2MAPA

Solution structure of the complex formed by the region 2 of e. coli sigmae and its cognate -10 promoter element non template strand tgtcaaa.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords RNA polymerase sigma factor
total genus 28
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2mapA00
5DULA 4GAEA 1RP3A 2WPGA 4ZQFA 4Y6RA 2MAOA 1Q0QA 4AYSA 3UEQA 5JO0A 4CXFA 1R0KA 1SC5A 1S46A 3WQSB 2JD0A 2O7GA 5JNLA 4LUPA 4OOEA 3ANNA 2Y1GA 5JC1A 3ZHXA 4OOFA 3WQQA 3UERA 1MVYA 3ZHYA 5JBIA 3AU8A 2JD1A 2C82A 1MW1A 2Y1FA 3CZLA 3CZEA 4FLQA 1T1SA 4KP7A 2JCYA 1H3LA 1G5AA 2JD2A 4NQWA 4A03A 4RCVA 3ANMA 3IIEA 2JCVA 1JVSA 3AUAA 4ZQEA 4Y6SA 1OR7A 4FLRA 4ZN6A 4ZQHA 1K5HA 4Y6PA 5JMWA 3RASA 2MAPA 3UCQA 3CZKA 2EGHA 2Y1EA 3ZHZA 3A06A 1ONOA 2Y1DA 1ONNA 1R0LA 1T1RA 3AU9A 1MW2A 5JAZA 3T0YA 1JGIA 4AICA 2Y1CA 3A14A 4ZQGA 1MW3A 5JMPA 4FLOA 1ONPA 1Q0LA 4Y67A 3WQRA 3ZI0A 3R0IA 1MW0A 3ANLA 2JCXA 1JG9A 4FLSA 1ZS2A 1Q0HA 3CZGA
chains in the Genus database with same CATH superfamily
4ZW8A 5DULA 4XNBA 4Q4EA 4GAEA 1RP3A 2WPGA 4JNDA 4K5LA 4XN4A 4ZQFA 3B2PA 4Y6RA 2MAOA 2GTQA 4PU2A 1Q0QA 4MKTA 3VVLA 4PW4A 3B3BA 3FTYA 3FU6A 4R5VA 1X3WA 5FWQA 1X3ZA 4QHPA 4AYSA 4QUOA 3B7TA 3KEDA 4XMWA 3UEQA 4FCAA 5JO0A 4CXFA 5BPPA 2RJIA 2ZXGA 2HPOA 4L2LA 1R0KA 4ZW3A 1SC5A 1S46A 3FUDA 3WQSB 2JD0A 3B34A 4ZX4A 3FUHA 2R59A 1SG7A 3B7RL 2O7GA 2PUSA 5JNLA 2R72A 4LUPA 4OOEA 1H19A 3ANNA 4XMZA 2Y1GA 2PGGA 2VJ8A 5JC1A 3ZHXA 3FH8A 4OOFA 4XMUA 5DLLA 3VVMA 3WQQA 4XN9A 3UERA 1MVYA 3ZHYA 5JBIA 3AU8A 3FUKA 3FU3A 2XPYA 4RVBA 3EBIA 2A7OA 3PUUA 2JD1A 2C82A 4R5TA 1MW1A 4MS6A 4Q4IA 2Y1FA 3CZLA 4XNAA 3CZEA 3FULA 4FLQA 1T1SA 4KP7A 4XN8A 4AR8A 2JCYA 2JV7A 1SQMA 1H3LA 4GAAA 3CXBA 1G5AA 1GW6A 2JD2A 2R70A 4NQWA 4A03A 4RCVA 4BKXA 3ANMA 3IIEA 2JCVA 3FU0A 1JVSA 3EBGA 3AUAA 4ZQEA 4Y6SA 2HPTA 2B61A 4ARFA 1OR7A 4FLRA 4ZW7A 4ZN6A 3FUJA 3RC8A 3FUIA 4ZQHA 4XN7A 1K5HA 2DQ6A 2WZGA 3Q43A 4Y6PA 3CHQA 5JMWA 5AENA 3FUMA 4J3BA 3CHOA 4ZW5A 4QIRA 3FUNA 4XMTA 4R7LA 3RASA 2MAPA 3UCQA 2XPZA 4XN5A 2QVWA 3FHEA 2VLAA 3CZKA 3CHSA 2EGHA 4PVBA 2Y1EA 3ZHZA 2WZFA 4XMXA 3A06A 4XO3A 4ZQTA 2XQ0A 4R5XA 1ONOA 4XO4A 2Y1DA 4K5NA 1ONNA 1R0LA 1T1RA 3AU9A 4ZX6A 3FTZA 3T8VA 1MW2A 4QPEA 