4B 5C0XH 3M7NA 2VNUD 1GUWA 1PFBA 4V0BA 4K5WA 1S5BD 2B8FA 1Z7TA 2EE1A 2QILA 1TWCB 4L6TB 1IKMA 5EJWA 1I6VC 3S2HB 5BN3A 4NDXA 3OW7A 2DY8A 4FF4A 2PQEA 4JBWA 4K8IA 5KNBA 4QB4A 2NN6H 1LTRD 5C0XG 1ZYRD 4ZAIA 2F0MA 4EQNA 5CMDA 2JE6I 3I91A 1SE4A 3BG3A 2OEOA 3EA6A 4X3UA 1UEAB 3TBIB 2EDGA 1RJTA 2QEJC 1VMCA 1ENAA 1ILQA 3DEPA 3MAQA 3OWEB 3KBXA 5EPKA 5EPLA 4DU9A 3MXPA 1OXXK 1Y8NB 1MSGA 2EYHA 1F2YA 3I73A 2VUMB 1B9NA 1TY2A 4MHEA 5C4XB 3M3YB 1I4QA 3VYTA 3BYYB 3PV0A 3DXJC 3VYRA 2MP1A 3CQZB 1K83B 1ET6A 5ELEA 4CBVA 4O42A 3MTSA 3SE0A 3A7AB 3N52A 1GXDC 3PO3B 4IUPA 5JPNC 2J4XA 4L8JA 1MSHA 2HDMA 1HFGA 5E4XA 3DWQA 1AW7A 3J7YW 1BQQT 4HMIA 1MGSA 4OHJA 4C3IB 5IT9L 3D6CA 2F0QA 5KGUA 4EQOA 1X3QA 4L63B 1B4OA 1RDPD 4BBRB 4DFAA 4X3KA 1KNEA 1I3QB 2EPBA 5D3DA 3L3OC 1OO9B 1TY0A 3X3NA 2HCCA 3GTPB 4RGTA 3VR3A 3M4YA 1GHKA 2K1BA 1BCPD 2FMCA 5FK9C 2E75C 4C3JB 2I46A 4GZYC 1B53A 1H9SA 5A35A 3T13A 1LT5D 4ZLTF 5I9PA 2CW0C 3OIPA 4EVOA 2K33A 5D14A 3BDOA 3V96A 3PIP3 1SNCA 4KD3A 3D8GA 1RKNA 2F0EA 4XYOA 2L0CA 1H9RA 1VDZA 4KTAA 1Z47A 3Q23A 1CHQD 5CV7A 1CTMA 1TWFB 2F0IA 1PTOH 4BWGB 5J1ZA 2K5DA 2O2LD 3WDNA 2IPKD 2IT1A 3TN2A 2BA0A 1G8ZD 3EVQA 2KEDA 1STNA 1BCPF 3OHXC 2OF1A 1Q1BA 5JAVA 3MXNA 1EFID 3EQLC 2B2VA 3JAML 1PDQA 1Z6HA 5BN5A 5CC4A 2EYPA 3SK4A 2F0OA 1F9RA 3GTLB 1BNZA 1SYCA 3ERQA 3R93A 1OXVA 1PRTF 3TP6A 2EY2A 4KV6A 4KD4A 2NBFA 3HKZB 2NUCA 3NQIA 4FXKC 2F0UA 3UI2A 3VYSA 4A3MB 4HN7A 3K5LA 3BYTB 2VB3X 4OO1G 3GQBA 1BOSA 4OGQC 1FD7D 2R3ZA 1HA5A 4G57A 1S5ED 2TMPA 5C3XA 1I50B 1U4PA 3NK9A 1SNMA 3LWUA 2A6HC 1WTVA 3MC0B 4CJ0B 5C5MA 3OOCA 1GUOA 1DJRD 1KLUD 1JOQA 1GOZA 4A3KB 1D2BA 4DNRB 3P1HA 2WIIB 4KJNA 1BO0A 4XDXA 1STYA 4KJOA 2LS01 2ICIA 2D9UA 1JB3A 4A3FB 3TMEA 1SNQA 1ENFA 2A69C 1C48A 5FOBB 4DXGA 2JP1A 2XVSA 1AFPA 1BF4A 2E2JB 5J22A 3NSWA 4DN4M 3QB3A 1WVLA 3FRPB 1V8QA 5CV8A 2F3WA 3KUPA 2HCIA 3PUZA 3GTMB 1A2TA 2A69D 2SNSA 4WJWA 1D5XC 3QO2A 2F1MA 3C3LA 2RKSA 3PO2B 2XSCA 1YNNC 4CKCA 2R7ZB 1BCPB 3MZ5A 5M9OA 1LV9A 4A3DB 4F7XA 1JWSD 2NN6G 1ML0D 4XQJA 4BY7B 4FNFA 5T1IA 4FYDA 4IFDJ 5IT9E 2WB1B 2RSOA 3RUZA 4LAAA 2NVQB 4G4KA 3GTOB 2KCCA 5JVG3 3TP8A 2IX0A 3SK8A 2Z1CA 1FNUA 1WTOA 3D6WA 1ET9A 2QDBA 4EGVA 2KCNA 1XXGA 2NB0A 5J39A 2AWOA 4QIWB 1YNND 3TSSA 1F2MA 2Q8RE 3RD4A 1EEFD 2CQAA 2EY5A 2BE5C 4RHSA 1SMYD 3A8JE 1IW7D 3OIQA 2EYFA 1G2TA 2A68D 1I4XA 2SDFA 2EYMA 5C0XI 2PPBC 1Y69U 3FVQA 4IUQA 3T56B 2IJ0A 3I3CA 4IZ8A 1ENCA 2D2CC 3OWFA 1SYBA 1JR0D 4QF4A 1TS4A 1E2VA 1TR5A 5FO8B 2E76C 5T1GA 4CHTB 1PMRA 1QNKA 2ID0A 2K28A 3KK7A 1E0BA 1EL0A 2EY6A 2I07B 2ZXRA 2NVYB 3J7AF 4RHRA 3T53B 2F0LA 1ESRA 3SK5A 1IYVA 4HR7B 4QUCA 3NPPA 3S1NB 2PZUA 5E1FA 2O5JC 1TIID 2R6GA 2JYOA 1HCZA 3DUZA 4K6LA 4ULLA 1Q12A 1EZ6A 3I70A 1LACA 4HAEA 4H0LC 1D6EC 1T5XD 2B2YC 5KRUA 1NAPA 3MEHA 1EYAA 2F0DA 4HCSA 1LT6D 2B2UC 5IGCA 4QUFA 3EJIA 1RODA 1S5DD 2NZ1D 1TS2A 1GUTA 4K5VA 3MHBA 5I2XA 1S5FD 4EQPA 2PMZB 1JOKA 2M00A 5A2QL 3FDTA 5C6AA 1QG7A 4Z9CB 3PUXA 4R8NA 2K5QA 3GTKB 3ND9A 2RDFA 1EY6A 1H9SB 1TU2B 2B2YA 2WAQB 4RH6A 5CV9A 5CORA 5IGGA 1CQFA 2A68C 5HGTA 1XYIA 3KLSA 4KKUA 3G7LA 3Q22A 4ILWA 1O80A 4KI0A 3H94A 4RGMA 1F77A 4XTCS 1VCIA 2AWNA 2JA6B 5LHY1 1U4RA 1JOOA 1DYQA 3AMUA 3PMFA 1TVXA 1SJHD 1IKLA 1SYFA 1PFMA 2A5HA 2XRQD 3HRZC 1PRTD 2K04A 1SNDA 3MXGA 3HOZB 2K03A 3S17B 1C8CA 2EXZA 1A6XA 4RCNA 3H0GB 4IALA 1UAPA 2WKCA 2B2TC 1RHPA 2BOSA 2RDGA 1VF5C 3OMCA 4IUNA 4PQXA 3TZDA 3U9SA 3MVVA 3G6JB 3EROA 4IFDH 3SEBA 4RFBA 5DM73 5IODA 4KKSA 5I6WA 3MFYA 3K58A 1JWUD 4K8JA 4K2LA 1CK1A 2IL8A 1DXMA 4FVMA 1SYGA 3CRLC 4N9TA 1R4PB 3HG9A 2XN9C 1U9RA 4CGYB 1Q8IA 1KLGD 1F9PA 3BVGA 1KDAA 2L12A 5A2QE 2DNEA 1X32A 5I9OA 4KMUC 4C2MB 1UNSA 1JICA 2B8GA 2XWBB 4Y7NB 2BDOA 3ZYYX 1FR3A 1EWHA 3W2DA 5C3EB 2B2UA 5CR3A 3MFGA 2O4XA 5KNDA 4X3SA 4DK0A 5ISRA 1QE6A 2G9HD 3GTQB 3P20A 1D5MC 4I7ZC 4BA2I 4TRDA 3NTHA 1PYWD 1PRTC 3KLRA 1MD2D 3H6MA 5EQ0A 2PZTA 3SDZA 1AN8A 5EPJA 4M8AA 3QOJA 1W6JA 1PTOB 1RTOA 4KK7A 2X69A 5EBCA 1CT1D 2JSOA 1EU4A 5BN4A 3DWAA 1CZWA 2RVLA 3TZUA 4BA1I 4ZUJA 3LWEA 2RA4A 4G7ZC 1PTOC 4RAUC 3T16A 3VR4A 2LFNA 2MGSA 5DM63 3NQTA 3M85A 4IUVA 1GHJA 3H09A 1I4RA 5CBEE 2F0WA 1FNVA 2FJ2A 2B2VC 4K6DA 1C4QA 2YYZA 1JCKB 1JQYD 1EY9A 1DD2A 1A2UA 1SE3A 3QJYA 3CU7A 5HURA 2IX1A 2B2WC 1FYCA 3RLFA 5G3LD 2B63B 2XIWA 3I90A 2FINB 2CVRA 3S14B 3ND8A 1B44D 2BA1A 1HPCA 2DY7A 2C5CA 4PV1C 4A93B 2A6EC 1TQOA 4PMCA 1PTOD 4J8QA 5KYLA 3QIAA 1MI2A 2AQ3B 3HEJA 3IFDA 1EOTA 1Y1VB 2E2HB 1SAPA 3DWPA 2JA5B 1D1KA 2BCOA 4M1UB 4FF1A 1QJOA 4TQUS 5CGKA 5FLXE 4XQQA 2RDHA 1ONLA 1PXUA 2OT2A 2Z4HA 4PMWA 2RQXA 4DNTB 1BR9A 2Z8LA 2ICEC 3VA5A 5EKKA 2M2LA 1Q1EA 5DNFA 5JEAJ 3GP7A 2F0KA 1CZGA 2M9VA 4AYBB 5IGBA 2JEBI 4IUUA 3LX0A 1I6HB 2K6AA 4V190 4K5XA 1PTOF 3W3AA 1HQMC 4XYQA 2KJXA 4NMZA 3URYA 2WKDA 2IWHA 1PZJD 1BXTA 4DXFA 2AQ2B 2FFKB 4C3IG 3K6OA 5K5PA 4H13C 4FP5D 5C4ZA 3K5NA 1PRTB 2K05A 2B39A 1O7ZA 2F0SA 5FLXL 1TWAB 1HA6A 5COYA 1V1PA 1IHZA 1BUVT 2Z4IA 1KTKA 3DM1A 3GTJB 1OXSC 3HP3A 5I6YA 3K7AB 1FNWA 3K0YA 1D5ZC 2RBMA 3A7LA 4ZYSA 2H1EA 2EYLA 2PYKA 2EOTA 1Y8OB 5I2YA 4G7OC 1IYUA 1SBBB 2L4NA 2L9HA 1R4QB 4KHVA 4C3JG 4FO2A 1SEBD 1L0YB 1LTGD 1A3VA 2A6HD 4S3SA 1HTLD 1L0XB 3VR2A 1WD1A 4NP5A 4K2KA 1EQVA 3A8KE 3AU7A 2RSNA 4TKOB 4WORA 1CI3M 1F9QA 2JA8B 1B9MA 3A8IE 5CV6A 1JE4A 5G3LF 2NTSA 4TSSA 5AFWA 1EY0A 5KYIA 2PZWA 4FXGC 5EBDA 2A6ED 4K14A 1LTTD 1Y8PB 1HHVA 1EZ8A 2FMMA 4KN4C 1SYEA 3T51B 1EEID 4O1NA 1H9JA 1M8AA 3P7JA 1U4MA 2PO4A 1B50A 3NE5B 2WP8J 4ZKCB 3NWSA 1RD9D 5CV5A 3NTKA 3NWTA 3R2TA 1LTID 1NCVA 1I4GA 3NHHA 1KDCA 2BE5D 5IGEA 2K32A 4B08A 1EY4A 3JAME 3FKIB 1Y1WB 3H3VC 1PLFA 1U4LA 4A3BB 1STAA 5C5LA 1J8IA 1TKWB 2E74C 4LK1C 2YU9B 1NR2A 1LTBD 1LLRD 1HTPA 3J80L 2KUMA 3VA7A 4XQNA 4KY6A 1TS5A 1A3UA 4XT1B 4DF7A 3D4DA 3A55A 2BDNA 4R8IA 5EKLA 5C3WA 4F87A 1TWGB 2KQ3A 1CA6A 5KNCA 5E4WC 5JEAH 2H4OA 2D5DA 1GUGA 3HOUB 1WTXA 1WTPA 3X3MA 1RF2D 1QILA 3EFXD 2F0JA 1EY7A 1V1OA 1AZPA 4B9XA 2XRSD 1DOLA 1DOKA 2CHBD 4DAYA 1WD0A 2X6LA 3BVZA 4MN3A 5CV4A 5JOBA 2KOLA 2AQ1B 4I65A 1B3AA 3IKJA 2F0FA 3V05A 2HQEA 3S15B 2L55A 2L11A 3K5MA 2G9DA 2F03A 1GUSA 2SNMA 3DMUA 1QWYA 1SXTA 1MBYA 5C4HA 3BS1A 2ZXOA 1UUPA 3HS0C 2AUJD 4KHZA 5JVH3 1O7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2Y A;  5I2X A;  2I46 A;  2M9V A; 