4ZW6A 4XMVA 3FUEA 3QJXA 4K5PA 3EBHA 5HLTA 3FUFA 5JAZA 3FTUA 3FTSA 2DQMA 4RSYA 4XO5A 1JGIA 3T0YA 5DYFA 4ZX5A 4ZX3A 4AICA 2Y1CA 3A14A 4ZQGA 3Q44A 4K5OA 3FTVA 3CHRA 3FH5A 1MW3A 2PL5A 4DPRA 5JMPA 3FU5A 5HNFA 2QJ1A 4FLOA 4K5MA 1ONPA 2FFLA 1Q0LA 3B7SA 3CHPA 3FTWA 4Y67A 4XN1A 3WQRA 3ZI0A 3R0IA 1MW0A 4AR9A 1HS6A 3B2XA 3ANLA 5EV7A 4XN2A 4X2UA 2JCXA 1JG9A 3HW2A 4AR1A 3B7UX 3B37A 3JT1A 3JSZA 3RC3A 4FLSA 4XNDA 3FTXA 5HNHA 1ZS2A 1Q0HA 3CIAA 3CZGA 3FH7A 3U9WA 2C5ZA 4QMEA
chains in the Genus database with same CATH topology
4ZW8A 5DULA 4XNBA 4Q4EA 4GAEA 1RP3A 2WPGA 4JNDA 4K5LA 4XN4A 4ZQFA 3B2PA 4Y6RA 2MAOA 2GTQA 4PU2A 1Q0QA 4MKTA 3VVLA 4PW4A 3B3BA 3FTYA 3FU6A 4R5VA 1X3WA 5FWQA 1X3ZA 4QHPA 4AYSA 4QUOA 3B7TA 3KEDA 4XMWA 3UEQA 4FCAA 5JO0A 4CXFA 5BPPA 2RJIA 2ZXGA 2HPOA 4L2LA 1R0KA 4ZW3A 1SC5A 1S46A 3FUDA 3WQSB 2JD0A 3B34A 4ZX4A 3FUHA 2R59A 1SG7A 3B7RL 2O7GA 2PUSA 5JNLA 2R72A 4LUPA 4OOEA 1H19A 3ANNA 4XMZA 2Y1GA 2PGGA 2VJ8A 5JC1A 3ZHXA 3FH8A 4OOFA 4XMUA 5DLLA 3VVMA 3WQQA 4XN9A 3UERA 1MVYA 3ZHYA 5JBIA 3AU8A 3FUKA 3FU3A 2XPYA 4RVBA 3EBIA 2A7OA 3PUUA 2JD1A 2C82A 4R5TA 1MW1A 4MS6A 4Q4IA 2Y1FA 3CZLA 4XNAA 3CZEA 3FULA 4FLQA 1T1SA 4KP7A 4XN8A 4AR8A 2JCYA 2JV7A 1SQMA 1H3LA 4GAAA 1G5AA 1GW6A 2JD2A 2R70A 4NQWA 4A03A 4RCVA 4BKXA 3ANMA 3IIEA 2JCVA 3FU0A 1JVSA 3EBGA 3AUAA 4ZQEA 4Y6SA 2HPTA 2B61A 4ARFA 1OR7A 4FLRA 4ZW7A 4ZN6A 3FUJA 3RC8A 3FUIA 4ZQHA 4XN7A 1K5HA 2DQ6A 2WZGA 3Q43A 4Y6PA 3CHQA 5JMWA 5AENA 3FUMA 4J3BA 3CHOA 4ZW5A 4QIRA 3FUNA 4XMTA 4R7LA 3RASA 2MAPA 3UCQA 2XPZA 4XN5A 2QVWA 3FHEA 2VLAA 3CZKA 3CHSA 2EGHA 4PVBA 2Y1EA 3ZHZA 2WZFA 4XMXA 3A06A 4XO3A 4ZQTA 2XQ0A 4R5XA 1ONOA 4XO4A 2Y1DA 4K5NA 1ONNA 1R0LA 1T1RA 3AU9A 4ZX6A 3FTZA 3T8VA 1MW2A 4QPEA 4ZW6A 4XMVA 3FUEA 3QJXA 4K5PA 3EBHA 5HLTA 3FUFA 5JAZA 3FTUA 3FTSA 2DQMA 4RSYA 4XO5A 1JGIA 3T0YA 5DYFA 4ZX5A 4ZX3A 4AICA 2Y1CA 3A14A 4ZQGA 3Q44A 4K5OA 3FTVA 3CHRA 3FH5A 1MW3A 2PL5A 4DPRA 5JMPA 3FU5A 5HNFA 2QJ1A 4FLOA 4K5MA 1ONPA 2FFLA 1Q0LA 3B7SA 3CHPA 3FTWA 4Y67A 4XN1A 3WQRA 3ZI0A 3R0IA 1MW0A 4AR9A 1HS6A 3B2XA 3ANLA 5EV7A 4XN2A 4X2UA 2JCXA 1JG9A 4AR1A 3B7UX 3B37A 3JT1A 3JSZA 3RC3A 4FLSA 4XNDA 3FTXA 5HNHA 1ZS2A 1Q0HA 3CIAA 3CZGA 3FH7A 3U9WA 2C5ZA 4QMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUL A;  4GAE A;  1RP3 A;  2WPG A;  4ZQF A;  4Y6R A;  2MAO A;  1Q0Q A;  4AYS A;  3UEQ A;  5JO0 A;  4CXF A;  1R0K A;  1SC5 A;  1S46 A;  3WQS B;  2JD0 A;  2O7G A;  5JNL A;  4LUP A;  4OOE A;  3ANN A;  2Y1G A;  5JC1 A;  3ZHX A;  4OOF A;  3WQQ A;  3UER A;  1MVY A;  3ZHY A;  5JBI A;  3AU8 A;  2JD1 A;  2C82 A;  1MW1 A;  2Y1F A;  3CZL A;  3CZE A;  4FLQ A;  1T1S A;  4KP7 A;  2JCY A;  1H3L A;  1G5A A;  2JD2 A;  4NQW A;  4A03 A;  4RCV A;  3ANM A;  3IIE A;  2JCV A;  1JVS A;  3AUA A;  4ZQE A;  4Y6S A;  1OR7 A;  4FLR A;  4ZN6 A;  4ZQH A;  1K5H A;  4Y6P A;  5JMW A;  3RAS A;  2MAP A;  3UCQ A;  3CZK A;  2EGH A;  2Y1E A;  3ZHZ A;  3A06 A;  1ONO A;  2Y1D A;  1ONN A;  1R0L A;  1T1R A;  3AU9 A;  1MW2 A;  5JAZ A;  3T0Y A;  1JGI A;  4AIC A;  2Y1C A;  3A14 A;  4ZQG A;  1MW3 A;  5JMP A;  4FLO A;  1ONP A;  1Q0L A;  4Y67 A;  3WQR A;  3ZI0 A;  3R0I A;  1MW0 A;  3ANL A;  2JCX A;  1JG9 A;  4FLS A;  1ZS2 A;  1Q0H A;  3CZG A; 
#chains in the Genus database with same CATH topology
 4ZW8 A;  5DUL A;  4XNB A;  4Q4E A;  4GAE A;  1RP3 A;  2WPG A;  4JND A;  4K5L A;  4XN4 A;  4ZQF A;  3B2P A;  4Y6R A;  2MAO A;  2GTQ A;  4PU2 A;  1Q0Q A;  4MKT A;  3VVL A;  4PW4 A;  3B3B A;  3FTY A;  3FU6 A;  4R5V A;  1X3W A;  5FWQ A;  1X3Z A;  4QHP A;  4AYS A;  4QUO A;  3B7T A;  3KED A;  4XMW A;  3UEQ A;  4FCA A;  5JO0 A;  4CXF A;  5BPP A;  2RJI A;  2ZXG A;  2HPO A;  4L2L A;  1R0K A;  4ZW3 A;  1SC5 A;  1S46 A;  3FUD A;  3WQS B;  2JD0 A;  3B34 A;  4ZX4 A;  3FUH A;  2R59 A;  1SG7 A;  3B7R L;  2O7G A;  2PUS A;  5JNL A;  2R72 A;  4LUP A;  4OOE A;  1H19 A;  3ANN A;  4XMZ A;  2Y1G A;  2PGG A;  2VJ8 A;  5JC1 A;  3ZHX A;  3FH8 A;  4OOF A;  4XMU A;  5DLL A;  3VVM A;  3WQQ A;  4XN9 A;  3UER A;  1MVY A;  3ZHY A;  5JBI A;  3AU8 A;  3FUK A;  3FU3 A;  2XPY A;  4RVB A;  3EBI A;  2A7O A;  3PUU A;  2JD1 A;  2C82 A;  4R5T A;  1MW1 A;  4MS6 A;  4Q4I A;  2Y1F A;  3CZL A;  4XNA A;  3CZE A;  3FUL A;  4FLQ A;  1T1S A;  4KP7 A;  4XN8 A;  4AR8 A;  2JCY A;  2JV7 A;  1SQM A;  1H3L A;  4GAA A;  3CXB A;  1G5A A;  1GW6 A;  2JD2 A;  2R70 A;  4NQW A;  4A03 A;  4RCV A;  4BKX A;  3ANM A;  3IIE A;  2JCV A;  3FU0 A;  1JVS A;  