#chains in the Genus database with same CATH topology
 2A73 B;  1FGU A;  2OTL A;  2OXP A;  4L5Q A;  2IX3 A;  2RHQ B;  4B3S Q;  1WTW A;  3AYH B;  1I5F A;  4DAV A;  3AFP A;  1H9M A;  1LTA D;  1AZQ A;  4DK6 C;  3PCO B;  4JI4 L;  3SHL A;  1YJ9 A;  1E1T A;  1SE2 A;  2UU9 L;  4JI5 Q;  1HZ9 A;  2CW0 D;  1S5C D;  1SDF A;  1BBX C;  2DNC A;  1FGB D;  1QNU A;  2K01 A;  4C1N I;  3R8B A;  1EIG A;  1IL8 A;  4UAI A;  4KY7 A;  3Q24 A;  3M7G A;  3S2D B;  2NYZ D;  3CPF A;  3PUY A;  2UUA Q;  1QB5 D;  4JBJ A;  1LT4 D;  5EKI A;  3Q6S A;  5E3F A;  3VYU A;  5CYU A;  2FHT A;  1G91 A;  2EZV A;  1LTL A;  3BDC A;  4P71 A;  5ELB A;  2QDL A;  3DEO A;  3ITP A;  3CCV A;  3S1N H;  3C1F A;  4C1N K;  5CBA E;  4DV0 Q;  3TS2 A;  1EYG A;  2NZO A;  3CHB D;  1YHQ A;  3QR8 A;  1QCB D;  4IJL A;  5DAU A;  1M90 C;  1DM0 B;  2EJM A;  3R2I A;  5C4J B;  5IGF A;  2N55 A;  1V1P B;  3KBG A;  1KAW A;  4BS9 A;  5C4J H;  2UXB Q;  1JWM D;  4FDB A;  4HSP A;  3CD6 A;  2MO0 A;  2MPM A;  4YCU A;  1VMP A;  1EQT A;  4BXX H;  1XNR Q;  1YNJ D;  3OTO L;  1TWC H;  1YVC A;  3GV3 A;  1LUZ A;  3ULL A;  2F0V A;  2L5T A;  4DR2 L;  4NKL A;  2ATW A;  4HJ8 A;  1CSQ A;  2PW5 A;  1VQO A;  1K0R A;  2PI2 E;  3MA2 B;  1DON A;  4ZQ3 A;  4Q5V A;  4LF7 L;  2EYO A;  3CMA A;  1Q86 C;  2A1A A;  2FXQ A;  1HRJ A;  1GO3 E;  1WTH A;  1IBM L;  3J7A V;  4JCV E;  4LJZ C;  4ZRZ A;  2E2I B;  2KBN A;  4CKE A;  1NUC A;  2PNR C;  1D7Q A;  2ENB A;  2L1B A;  4QCL A;  2EVB A;  3WOF A;  5LL6 S;  4BY7 G;  4OIK A;  3S24 A;  5IIF A;  1KC8 C;  3A0J A;  1U0L A;  4JI0 L;  1Q90 A;  3JAM c;  5M3M B;  4NW2 A;  4G7H C;  2CWP A;  4NXN L;  1HNW Q;  1KAB A;  2AUK A;  3L2P A;  3B6Y A;  4A4I A;  5GAH C;  2HDL A;  3OPO A;  2VXW A;  5C0X J;  2XNA C;  3QOL A;  3HGB A;  1E24 A;  2YTX A;  4R9W A;  1A15 A;  4DV4 L;  3I4N B;  3MWY W;  4F88 A;  1NY4 A;  2NWG A;  2EY1 A;  4JI2 L;  4KKT A;  2MNA A;  1SNP A;  2IW3 A;  1EY5 A;  2B2T A;  3K0X A;  1Q3L A;  5C44 B;  1QZG A;  3I72 A;  3L9A X;  2RCN A;  2H5X A;  4RKB A;  1EIF A;  2ZTC A;  2I5L X;  2HUG A;  4A3J B;  4P72 A;  4ALP A;  1EIH A;  4X66 Q;  3TS0 A;  3AB9 A;  4A93 H;  3J80 E;  2VB2 X;  4UP9 A;  5BR8 Q;  4CKB A;  1EWI A;  1JC7 A;  5K36 G;  1HH2 P;  1W2B A;  2F0H A;  3BVM A;  4A3L G;  2JQO A;  3L7Z C;  3M4O H;  3NBI A;  2R92 G;  3Q0A A;  1RTN A;  2K5W A;  2DJG C;  1CQV A;  4HTH A;  4HED A;  2KA7 A;  1KDB A;  1VQ5 A;  1VF7 A;  4A3C G;  1K8O A;  1HXY D;  3HZX A;  4XIG S;  4PNY A;  3P75 A;  1KAA A;  2JA6 G;  3O13 A;  5JEA G;  1CFM A;  3GTQ H;  1ZKO A;  4KY5 A;  1B8A A;  1YBY A;  2V4D A;  1ZEQ X;  4X3T A;  4GOP A;  1S4Z A;  2J7Z A;  2KEC A;  3KLS X;  4UP8 A;  1VQC A;  1QVG A;  4DUY Q;  4A3E B;  2NVT B;  2RHS B;  3I4M H;  1LO5 D;  3CCU A;  4OO1 I;  2ASB A;  3T4A C;  3HOU G;  4DR7 L;  5GAE C;  4QGU A;  1A3T A;  3NUC A;  1OXT A;  1VQ8 A;  3I4N G;  3T1H Q;  1HQR D;  2NTT A;  3ONA B;  1KNA A;  2B2W A;  5ELC A;  1F2L A;  1P8L A;  3S14 H;  5KIX A;  4F8M A;  1MJC A;  5DEH A;  4U67 3;  3KDF A;  5M5X B;  1X3G A;  2HD3 A;  4IUR A;  2Q2U A;  3A5Z B;  1I4H A;  1IW7 C;  1M4V A;  3R3O A;  4CDD C;  1STH A;  2X6G A;  1XPR A;  4IJH A;  4IFD G;  1AE3 A;  2QGQ A;  4A3K G;  1DZ1 A;  4YWK A;  4P2C B;  2N3S A;  1RCV D;  3NBH A;  3Q8D A;  1BCP C;  4POF A;  4PMB A;  5FO9 B;  1R9T B;  4DR3 L;  1VQG A;  3J81 L;  1AEX A;  1WTR A;  1G6Z A;  5JPM C;  4ZUI A;  3CRK C;  4MZ9 A;  3PGZ A;  3F2U A;  2CWA A;  4QMG A;  4HCE A;  3E9I A;  1O7Y A;  5TSS A;  2Q8I B;  1II3 A;  3LGJ A;  5H1S E;  4RA8 A;  2SOB A;  2P5Z X;  4J15 A;  2PCF B;  3T1Y Q;  3GTK H;  2C9O A;  3C2P A;  4JBK A;  4FXD A;  3KF6 B;  2QEX A;  2O5I C;  3NP8 A;  2CH4 A;  5IT9 c;  1TS3 A;  3S9W A;  1LAB A;  4MTN A;  4C3H G;  2D62 A;  3BZD B;  1L1O A;  1YHA A;  2F0G A;  1YJW A;  2QCP X;  4DGZ A;  4N8X 1;  3NXW A;  5JJZ A;  1BVS A;  4LWC A;  5LL6 X;  3GTG B;  1PFN A;  5IYD G;  1MKH A;  5M3F B;  2R93 B;  1ICW A;  1H9K A;  4OX9 L;  2NVT H;  2B63 H;  2EJG C;  5FKA C;  1T5E A;  2F0P A;  4A3B H;  4A3G B;  3GD7 A;  2K5H A;  4YHH L;  2NVX B;  2LMC B;  3I4N H;  3FPP A;  4U68 A;  3HOW B;  3OSO A;  4B3R Q;  2E2D C;  1RIP A;  1SLJ A;  1SSO A;  3E6Z X;  3GO5 A;  1GJX A;  1L2F A;  5IOC A;  5ELD A;  5GRO A;  3QWN A;  1C0A A;  1YNJ C;  3PUW A;  1SRU A;  4ID6 A;  1SFO B;  4ZKB B;  3I56 A;  1CA5 A;  4RCO A;  4IUT A;  1HZB A;  1BBW A;  5M5X H;  1SNO A;  1QVF A;  4CJ1 B;  4DA2 A;  3NTI A;  4X64 Q;  3CCQ A;  3DM3 A;  2JXM B;  4ZK9 B;  4DAP A;  1ESF A;  2JEA I;  4LF8 Q;  2MQH A;  4X66 L;  4A3C H;  3BDL A;  2K4K A;  1STG A;  1W6K A;  2YV5 A;  3TP7 A;  3RZD B;  1XMQ L;  2LY7 A;  3S17 H;  4LF9 Q;  4B3M L;  4J6H A;  3W5O A;  1PZK D;  3M4O B;  1SMY C;  5ELF A;  1C7Y A;  3H91 A;  3I4L A;  3J80 i;  3E0J A;  1NMG A;  4E6I A;  3K59 A;  4CJ2 C;  1KD1 C;  3SVM A;  5M5Y B;  1QVC A;  2Y0S B;  3VR5 A;  2ZM6 L;  3CCE A;  4AQY Q;  5IWA L;  1YI2 A;  4WJ4 A;  1WCM H;  4HJ5 A;  1KL9 A;  5M5W B;  1S72 A;  1SRO A;  1WTQ A;  4XT3 B;  2R92 B;  4H7B A;  4KN7 C;  3KYH C;  1PH8 A;  3D31 A;  4HMJ A;  2ZT9 C;  3HOX G;  1QUQ B;  1K8M A;  2WIN B;  3I55 A;  4JYA Q;  4RWS C;  3E5S A;  4A3D G;  4MIU A;  4ODG A;  3LNN A;  4BY7 H;  1UE5 A;  3JC6 6;  2NN6 I;  4OWW B;  4FF3 A;  2Q8T A;  1S3O A;  2KEE A;  1D1I A;  3I4M B;  3HOX B;  3A56 A;  1HFN A;  3NEM A;  2PW7 A;  3S1Q B;  3BZK A;  1TWH B;  1LT3 D;  2XWJ B;  4IQZ A;  4RKL A;  4RGO S;  1G51 A;  3HOX H;  4GNX A;  1W3S A;  4Q0F A;  1KIX A;  4OL7 A;  5ELN A;  1HUM A;  1PFS A;  2LXK A;  3N6R A;  4L5T A;  3A54 A;  5NUC A;  1CKM A;  2F0T A;  2YU9 H;  3S1R B;  4IPD A;  2DN8 A;  2WAQ E;  1NR4 A;  2MHV A;  4A76 A;  1EU3 A;  3S1M B;  3RNU A;  4BBR H;  2LKV A;  4H44 C;  2ZXP A;  2YTV A;  3H15 A;  2K7V A;  1F2Z A;  3E0E A;  1SJE D;  2KCM A;  2LXJ A;  4A3I G;  2N88 A;  1F9S A;  3V2T A;  1YIT A;  3S1M H;  1B2T A;  3RZO B;  3VR6 A;  3D4W A;  4HIO A;  2B3G A;  3UDG A;  3IFT A;  3SK6 A;  1E2Z A;  1DOM A;  4ME5 A;  4CDE C;  4RGN A;  2R61 A;  1QOH A;  1ILP A;  4HJ7 A;  1EWC A;  2MUY A;  5FO7 B;  2A74 C;  3SXH A;  3PF5 A;  1ZXT A;  4JK1 C;  3H0G H;  3GTJ H;  3KFU A;  5I4D A;  1D8L A;  2R7F A;  3DHQ A;  1OTC A;  4IFD I;  1EYC A;  3RLN A;  2EJF C;  4J1M A;  4R4Q A;  4DV2 Q;  3GTM H;  2F3I A;  1PZI D;  1CHP D;  2B29 A;  2WV6 D;  5D3I B;  5C3E H;  1XNR L;  2QF7 A;  1VQ9 A;  4OO1 H;  1EY8 A;  5E7N A;  1XTC D;  3C1E A;  5M3F G;  3FMC A;  2R93 G;  5K36 H;  1SYD A;  1E2W A;  3U4V A;  1WCM B;  1EYD A;  4DK1 A;  3HOV B;  1PA6 A;  1CSP A;  3IL8 A;  4ABN A;  2TSS A;  4A3I B;  5F2D A;  1JB7 A;  2L15 A;  3CPW A;  3S16 B;  3CKI B;  4OEL B;  2ZJQ A;  3F1Z A;  1M1K C;  1STE A;  2JA9 A;  1NSN S;  3MXU A;  4B9W A;  5AJ3 L;  1LTS D;  4UDU C;  1G2S A;  2N78 A;  1G29 1;  2EYJ A;  1HR0 W;  4JI4 Q;  4C56 C;  1AP0 A;  1GUN A;  1TT2 A;  4BY1 B;  2CFM A;  3U9O A;  2JA7 B;  4UPA A;  3HKZ G;  1JOR A;  4BBS B;  2OCE A;  3HOW G;  1GM5 A;  3H3V H;  1BBU A;  1CKN A;  2F4V Q;  5AJ3 Q;  4DR3 Q;  4GKK L;  3D4R A;  2XTI A;  4FF2 A;  2F0N A;  4IN3 A;  1IBM Q;  1NE3 A;  4PZ7 A;  1EIY B;  3OMG A;  3PUV A;  3QG1 A;  1XNQ L;  4XXE A;  3CCR A;  2KVM A;  3PIO 3;  4K0K L;  3K5O A;  3FEW X;  3TDQ A;  3K81 C;  1K83 H;  1XX8 A;  1OXU A;  2OQK A;  4N9P A;  1IZ6 A;  4C3H B;  4DUY L;  3I8Z A;  3BZC A;  2E5L Q;  1CM9 A;  2SEB D;  1VQH A;  3J81 E;  1VQ4 A;  1DCZ A;  5D65 A;  3ICE A;  1X9N A;  1QZH A;  3KF8 A;  2KHS A;  2QKI C;  2F4I A;  4B3M Q;  1AE2 A;  4WRD A;  4HSV A;  2WAC A;  3K57 A;  3FPU B;  2Q2T A;  1A8V A;  1BDO A;  3PQI A;  4BXX G;  1V43 A;  1VQA A;  2F3V A;  4OIJ A;  3IAY A;  5C44 G;  2JA5 G;  4DV1 Q;  1ZYR C;  2MJ8 A;  1J9O A;  1EUJ A;  1IBK L;  2RF4 A;  2J0T D;  1O78 A;  4YIJ A;  1B1Z A;  1K0S A;  3C46 A;  3TP5 A;  1XWE A;  1I4P A;  4WFN 3;  1VQ6 A;  5JJI A;  1XTD A;  4ME3 A;  1X3P A;  2D0P A;  3GV6 A;  3WOE A;  4YWM A;  3HOY B;  4A3F G;  1UE7 A;  3UDF A;  1STB A;  4NXM Q;  3D3R A;  2WB1 E;  3RMH A;  5EGT A;  3SR1 A;  5IGD A;  2PNH A;  5KEE A;  1HUN A;  4A3B G;  4LMQ D;  1PYS B;  2GA4 B;  5C0X H;  3M7N A;  2VNU D;  1GUW A;  4GLV B;  1PFB A;  4V0B A;  4K5W A;  4GKJ L;  1S5B D;  2B8F A;  1Z7T A;  2EE1 A;  2QIL A;  4JV5 L;  1KRT A;  1TWC B;  1PH6 A;  4POG A;  4L6T B;  1IKM A;  5EJW A;  1E22 A;  2E2H H;  1I6V C;  1B7Y B;  3S2H B;  2AMC B;  5BN3 A;  4NDX A;  1K3B C;  3OW7 A;  2DY8 A;  4N8F A;  1WI5 A;  2PQE A;  4JBW A;  4DR1 L;  4FF4 A;  4K8I A;  5KNB A;  4QB4 A;  3CF5 A;  2R7Z G;  3D0F A;  2NN6 H;  2ALY B;  3STB D;  1KQS A;  4UHV A;  3S2D H;  1LTR D;  3WWV A;  5C0X G;  4DR5 L;  4EX5 A;  1ZYR D;  1N33 L;  4ZAI A;  2F0M A;  4EQN A;  5CMD A;  2JE6 I;  3I91 A;  3I2Z A;  3U4Z A;  3F2C A;  1SE4 A;  3BG3 A;  2OEO A;  3EA6 A;  4X3U A;  1UEA B;  3TBI B;  2EDG A;  1RJT A;  3PIO A;  2QEJ C;  1VMC A;  1ENA A;  1ILQ A;  4YCV A;  3DEP A;  3MAQ A;  3OWE B;  2NZH A;  3KBX A;  5EPK A;  5EPL A;  4DU9 A;  3MXP A;  3OTO Q;  1OXX K;  1Y8N B;  2MFI A;  1MSG A;  4A3D H;  2EYH A;  1F2Y A;  3I73 A;  1PH5 A;  4OWX B;  2VUM B;  4LFC L;  1B9N A;  1TY2 A;  4MHE A;  3CXC A;  5C4X B;  4DV3 L;  3M3Y B;  1I4Q A;  3PO3 G;  2Z0S A;  3VYT A;  3BYY B;  5C4X H;  3PV0 A;  3DXJ C;  1B70 B;  3VYR A;  2MP1 A;  3CQZ B;  1K83 B;  1ET6 A;  2K14 A;  1K9M C;  5ELE A;  4CBV A;  1BKB A;  2UXC Q;  4O42 A;  3MTS A;  3K80 C;  4JI3 L;  3SE0 A;  1KXL A;  1X3F A;  3A7A B;  3N52 A;  1GXD C;  3PO3 B;  4IUP A;  5JPN C;  2Z9H A;  2UXB L;  2G5D A;  2J4X A;  4L8J A;  2XGT A;  1MSH A;  2HDM A;  1HFG A;  2PI2 A;  5E4X A;  4JI5 L;  3DWQ A;  2R7Z H;  1AW7 A;  3J7Y W;  1BQQ T;  1XMO L;  4NB3 A;  4HMI A;  1MGS A;  4OHJ A;  4C3I B;  5IT9 L;  3D6C A;  2DJF C;  2F0Q A;  5KGU A;  3MEF A;  4EQO A;  4JI1 L;  4LUO A;  1TXY A;  1EQQ A;  1X3Q A;  1U5K A;  4L63 B;  3ZJY C;  1B4O A;  1RDP D;  4OWT B;  4BBR B;  1GD7 A;  4DFA A;  5IY0 A;  4X3K A;  1KNE A;  1I3Q B;  2EPB A;  3AQQ A;  5D3D A;  3SGI A;  4A3E G;  3L3O C;  1OO9 B;  1TY0 A;  3X3N A;  1HZA A;  2HCC A;  4R4C A;  3GTP B;  4RGT A;  3VR3 A;  4H02 A;  3M4Y A;  1GHK A;  4B3S L;  4DK3 C;  2K1B A;  1BCP D;  2FMC A;  1S40 A;  1XNQ Q;  4GN4 B;  4DV5 L;  5FK9 C;  2E75 C;  4C3J B;  2I46 A;  1K3R A;  4GZY C;  1B53 A;  1H9S A;  1UEB A;  5A35 A;  3T13 A;  1LT5 D;  1FJG L;  4ZLT F;  5I9P A;  1SR3 A;  2CW0 C;  2K52 A;  3OIP A;  4EVO A;  2K33 A;  2E2J H;  4X65 L;  1Y1V H;  4C3H H;  5D14 A;  3BDO A;  3OW2 A;  4BBS G;  3V96 A;  3PIP 3;  1SNC A;  4KD3 A;  2A19 A;  2C35 B;  1XJV A;  3D8G A;  3G6E A;  3HOY G;  1RKN A;  2F0E A;  4XYO A;  1HZC A;  2L0C A;  1H9R A;  1VDZ A;  2JN4 A;  4KTA A;  1L1O C;  1Z47 A;  3Q23 A;  1CHQ D;  5CV7 A;  3G4S A;  1CKO A;  1CTM A;  1TWF B;  2F0I A;  1PTO H;  4BWG B;  1HNZ Q;  5J1Z A;  2K5D A;  2O2L D;  3K7U C;  3WDN A;  2IPK D;  2IT1 A;  4QL5 A;  3TN2 A;  2ZTD A;  2BA0 A;  1G8Z D;  3CAM A;  2KED A;  3EVQ A;  3I7F A;  1STN A;  1BCP F;  4DKA C;  3FKI G;  3OHX C;  5IYC H;  5BR8 L;  2OF1 A;  1Q1B A;  1VQN A;  5JAV A;  3MXN A;  1EFI D;  3DLL A;  3EQL C;  1HR0 Q;  3T1Y L;  2B2V A;  3JAM L;  1PDQ A;  1Z6H A;  4PZ6 A;  2MO1 A;  4IO9 A;  5BN5 A;  5CC4 A;  2EYP A;  3SK4 A;  3S1R H;  2ES2 A;  2F0O A;  3BJU A;  1F9R A;  1G6P A;  3GTL B;  1BNZ A;  4RMF A;  1SFO H;  1SYC A;  3ERQ A;  3R93 A;  1OXV A;  2CCZ A;  3GTP H;  1PH9 A;  1PRT F;  4LFA L;  4LFA Q;  3TP6 A;  2EY2 A;  4X64 L;  4KV6 A;  4KD4 A;  2NBF A;  3HKZ B;  3KF6 A;  4GN3 B;  2NUC A;  3NQI A;  4FXK C;  4ZCK A;  3HOU H;  2F0U A;  3UI2 A;  3VYS A;  3TRE A;  1A63 A;  3EIV A;  4A3M B;  4IPH A;  4HN7 A;  1Y1W H;  1PVO A;  3K5L A;  4LF5 L;  3BYT B;  2VB3 X;  4OO1 G;  3OYY A;  3GQB A;  1BOS A;  4OGQ C;  4AH6 A;  1FD7 D;  2WAQ G;  2R3Z A;  4KHP Q;  1C9O A;  1HA5 A;  2VW9 A;  2VY3 A;  4G57 A;  1S5E D;  2Q2I A;  3E3X A;  2TMP A;  3HOV G;  5C3X A;  4GKJ Q;  1I50 B;  1U4P A;  4X6A H;  3NK9 A;  1SNM A;  4JI6 Q;  3LWU A;  2A6H C;  2K75 A;  2YTY A;  1TWF H;  4JI8 Q;  1O7I A;  1WTV A;  3MC0 B;  4CJ0 B;  5C5M A;  1YIJ A;  2EIF A;  4A3G G;  3OOC A;  1GUO A;  4GKK Q;  1JE5 A;  1DJR D;  2IHF A;  1KLU D;  1JOQ A;  1GOZ A;  3F2B A;  4A3K B;  1D2B A;  4DNR B;  3P1H A;  2WII B;  4KJN A;  1BO0 A;  1KRS A;  4XDX A;  4DAY B;  1STY A;  4KJO A;  2LS0 1;  2ICI A;  4LUZ A;  2D9U A;  2KEN A;  1XMQ Q;  1JB3 A;  4A3F B;  3M9B A;  3TME A;  5IP7 G;  1YJN A;  1FL0 A;  1SNQ A;  1ENF A;  2A69 C;  1C48 A;  1R9T H;  5FOB B;  5LMN W;  4DXG A;  2JP1 A;  2XVS A;  1AFP A;  4R4T A;  1BF4 A;  4DR5 Q;  2E2J B;  5J22 A;  4HID A;  4WJ3 M;  2UXD Q;  3NSW A;  4DN4 M;  4R1J A;  3QB3 A;  1WVL A;  3FRP B;  1V8Q A;  2UUA L;  5CV8 A;  2F3W A;  2JA8 G;  3KUP A;  3PO3 H;  3HOV H;  1KHI A;  2HCI A;  3PUZ A;  2KHJ A;  3GTM B;  4DV7 Q;  3UDI A;  2PQA A;  1A2T A;  5IYB H;  2A69 D;  2SNS A;  3BU2 A;  4WJW A;  1D5X C;  3QO2 A;  2VQE Q;  2JK8 A;  2F1M A;  3C3L A;  4DR7 Q;  2RKS A;  3PO2 B;  2XSC A;  4IPC A;  3HOZ G;  1YNN C;  4JI8 L;  4CKC A;  2R7Z B;  1BCP B;  3MZ5 A;  5M9O A;  1LV9 A;  4A3D B;  1CUK A;  4F7X A;  1JWS D;  2NN6 G;  1ML0 D;  4XQJ A;  4BY7 B;  4FNF A;  5T1I A;  4FYD A;  4IFD J;  5IT9 E;  2ZJP A;  2WB1 B;  2RSO A;  1YEZ A;  3RUZ A;  4KHP L;  4LAA A;  3HOW H;  2NVQ B;  4G4K A;  3GTO B;  3CC4 A;  2KCC A;  5JVG 3;  3TP8 A;  1VQF A;  2IX0 A;  3SK8 A;  4LUV A;  2Z1C A;  2F52 A;  1FNU A;  1WTO A;  3D6W A;  1ET9 A;  2QDB A;  4EGV A;  1VQI A;  2KCN A;  3RN2 A;  1XXG A;  2NB0 A;  5J39 A;  1VQK A;  2AWO A;  4MTK A;  4QIW B;  1YNN D;  3TSS A;  1F2M A;  2Q8R E;  3RD4 A;  4LF7 Q;  3GTL H;  1K73 C;  1EEF D;  1X65 A;  2CQA A;  2EY5 A;  3ERS X;  2UUB L;  2BE5 C;  4RHS A;  4JI3 Q;  1SMY D;  3A8J E;  1IW7 D;  3HOZ H;  5JJK A;  3HFZ B;  2K50 A;  3OIQ A;  1PH1 A;  3J81 c;  5ELO A;  4R4O A;  4YY3 L;  2EYF A;  3UE1 A;  1G2T A;  2A68 D;  2HT1 A;  1I4X A;  1VQJ A;  2SDF A;  4AYB E;  1MHW C;  2EYM A;  5C0X I;  2PPB C;  5FJ8 G;  1Y69 U;  2ZTE A;  3FVQ A;  4QY7 A;  4IUQ A;  3T56 B;  2IJ0 A;  3I3C A;  4IZ8 A;  1ENC A;  5GQO A;  1NJI C;  2D2C C;  3OWF A;  4NPS A;  1J5E L;  1SYB A;  1JR0 D;  4QF4 A;  4P75 A;  3F2D A;  1TS4 A;  1E2V A;  2Z6K C;  2A8V A;  1TR5 A;  5FO8 B;  2E76 C;  4JG2 A;  5T1G A;  1L0W A;  3W1G A;  4CHT B;  1PH3 A;  1PMR A;  1QNK A;  1N36 Q;  2ID0 A;  2K28 A;  3K8A A;  3KK7 A;  4DV2 L;  1E0B A;  4AQY L;  2WFW A;  1EL0 A;  2EY6 A;  2I07 B;  2ZXR A;  4DR4 L;  2NVY B;  3J7A F;  4DV4 Q;  4RHR A;  3T53 B;  2F0L A;  3ULP A;  1ESR A;  3SK5 A;  1IYV A;  4HR7 B;  4QUC A;  3NPP A;  3S1N B;  3HKZ E;  2PZU A;  1MJE A;  2CH4 W;  5E1F A;  3STB C;  4LF9 L;  1TII D;  2O5J C;  5IP7 H;  2R6G A;  2JYO A;  1HCZ A;  3S1Q H;  3DUZ A;  4K6L A;  4ULL A;  1Q12 A;  3ER0 A;  1B3Q A;  4HJA A;  1EZ6 A;  3I70 A;  1LAC A;  3HOY H;  3PIP A;  4HAE A;  4H0L C;  1D6E C;  4YWL A;  4P74 A;  4EQ5 A;  1T5X D;  2B2Y C;  5KRU A;  1NAP A;  1X56 A;  3MEH A;  1EYA A;  2F0D A;  4HCS A;  2VQF L;  1LT6 D;  4O0A A;  1T9H A;  2B2U C;  1VQB A;  5IGC A;  4A3K H;  1V1Q A;  4X65 Q;  4QUF A;  3EJI A;  2RCF A;  1ROD A;  4BBS H;  1S5D D;  2NZ1 D;  1TS2 A;  1GUT A;  4K5V A;  1E3P A;  3MHB A;  4B3R L;  1X3E A;  3J81 i;  5I2X A;  4DV3 Q;  1S5F D;  4EQP A;  2PMZ B;  1JOK A;  2M00 A;  4GNX B;  2Y0S E;  5A2Q L;  2E2I H;  3FDT A;  2EQS A;  1CKN B;  5C6A A;  1QG7 A;  4UP7 A;  4Z9C B;  3PUX A;  1WYD A;  2K5Q A;  3NEL A;  4R8N A;  4X62 Q;  4B3T Q;  4L5S A;  3GTK B;  3ND9 A;  4LFB Q;  2RDF A;  1EY6 A;  1H9S B;  4DR6 Q;  1TU2 B;  5M3M H;  2R92 H;  2GN5 A;  2B2Y A;  1UE1 A;  1N34 Q;  5LMU Q;  2WAQ B;  4RH6 A;  4A93 G;  5CV9 A;  4GNX C;  3EN2 A;  5L37 A;  3KF8 B;  3PO2 H;  5COR A;  5IGG A;  1CQF A;  4DV6 L;  2A68 C;  4RG1 A;  5HGT A;  1JT8 A;  1NNX A;  2V1C C;  1N32 Q;  1XYI A;  3KLS A;  4KKU A;  4C2M H;  1I50 H;  3G7L A;  3Q22 A;  4ILW A;  1O80 A;  4KI0 A;  3H94 A;  4RGM A;  1F77 A;  4XTC S;  4BBR G;  1VCI A;  4PZ8 A;  2AWN A;  2JA6 B;  1Z9F A;  1U4R A;  5LHY 1;  1JOO A;  4DR6 L;  3RZD H;  3G71 A;  1DYQ A;  3G48 A;  3AMU A;  3PMF A;  1TVX A;  1SJH D;  1IKL A;  4JI6 L;  1SYF A;  1PV4 A;  1PFM A;  1TWG H;  2A5H A;  1K8G A;  2XRQ D;  3HRZ C;  1PRT D;  3KLW A;  2K04 A;  2CKZ B;  3RN5 A;  1XPO A;  1SND A;  4OON A;  3MXG A;  3HOZ B;  1RL2 A;  4HIK A;  2K03 A;  4BY1 G;  3S17 B;  1WOC A;  1C8C A;  2EXZ A;  4A3J G;  1A6X A;  3J7A 5;  4RCN A;  3H0G B;  4IAL A;  1UAP A;  4LW1 A;  2E8G A;  2WKC A;  2B2T C;  1RHP A;  1VS0 A;  2BOS A;  2RDG A;  1VF5 C;  3OMC A;  4IUN A;  4KLK A;  1L1O B;  3K7A H;  4PQX A;  3TZD A;  3U9S A;  1P16 A;  3MVV A;  2UUC Q;  4DV6 Q;  1QUQ A;  2HIX A;  3G6J B;  3ERO A;  3TQY A;  4IFD H;  2EXD A;  3SEB A;  4RFB A;  5DM7 3;  5IOD A;  3CCS A;  4KKS A;  5I6W A;  4LF8 L;  3MFY A;  3K58 A;  1JWU D;  4K8J A;  4K2L A;  1CK1 A;  1IBL Q;  2IL8 A;  2K5N A;  1DXM A;  4FVM A;  5DLQ E;  1SYG A;  3KOJ A;  4JYA L;  3CRL C;  1TWH H;  4N9T A;  1R4P B;  3W1B A;  3HG9 A;  3U58 A;  1SN8 A;  2XN9 C;  1IBK Q;  1U9R A;  1N33 Q;  4CGY B;  1Q8I A;  1KLG D;  2VL6 A;  1I94 L;  1F9P A;  3BVG A;  1KDA A;  2L12 A;  5A2Q E;  2DNE A;  3T1H L;  2PMZ E;  1X32 A;  2ZM6 Q;  5I9O A;  4KMU C;  4OXP A;  4C2M B;  2NVQ H;  1UNS A;  1JIC A;  2B8G A;  4A3G H;  4OX9 Q;  4DR1 Q;  1X6O A;  2XWB B;  4Y7N B;  1J6Q A;  2BDO A;  1IYJ B;  2WB1 G;  4O2D A;  4LF6 Q;  4JI2 Q;  3ZYY X;  1K28 A;  1HNW L;  1FR3 A;  1EWH A;  1JJC B;  3W2D A;  5C3E B;  3CME A;  4JI0 Q;  2B2U A;  2VZA A;  5CR3 A;  3MFG A;  2O4X A;  5KND A;  1N8R C;  4X3S A;  3M4P A;  3F8T A;  1XMO Q;  4DPG A;  3IRB A;  4DK0 A;  3CCJ A;  4JV5 Q;  3J7Z C;  3H3V I;  5ISR A;  4DUZ L;  3CC2 A;  2UUC L;  1Y1W G;  1QE6 A;  1HNX L;  1SMX A;  3CW2 C;  2G9H D;  5C3E G;  3GTQ B;  3P20 A;  1D5M C;  4I7Z C;  5M3F H;  2R93 H;  4APV A;  3EBE A;  2AHO B;  4TRD A;  4BA2 I;  3NTH A;  1PYW D;  3L0O A;  1UWV A;  1PRT C;  4I7A A;  3KLR A;  1MD2 D;  3H6M A;  5EQ0 A;  4GS3 A;  4C3I H;  2PZT A;  3SDZ A;  1AN8 A;  4M8A A;  3QOJ A;  5EPJ A;  1W6J A;  4TVA B;  1PTO B;  1N34 L;  1RTO A;  2NVY H;  4KK7 A;  4GOP C;  2X69 A;  5EBC A;  1DGS A;  1CT1 D;  3FKI H;  5IYC G;  1E1O A;  2JSO A;  3FP9 A;  5IP9 G;  1VQL A;  1EU4 A;  5BN4 A;  1AH9 A;  3DWA A;  1CZW A;  2RVL A;  3TZU A;  4BA1 I;  4ZUJ A;  4JI7 Q;  3LWE A;  2RA4 A;  2IHE A;  1XPU A;  3M3Y H;  4G7Z C;  5M5Y H;  1PTO C;  4RAU C;  3AEV A;  4YCW A;  3T16 A;  3VR4 A;  1HNZ L;  2LFN A;  3CP0 A;  3CQZ H;  2DUD A;  2MGS A;  5DM6 3;  2UXD L;  1Y1V G;  3NQT A;  3M85 A;  4LNQ A;  4IUV A;  1GHJ A;  4QQB X;  4Y7N H;  3H09 A;  1I4R A;  5CBE E;  5EAY A;  2F0W A;  1FNV A;  2FJ2 A;  3I4O A;  2B2V C;  1HJP A;  4K6D A;  1C4Q A;  2HHH Q;  2HHH L;  1NMF A;  2YYZ A;  1VQ7 A;  1JCK B;  5FLM G;  1JQY D;  1NBW A;  1EY9 A;  2GVA A;  2BH8 A;  1DD2 A;  4R4I A;  1X55 A;  1A2U A;  2I5M X;  4A3E H;  1SE3 A;  1EFW A;  1YHB A;  4QJF A;  3E9H A;  3QJY A;  3CU7 A;  5HUR A;  2IX1 A;  1IXR A;  1VQD A;  2B2W C;  1EOV A;  1FYC A;  1ASY A;  3RLF A;  5J3B A;  1NTG A;  5G3L D;  2B63 B;  2XIW A;  3I90 A;  2FIN B;  4P73 A;  4GLA C;  2CVR A;  2Z6K A;  3S14 B;  3ND8 A;  1V9P A;  1B44 D;  1Y14 B;  3UE0 A;  1WJJ A;  2BA1 A;  3GTG H;  1JMC A;  1HPC A;  4QIW E;  2DY7 A;  2C5C A;  4PV1 C;  1Q81 C;  4A93 B;  2A6E C;  3PF4 A;  5HY6 A;  2NVX H;  2ZJR A;  1TQO A;  1N32 L;  4PMC A;  4MNO A;  2JA6 H;  2PQA B;  3CC7 A;  1PTO D;  3KDF B;  4J8Q A;  4LF4 Q;  5KYL A;  3QIA A;  1MI2 A;  2AQ3 B;  3HEJ A;  4JI1 Q;  3IFD A;  1EOT A;  1Y1V B;  2E2H B;  1YZ6 A;  1JJG A;  1SAP A;  3S2H H;  3DWP A;  4GN5 A;  2JA5 B;  4DV0 L;  1D1K A;  2BCO A;  4M1U B;  4FF1 A;  1N36 L;  1ASZ A;  1QJO A;  4TQU S;  5CGK A;  2JA5 H;  5FLX E;  4XQQ A;  1IL2 A;  2RDH A;  4Y52 H;  3ULJ A;  3H0G G;  1ONL A;  1PH7 A;  1PXU A;  2OT2 A;  2Z4H A;  4PMW A;  2RQX A;  1LM0 A;  4IOC A;  4DNT B;  5FLM H;  1BR9 A;  3MXN B;  2Y0S G;  2Z8L A;  5C4X G;  2ICE C;  1HNX Q;  3VA5 A;  5EKK A;  2M2L A;  1Q1E A;  5DNF A;  1K8A C;  5JEA J;  2QW7 A;  4A3I H;  3NBH B;  3GP7 A;  2F0K A;  3TEH B;  4DR2 Q;  1CZG A;  3M4Q A;  2JA8 H;  2M9V A;  5GAD C;  2F4V L;  4AYB B;  5IGB A;  2JEB I;  4IUU A;  3LX0 A;  1I6H B;  2K6A A;  4LF5 Q;  4V19 0;  5C44 H;  4K5X A;  1PTO F;  3W3A A;  1HQM C;  4XYQ A;  2KJX A;  4NMZ A;  3URY A;  2WKD A;  2Q2H A;  3CCM A;  4CDF C;  1ICF B;  2IWH A;  4AYB G;  1PZJ D;  4BY1 H;  1Q8K A;  1BXT A;  4DXF A;  2AQ2 B;  1VQE A;  1WFQ A;  5IP9 H;  1MIU A;  2Z6B A;  2FFK B;  3K6O A;  1TWA H;  4C3I G;  4H13 C;  4FP5 D;  5C4Z A;  5K5P A;  3K5N A;  1PRT B;  2K05 A;  2B39 A;  1O7Z A;  2F0S A;  5FLX L;  1TWA B;  1HA6 A;  5COY A;  1V1P A;  1IHZ A;  1BUV T;  4IOA A;  2Z4I A;  4LFB L;  4A3M G;  1KTK A;  3DM1 A;  4JBM A;  3JAM i;  1GKH A;  3GTJ B;  1OXS C;  3HP3 A;  5I6Y A;  3K7A B;  5FJ8 H;  1FNW A;  3K0Y A;  4DV5 Q;  1D5Z C;  3AFQ A;  5LMU L;  4YHH Q;  2RBM A;  3A7L A;  4ZYS A;  2H1E A;  4DV7 L;  2EYL A;  2PYK A;  2EOT A;  1Y8O B;  5I2Y A;  4PG3 A;  2HIV A;  4G7O C;  2E5L L;  2BH2 A;  1IYU A;  1SBB B;  5HGQ A;  4A3L H;  2L4N A;  3RR5 A;  3CCL A;  3KJP A;  2N8N A;  2L9H A;  1R4Q B;  4KHV A;  2GVB A;  4C3J G;  4FO2 A;  4HIM A;  1SEB D;  1L0Y B;  4K0K Q;  2K5V A;  1LTG D;  1A3V A;  2D0O A;  3PO2 G;  2A6H D;  4S3S A;  1HTL D;  1L0X B;  3VR2 A;  1WD1 A;  2AKW B;  1FVI A;  4JC0 A;  4NP5 A;  4K2K A;  1EQV A;  3A8K E;  2CQO A;  3AU7 A;  2RSN A;  4CDC C;  4TKO B;  4WOR A;  4DAM A;  4L5R C;  1CI3 M;  1F9Q A;  2JA8 B;  1B9M A;  3A8I E;  5CV6 A;  1JE4 A;  4A3F H;  5G3L F;  1I6H H;  3S15 H;  2NTS A;  4TSS A;  1FJG Q;  3GTO H;  1LYL A;  1Q82 C;  2JA7 H;  1JJ2 A;  5JJL A;  4NXM L;  2UU9 Q;  5AFW A;  1EY0 A;  1E7Z A;  5KYI A;  1A0I A;  2PZW A;  4FXG C;  4DR4 Q;  5FLX c;  5IYB G;  5EBD A;  2R7D A;  2A6E D;  4K14 A;  1LTT D;  4GOP B;  1Y8P B;  1HHV A;  1EZ8 A;  2FMM A;  1SE8 A;  4KN4 C;  1SYE A;  3T51 B;  1H95 A;  1VQM A;  3HKS A;  1EEI D;  3KJO A;  1J5E Q;  4JI7 L;  4O1N A;  1H9J A;  1M8A A;  2QA4 A;  3P7J A;  1U4M A;  3RLO A;  1Q7Y C;  2PO4 A;  1B50 A;  3NE5 B;  2WP8 J;  4ZKC B;  3NWS A;  1RD9 D;  5CV5 A;  3NTK A;  4YY3 Q;  3I4M G;  3NWT A;  4X62 L;  4B3T L;  3R2T A;  2JA7 G;  1LTI D;  1NCV A;  1I4G A;  3NHH A;  1KDC A;  2UUB Q;  2I5H A;  3A5U A;  2BE5 D;  5IGE A;  2K32 A;  4B08 A;  1EY4 A;  3JAM E;  1PH2 A;  5M5W H;  1IBL L;  3FKI B;  1Y1W B;  3H3V C;  1PLF A;  2I0Q A;  1U4L A;  4A3B B;  4GLX A;  2VQF Q;  4JW0 A;  1STA A;  2LSS A;  4DNI A;  4JVZ A;  1UE6 A;  5C5L A;  1J8I A;  1TKW B;  2E74 C;  4LK1 C;  2N49 A;  2YU9 B;  1NR2 A;  1LTB D;  1LLR D;  2JJQ A;  1HTP A;  1I3Q H;  3J81 j;  3J80 L;  2KUM A;  1WCM G;  3VA7 A;  4JPB W;  3U50 C;  1GVP A;  5LMN L;  4XQN A;  4KY6 A;  1HR0 L;  3TRZ A;  1Q46 A;  1TS5 A;  1A3U A;  3RZO H;  4XT1 B;  4DF7 A;  5IYD H;  2IY5 B;  4UY8 C;  3D4D A;  4IPG A;  3A55 A;  3GDE A;  3J80 c;  2BDN A;  4R8I A;  4A3M H;  5EKL A;  5C3W A;  4LF6 L;  4F87 A;  1TWG B;  4C3J H;  2KQ3 A;  1CA6 A;  5KNC A;  3A74 A;  2VS1 A;  5E4W C;  1PH4 A;  5JEA H;  2H4O A;  2D5D A;  1GUG A;  2UXC L;  4JOI A;  3HOU B;  1WTX A;  1WTP A;  5IE8 A;  5M3M G;  3X3M A;  5GAG C;  2OQ0 A;  2VQE L;  1X54 A;  1RF2 D;  5LMN Q;  1QIL A;  3EFX D;  2F0J A;  1EY7 A;  5IWA Q;  1V1O A;  1AZP A;  4B9X A;  1EQR A;  2XRS D;  1DOL A;  1DOK A;  2CHB D;  3FHW A;  1I94 Q;  4LFC Q;  4DAY A;  1WD0 A;  2X6L A;  4OEM B;  2B63 G;  3BVZ A;  4NXN Q;  1YNX A;  1PYB A;  4MN3 A;  5CV4 A;  4A75 A;  2VUM G;  4DV1 L;  5JOB A;  3S16 H;  2KOL A;  1PHJ A;  2KCT A;  2AQ1 B;  4I65 A;  1B3A A;  3IKJ A;  2OWO A;  2F0F A;  1VQP A;  3V05 A;  2HQE A;  3S15 B;  2L55 A;  2L11 A;  3K5M A;  4AIM A;  4LF4 L;  2G9D A;  2F03 A;  1GUS A;  2SNM A;  3DMU A;  1QWY A;  1SXT A;  1MBY A;  3VDY A;  4HJ9 A;  2VUM H;  5C4H A;  2DGY A;  4JOI C;  3BS1 A;  2ZXO A;  1UUP A;  1N9W A;  4DUZ Q;  2KHI A;  2HQL A;  3HS0 C;  3UDX A;  1A62 A;  2AUJ D;  4KHZ A;  5JVH 3;  4A3J H;  3NEN A;  2OTJ A;  1O7L A;  3PSI A; 
#chains in the Genus database with same CATH homology
 2A73 B;  2OXP A;  2IX3 A;  1WTW A;  4DAV A;  1AZQ A;  1H9M A;  1LTA D;  3SHL A;  1SE2 A;  2CW0 D;  1S5C D;  1SDF A;  1BBX C;  2DNC A;  1FGB D;  1QNU A;  2K01 A;  4C1N I;  3R8B A;  1EIG A;  1IL8 A;  4UAI A;  4KY7 A;  3Q24 A;  3M7G A;  3S2D B;  2NYZ D;  3PUY A;  1QB5 D;  1LT4 D;  5EKI A;  3Q6S A;  5E3F A;  3VYU A;  5CYU A;  2FHT A;  1G91 A;  2EZV A;  3BDC A;  5ELB A;  3DEO A;  3ITP A;  3C1F A;  4C1N K;  5CBA E;  3CHB D;  1QCB D;  5DAU A;  1DM0 B;  2EJM A;  3R2I A;  5C4J B;  5IGF A;  2N55 A;  1V1P B;  3KBG A;  4BS9 A;  1JWM D;  4HSP A;  2MPM A;  1VMP A;  1EQT A;  1YNJ D;  3GV3 A;  2F0V A;  2L5T A;  4NKL A;  2PW5 A;  3MA2 B;  1DON A;  4ZQ3 A;  4Q5V A;  2EYO A;  1HRJ A;  3J7A V;  4LJZ C;  4ZRZ A;  2E2I B;  4CKE A;  1NUC A;  2PNR C;  2ENB A;  2L1B A;  4QCL A;  2EVB A;  3WOF A;  5LL6 S;  4OIK A;  5IIF A;  1Q90 A;  5M3M B;  4NW2 A;  4G7H C;  1KAB A;  2AUK A;  2HDL A;  3OPO A;  2VXW A;  5C0X J;  2XNA C;  3HGB A;  3QOL A;  4R9W A;  1A15 A;  3I4N B;  3MWY W;  4F88 A;  2NWG A;  2EY1 A;  4KKT A;  1SNP A;  2IW3 A;  1EY5 A;  2B2T A;  1Q3L A;  5C44 B;  3I72 A;  3L9A X;  4RKB A;  2HUG A;  4A3J B;  1EIH A;  3AB9 A;  3J80 E;  2VB2 X;  4CKB A;  1JC7 A;  5K36 G;  2F0H A;  3BVM A;  3L7Z C;  3NBI A;  3Q0A A;  1RTN A;  2K5W A;  1CQV A;  4HTH A;  4HED A;  2KA7 A;  1KDB A;  1VF7 A;  1K8O A;  1HXY D;  3HZX A;  4XIG S;  4PNY A;  3P75 A;  1KAA A;  3O13 A;  5JEA G;  1CFM A;  1ZKO A;  4KY5 A;  4X3T A;  2V4D A;  1ZEQ X;  1S4Z A;  2J7Z A;  2KEC A;  3KLS X;  4A3E B;  2NVT B;  1LO5 D;  4OO1 I;  3T4A C;  1A3T A;  3NUC A;  1OXT A;  1HQR D;  2NTT A;  3ONA B;  1KNA A;  2B2W A;  5ELC A;  1F2L A;  5KIX A;  4F8M A;  5DEH A;  4U67 3;  5M5X B;  4IUR A;  1I4H A;  1IW7 C;  1M4V A;  3R3O A;  1STH A;  2X6G A;  4IFD G;  1DZ1 A;  4P2C B;  3NBH A;  1RCV D;  1BCP C;  4PMB A;  5FO9 B;  1R9T B;  3J81 L;  1AEX A;  1WTR A;  1G6Z A;  5JPM C;  4ZUI A;  3CRK C;  3F2U A;  4QMG A;  4HCE A;  1O7Y A;  5TSS A;  2Q8I B;  1II3 A;  4RA8 A;  2SOB A;  2PCF B;  2C9O A;  3C2P A;  4FXD A;  2O5I C;  3NP8 A;  1TS3 A;  3S9W A;  1LAB A;  4C3H G;  2D62 A;  3BZD B;  2F0G A;  2QCP X;  4DGZ A;  3NXW A;  5JJZ A;  5LL6 X;  3GTG B;  1PFN A;  5M3F B;  2R93 B;  1ICW A;  1H9K A;  2EJG C;  5FKA C;  1T5E A;  2F0P A;  4A3G B;  3GD7 A;  2NVX B;  2LMC B;  3FPP A;  3HOW B;  4U68 A;  3OSO A;  2E2D C;  1SSO A;  3E6Z X;  3GO5 A;  1GJX A;  5IOC A;  5ELD A;  3QWN A;  1YNJ C;  3PUW A;  4ID6 A;  1SFO B;  4ZKB B;  1CA5 A;  4RCO A;  4IUT A;  1SNO A;  4CJ1 B;  4DA2 A;  3NTI A;  2JXM B;  4ZK9 B;  4DAP A;  1ESF A;  2JEA I;  3BDL A;  1STG A;  1W6K A;  3TP7 A;  3RZD B;  2LY7 A;  4J6H A;  1PZK D;  3M4O B;  1SMY C;  5ELF A;  3H91 A;  3I4L A;  3E0J A;  4E6I A;  3K59 A;  4CJ2 C;  3SVM A;  5M5Y B;  2Y0S B;  3VR5 A;  5M5W B;  1WTQ A;  4XT3 B;  2R92 B;  4H7B A;  4KN7 C;  3D31 A;  4HMJ A;  2ZT9 C;  1K8M A;  2WIN B;  4RWS C;  3E5S A;  4MIU A;  4ODG A;  3LNN A;  2NN6 I;  4FF3 A;  2Q8T A;  2KEE A;  1D1I A;  3I4M B;  3HOX B;  3A56 A;  1HFN A;  2PW7 A;  3S1Q B;  1TWH B;  1LT3 D;  2XWJ B;  4IQZ A;  4RKL A;  4RGO S;  4Q0F A;  4OL7 A;  1HUM A;  3N6R A;  3A54 A;  5NUC A;  2F0T A;  3S1R B;  2DN8 A;  1NR4 A;  2MHV A;  1EU3 A;  3S1M B;  2LKV A;  4H44 C;  2ZXP A;  2K7V A;  1F2Z A;  1SJE D;  2N88 A;  1F9S A;  3V2T A;  1B2T A;  3RZO B;  3VR6 A;  3D4W A;  3IFT A;  3SK6 A;  1E2Z A;  1DOM A;  4ME5 A;  4RGN A;  2R61 A;  1QOH A;  1ILP A;  1EWC A;  2MUY A;  5FO7 B;  2A74 C;  3SXH A;  1ZXT A;  4JK1 C;  5I4D A;  3DHQ A;  4IFD I;  1EYC A;  2EJF C;  4J1M A;  1PZI D;  1CHP D;  2WV6 D;  5D3I B;  2QF7 A;  4OO1 H;  1EY8 A;  1XTC D;  3C1E A;  3FMC A;  5K36 H;  1SYD A;  1E2W A;  1WCM B;  1EYD A;  4DK1 A;  3HOV B;  3IL8 A;  4ABN A;  2TSS A;  4A3I B;  5F2D A;  3S16 B;  3CKI B;  1STE A;  1NSN S;  3MXU A;  4B9W A;  1LTS D;  4UDU C;  1G2S A;  1G29 1;  2EYJ A;  4C56 C;  1AP0 A;  1GUN A;  1TT2 A;  4BY1 B;  3U9O A;  2JA7 B;  1JOR A;  4BBS B;  3D4R A;  4FF2 A;  2F0N A;  4IN3 A;  3OMG A;  3PUV A;  3QG1 A;  4XXE A;  2KVM A;  3PIO 3;  3K5O A;  3FEW X;  3TDQ A;  1XX8 A;  1OXU A;  4N9P A;  4C3H B;  3I8Z A;  1CM9 A;  2SEB D;  3J81 E;  1DCZ A;  5D65 A;  3KF8 A;  2KHS A;  2QKI C;  2F4I A;  4WRD A;  4HSV A;  2WAC A;  3K57 A;  3FPU B;  1BDO A;  1V43 A;  2F3V A;  4OIJ A;  3IAY A;  1ZYR C;  2MJ8 A;  1J9O A;  2J0T D;  1O78 A;  4YIJ A;  1B1Z A;  3C46 A;  3TP5 A;  1XWE A;  1I4P A;  4WFN 3;  1X3P A;  3GV6 A;  3WOE A;  3HOY B;  1STB A;  3D3R A;  3RMH A;  5IGD A;  5EGT A;  3SR1 A;  5KEE A;  1HUN A;  4LMQ D;  2GA4 B;  5C0X H;  3M7N A;  2VNU D;  1GUW A;  1PFB A;  4V0B A;  4K5W A;  1S5B D;  2B8F A;  1Z7T A;  2EE1 A;  2QIL A;  1TWC B;  4L6T B;  1IKM A;  5EJW A;  1I6V C;  3S2H B;  5BN3 A;  4NDX A;  3OW7 A;  2DY8 A;  4FF4 A;  2PQE A;  4JBW A;  4K8I A;  5KNB A;  4QB4 A;  2NN6 H;  1LTR D;  5C0X G;  1ZYR D;  4ZAI A;  2F0M A;  4EQN A;  5CMD A;  2JE6 I;  3I91 A;  1SE4 A;  3BG3 A;  2OEO A;  3EA6 A;  4X3U A;  1UEA B;  3TBI B;  2EDG A;  1RJT A;  2QEJ C;  1VMC A;  1ENA A;  1ILQ A;  3DEP A;  3MAQ A;  3OWE B;  3KBX A;  5EPK A;  5EPL A;  4DU9 A;  3MXP A;  1OXX K;  1Y8N B;  1MSG A;  2EYH A;  1F2Y A;  3I73 A;  2VUM B;  1B9N A;  1TY2 A;  4MHE A;  5C4X B;  3M3Y B;  1I4Q A;  3VYT A;  3BYY B;  3PV0 A;  3DXJ C;  3VYR A;  2MP1 A;  3CQZ B;  1K83 B;  1ET6 A;  5ELE A;  4CBV A;  4O42 A;  3MTS A;  3SE0 A;  3A7A B;  3N52 A;  1GXD C;  3PO3 B;  4IUP A;  5JPN C;  2J4X A;  4L8J A;  1MSH A;  2HDM A;  1HFG A;  5E4X A;  3DWQ A;  1AW7 A;  3J7Y W;  1BQQ T;  4HMI A;  1MGS A;  4OHJ A;  4C3I B;  5IT9 L;  3D6C A;  2F0Q A;  5KGU A;  4EQO A;  1X3Q A;  4L63 B;  1B4O A;  1RDP D;  4BBR B;  4DFA A;  4X3K A;  1KNE A;  1I3Q B;  2EPB A;  5D3D A;  3L3O C;  1OO9 B;  1TY0 A;  3X3N A;  2HCC A;  3GTP B;  4RGT A;  3VR3 A;  3M4Y A;  1GHK A;  2K1B A;  1BCP D;  2FMC A;  5FK9 C;  2E75 C;  4C3J B;  2I46 A;  4GZY C;  1B53 A;  1H9S A;  5A35 A;  3T13 A;  1LT5 D;  4ZLT F;  5I9P A;  2CW0 C;  3OIP A;  4EVO A;  2K33 A;  5D14 A;  3BDO A;  3V96 A;  3PIP 3;  1SNC A;  4KD3 A;  3D8G A;  1RKN A;  2F0E A;  4XYO A;  2L0C A;  1H9R A;  1VDZ A;  4KTA A;  1Z47 A;  3Q23 A;  1CHQ D;  5CV7 A;  1CTM A;  1TWF B;  2F0I A;  1PTO H;  4BWG B;  5J1Z A;  2K5D A;  2O2L D;  3WDN A;  2IPK D;  2IT1 A;  3TN2 A;  2BA0 A;  1G8Z D;  3EVQ A;  2KED A;  1STN A;  1BCP F;  3OHX C;  2OF1 A;  1Q1B A;  5JAV A;  3MXN A;  1EFI D;  3EQL C;  2B2V A;  3JAM L;  1PDQ A;  1Z6H A;  5BN5 A;  5CC4 A;  2EYP A;  3SK4 A;  2F0O A;  1F9R A;  3GTL B;  1BNZ A;  1SYC A;  3ERQ A;  3R93 A;  1OXV A;  1PRT F;  3TP6 A;  2EY2 A;  4KV6 A;  4KD4 A;  2NBF A;  3HKZ B;  2NUC A;  3NQI A;  4FXK C;  2F0U A;  3UI2 A;  3VYS A;  4A3M B;  4HN7 A;  3K5L A;  3BYT B;  2VB3 X;  4OO1 G;  3GQB A;  1BOS A;  4OGQ C;  1FD7 D;  2R3Z A;  1HA5 A;  4G57 A;  1S5E D;  2TMP A;  5C3X A;  1I50 B;  1U4P A;  3NK9 A;  1SNM A;  3LWU A;  2A6H C;  1WTV A;  3MC0 B;  4CJ0 B;  5C5M A;  3OOC A;  1GUO A;  1DJR D;  1KLU D;  1JOQ A;  1GOZ A;  4A3K B;  1D2B A;  4DNR B;  3P1H A;  2WII B;  4KJN A;  1BO0 A;  4XDX A;  1STY A;  4KJO A;  2LS0 1;  2ICI A;  2D9U A;  1JB3 A;  4A3F B;  3TME A;  1SNQ A;  1ENF A;  2A69 C;  1C48 A;  5FOB B;  4DXG A;  2JP1 A;  2XVS A;  1AFP A;  1BF4 A;  2E2J B;  5J22 A;  3NSW A;  4DN4 M;  3QB3 A;  1WVL A;  3FRP B;  1V8Q A;  5CV8 A;  2F3W A;  3KUP A;  2HCI A;  3PUZ A;  3GTM B;  1A2T A;  2A69 D;  2SNS A;  4WJW A;  1D5X C;  3QO2 A;  2F1M A;  3C3L A;  2RKS A;  3PO2 B;  2XSC A;  1YNN C;  4CKC A;  2R7Z B;  1BCP B;  3MZ5 A;  5M9O A;  1LV9 A;  4A3D B;  4F7X A;  1JWS D;  2NN6 G;  1ML0 D;  4XQJ A;  4BY7 B;  4FNF A;  5T1I A;  4FYD A;  4IFD J;  5IT9 E;  2WB1 B;  2RSO A;  3RUZ A;  4LAA A;  2NVQ B;  4G4K A;  3GTO B;  2KCC A;  5JVG 3;  3TP8 A;  2IX0 A;  3SK8 A;  2Z1C A;  1FNU A;  1WTO A;  3D6W A;  1ET9 A;  2QDB A;  4EGV A;  2KCN A;  1XXG A;  2NB0 A;  5J39 A;  2AWO A;  4QIW B;  1YNN D;  3TSS A;  1F2M A;  2Q8R E;  3RD4 A;  1EEF D;  2CQA A;  2EY5 A;  2BE5 C;  4RHS A;  1SMY D;  3A8J E;  1IW7 D;  3OIQ A;  2EYF A;  1G2T A;  2A68 D;  1I4X A;  2SDF A;  2EYM A;  5C0X I;  2PPB C;  1Y69 U;  3FVQ A;  4IUQ A;  3T56 B;  2IJ0 A;  3I3C A;  4IZ8 A;  1ENC A;  2D2C C;  3OWF A;  1SYB A;  1JR0 D;  4QF4 A;  1TS4 A;  1E2V A;  1TR5 A;  5FO8 B;  2E76 C;  5T1G A;  4CHT B;  1PMR A;  1QNK A;  2ID0 A;  2K28 A;  3KK7 A;  1E0B A;  1EL0 A;  2EY6 A;  2I07 B;  2ZXR A;  2NVY B;  3J7A F;  4RHR A;  3T53 B;  2F0L A;  1ESR A;  3SK5 A;  1IYV A;  4HR7 B;  4QUC A;  3NPP A;  3S1N B;  2PZU A;  5E1F A;  2O5J C;  1TII D;  2R6G A;  2JYO A;  1HCZ A;  3DUZ A;  4K6L A;  4ULL A;  1Q12 A;  1EZ6 A;  3I70 A;  1LAC A;  4HAE A;  4H0L C;  1D6E C;  1T5X D;  2B2Y C;  5KRU A;  1NAP A;  3MEH A;  1EYA A;  2F0D A;  4HCS A;  1LT6 D;  2B2U C;  5IGC A;  4QUF A;  3EJI A;  1ROD A;  1S5D D;  2NZ1 D;  1TS2 A;  1GUT A;  4K5V A;  3MHB A;  5I2X A;  1S5F D;  4EQP A;  2PMZ B;  1JOK A;  2M00 A;  5A2Q L;  3FDT A;  5C6A A;  1QG7 A;  4Z9C B;  3PUX A;  4R8N A;  2K5Q A;  3GTK B;  3ND9 A;  2RDF A;  1EY6 A;  1H9S B;  1TU2 B;  2B2Y A;  2WAQ B;  4RH6 A;  5CV9 A;  5COR A;  5IGG A;  1CQF A;  2A68 C;  5HGT A;  1XYI A;  3KLS A;  4KKU A;  3G7L A;  3Q22 A;  4ILW A;  1O80 A;  4KI0 A;  3H94 A;  4RGM A;  1F77 A;  4XTC S;  1VCI A;  2AWN A;  2JA6 B;  5LHY 1;  1U4R A;  1JOO A;  1DYQ A;  3AMU A;  3PMF A;  1TVX A;  1SJH D;  1IKL A;  1SYF A;  1PFM A;  2A5H A;  2XRQ D;  3HRZ C;  1PRT D;  2K04 A;  1SND A;  3MXG A;  3HOZ B;  2K03 A;  3S17 B;  1C8C A;  2EXZ A;  1A6X A;  4RCN A;  3H0G B;  4IAL A;  1UAP A;  2WKC A;  2B2T C;  1RHP A;  2BOS A;  2RDG A;  1VF5 C;  3OMC A;  4IUN A;  4PQX A;  3TZD A;  3U9S A;  3MVV A;  3G6J B;  3ERO A;  4IFD H;  3SEB A;  4RFB A;  5DM7 3;  5IOD A;  4KKS A;  5I6W A;  3MFY A;  3K58 A;  1JWU D;  4K8J A;  4K2L A;  1CK1 A;  2IL8 A;  1DXM A;  4FVM A;  1SYG A;  3CRL C;  4N9T A;  1R4P B;  3HG9 A;  2XN9 C;  1U9R A;  4CGY B;  1Q8I A;  1KLG D;  1F9P A;  3BVG A;  1KDA A;  2L12 A;  5A2Q E;  2DNE A;  1X32 A;  5I9O A;  4KMU C;  4C2M B;  1UNS A;  1JIC A;  2B8G A;  2XWB B;  4Y7N B;  2BDO A;  3ZYY X;  1FR3 A;  1EWH A;  3W2D A;  5C3E B;  2B2U A;  5CR3 A;  3MFG A;  2O4X A;  5KND A;  4X3S A;  4DK0 A;  5ISR A;  1QE6 A;  2G9H D;  3GTQ B;  3P20 A;  1D5M C;  4I7Z C;  4BA2 I;  4TRD A;  3NTH A;  1PYW D;  1PRT C;  3KLR A;  1MD2 D;  3H6M A;  5EQ0 A;  2PZT A;  3SDZ A;  1AN8 A;  5EPJ A;  4M8A A;  3QOJ A;  1W6J A;  1PTO B;  1RTO A;  4KK7 A;  2X69 A;  5EBC A;  1CT1 D;  2JSO A;  1EU4 A;  5BN4 A;  3DWA A;  1CZW A;  2RVL A;  3TZU A;  4BA1 I;  4ZUJ A;  3LWE A;  2RA4 A;  4G7Z C;  1PTO C;  4RAU C;  3T16 A;  3VR4 A;  2LFN A;  2MGS A;  5DM6 3;  3NQT A;  3M85 A;  4IUV A;  1GHJ A;  3H09 A;  1I4R A;  5CBE E;  2F0W A;  1FNV A;  2FJ2 A;  2B2V C;  4K6D A;  1C4Q A;  2YYZ A;  1JCK B;  1JQY D;  1EY9 A;  1DD2 A;  1A2U A;  1SE3 A;  3QJY A;  3CU7 A;  5HUR A;  2IX1 A;  2B2W C;  1FYC A;  3RLF A;  5G3L D;  2B63 B;  2XIW A;  3I90 A;  2FIN B;  2CVR A;  3S14 B;  3ND8 A;  1B44 D;  2BA1 A;  1HPC A;  2DY7 A;  2C5C A;  4PV1 C;  4A93 B;  2A6E C;  1TQO A;  4PMC A;  1PTO D;  4J8Q A;  5KYL A;  3QIA A;  1MI2 A;  2AQ3 B;  3HEJ A;  3IFD A;  1EOT A;  1Y1V B;  2E2H B;  1SAP A;  3DWP A;  2JA5 B;  1D1K A;  2BCO A;  4M1U B;  4FF1 A;  1QJO A;  4TQU S;  5CGK A;  5FLX E;  4XQQ A;  2RDH A;  1ONL A;  1PXU A;  2OT2 A;  2Z4H A;  4PMW A;  2RQX A;  4DNT B;  1BR9 A;  2Z8L A;  2ICE C;  3VA5 A;  5EKK A;  2M2L A;  1Q1E A;  5DNF A;  5JEA J;  3GP7 A;  2F0K A;  1CZG A;  2M9V A;  4AYB B;  5IGB A;  2JEB I;  4IUU A;  3LX0 A;  1I6H B;  2K6A A;  4V19 0;  4K5X A;  1PTO F;  3W3A A;  1HQM C;  4XYQ A;  2KJX A;  4NMZ A;  3URY A;  2WKD A;  2IWH A;  1PZJ D;  1BXT A;  4DXF A;  2AQ2 B;  2FFK B;  4C3I G;  3K6O A;  5K5P A;  4H13 C;  4FP5 D;  5C4Z A;  3K5N A;  1PRT B;  2K05 A;  2B39 A;  1O7Z A;  2F0S A;  5FLX L;  1TWA B;  1HA6 A;  5COY A;  1V1P A;  1IHZ A;  1BUV T;  2Z4I A;  1KTK A;  3DM1 A;  3GTJ B;  1OXS C;  3HP3 A;  5I6Y A;  3K7A B;  1FNW A;  3K0Y A;  1D5Z C;  2RBM A;  3A7L A;  4ZYS A;  2H1E A;  2EYL A;  2PYK A;  2EOT A;  1Y8O B;  5I2Y A;  4G7O C;  1IYU A;  1SBB B;  2L4N A;  2L9H A;  1R4Q B;  4KHV A;  4C3J G;  4FO2 A;  1SEB D;  1L0Y B;  1LTG D;  1A3V A;  2A6H D;  4S3S A;  1HTL D;  1L0X B;  3VR2 A;  1WD1 A;  4NP5 A;  4K2K A;  1EQV A;  3A8K E;  3AU7 A;  2RSN A;  4TKO B;  4WOR A;  1CI3 M;  1F9Q A;  2JA8 B;  1B9M A;  3A8I E;  5CV6 A;  1JE4 A;  5G3L F;  2NTS A;  4TSS A;  5AFW A;  1EY0 A;  5KYI A;  2PZW A;  4FXG C;  5EBD A;  2A6E D;  4K14 A;  1LTT D;  1Y8P B;  1HHV A;  1EZ8 A;  2FMM A;  4KN4 C;  1SYE A;  3T51 B;  1EEI D;  4O1N A;  1H9J A;  1M8A A;  3P7J A;  1U4M A;  2PO4 A;  1B50 A;  3NE5 B;  2WP8 J;  4ZKC B;  3NWS A;  1RD9 D;  5CV5 A;  3NTK A;  3NWT A;  3R2T A;  1LTI D;  1NCV A;  1I4G A;  3NHH A;  1KDC A;  2BE5 D;  5IGE A;  2K32 A;  4B08 A;  1EY4 A;  3JAM E;  3FKI B;  1Y1W B;  3H3V C;  1PLF A;  1U4L A;  4A3B B;  1STA A;  5C5L A;  1J8I A;  1TKW B;  2E74 C;  4LK1 C;  2YU9 B;  1NR2 A;  1LTB D;  1LLR D;  1HTP A;  3J80 L;  2KUM A;  3VA7 A;  4XQN A;  4KY6 A;  1TS5 A;  1A3U A;  4XT1 B;  4DF7 A;  3D4D A;  3A55 A;  2BDN A;  4R8I A;  5EKL A;  5C3W A;  4F87 A;  1TWG B;  2KQ3 A;  1CA6 A;  5KNC A;  5E4W C;  5JEA H;  2H4O A;  2D5D A;  1GUG A;  3HOU B;  1WTX A;  1WTP A;  3X3M A;  1RF2 D;  1QIL A;  3EFX D;  2F0J A;  1EY7 A;  1V1O A;  1AZP A;  4B9X A;  2XRS D;  1DOL A;  1DOK A;  2CHB D;  4DAY A;  1WD0 A;  2X6L A;  3BVZ A;  4MN3 A;  5CV4 A;  5JOB A;  2KOL A;  2AQ1 B;  4I65 A;  1B3A A;  3IKJ A;  2F0F A;  3V05 A;  2HQE A;  3S15 B;  2L55 A;  2L11 A;  3K5M A;  2G9D A;  2F03 A;  1GUS A;  2SNM A;  3DMU A;  1QWY A;  1SXT A;  1MBY A;  5C4H A;  3BS1 A;  2ZXO A;  1UUP A;  3HS0 C;  2AUJ D;  4KHZ A;  5JVH 3;  1O7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...