3EBG A;  3AUA A;  4ZQE A;  4Y6S A;  2HPT A;  2B61 A;  4ARF A;  1OR7 A;  4FLR A;  4ZW7 A;  4ZN6 A;  3FUJ A;  3RC8 A;  3FUI A;  4ZQH A;  4XN7 A;  1K5H A;  2DQ6 A;  2WZG A;  3Q43 A;  4Y6P A;  3CHQ A;  5JMW A;  5AEN A;  3FUM A;  4J3B A;  3CHO A;  4ZW5 A;  4QIR A;  3FUN A;  4XMT A;  4R7L A;  3RAS A;  2MAP A;  3UCQ A;  2XPZ A;  4XN5 A;  2QVW A;  3FHE A;  2VLA A;  3CZK A;  3CHS A;  2EGH A;  4PVB A;  2Y1E A;  3ZHZ A;  2WZF A;  4XMX A;  3A06 A;  4XO3 A;  4ZQT A;  2XQ0 A;  4R5X A;  1ONO A;  4XO4 A;  2Y1D A;  4K5N A;  1ONN A;  1R0L A;  1T1R A;  3AU9 A;  4ZX6 A;  3FTZ A;  3T8V A;  1MW2 A;  4QPE A;  4ZW6 A;  4XMV A;  3FUE A;  3QJX A;  4K5P A;  3EBH A;  5HLT A;  3FUF A;  5JAZ A;  3FTU A;  3FTS A;  2DQM A;  4RSY A;  4XO5 A;  1JGI A;  3T0Y A;  5DYF A;  4ZX5 A;  4ZX3 A;  4AIC A;  2Y1C A;  3A14 A;  4ZQG A;  3Q44 A;  4K5O A;  3FTV A;  3CHR A;  3FH5 A;  1MW3 A;  2PL5 A;  4DPR A;  5JMP A;  3FU5 A;  5HNF A;  2QJ1 A;  4FLO A;  4K5M A;  1ONP A;  2FFL A;  1Q0L A;  3B7S A;  3CHP A;  3FTW A;  4Y67 A;  4XN1 A;  3WQR A;  3ZI0 A;  3R0I A;  1MW0 A;  4AR9 A;  1HS6 A;  3B2X A;  3ANL A;  5EV7 A;  4XN2 A;  4X2U A;  2JCX A;  1JG9 A;  3HW2 A;  4AR1 A;  3B7U X;  3B37 A;  3JT1 A;  3JSZ A;  3RC3 A;  4FLS A;  4XND A;  3FTX A;  5HNH A;  1ZS2 A;  1Q0H A;  3CIA A;  3CZG A;  3FH7 A;  3U9W A;  2C5Z A;  4QME A; 
#chains in the Genus database with same CATH homology
 4ZW8 A;  5DUL A;  4XNB A;  4Q4E A;  4GAE A;  1RP3 A;  2WPG A;  4JND A;  4K5L A;  4XN4 A;  4ZQF A;  3B2P A;  4Y6R A;  2MAO A;  2GTQ A;  4PU2 A;  1Q0Q A;  4MKT A;  3VVL A;  4PW4 A;  3B3B A;  3FTY A;  3FU6 A;  4R5V A;  1X3W A;  5FWQ A;  1X3Z A;  4QHP A;  4AYS A;  4QUO A;  3B7T A;  3KED A;  4XMW A;  3UEQ A;  4FCA A;  5JO0 A;  4CXF A;  5BPP A;  2RJI A;  2ZXG A;  2HPO A;  4L2L A;  1R0K A;  4ZW3 A;  1SC5 A;  1S46 A;  3FUD A;  3WQS B;  2JD0 A;  3B34 A;  4ZX4 A;  3FUH A;  2R59 A;  1SG7 A;  3B7R L;  2O7G A;  2PUS A;  5JNL A;  2R72 A;  4LUP A;  4OOE A;  1H19 A;  3ANN A;  4XMZ A;  2Y1G A;  2PGG A;  2VJ8 A;  5JC1 A;  3ZHX A;  3FH8 A;  4OOF A;  4XMU A;  5DLL A;  3VVM A;  3WQQ A;  4XN9 A;  3UER A;  1MVY A;  3ZHY A;  5JBI A;  3AU8 A;  3FUK A;  3FU3 A;  2XPY A;  4RVB A;  3EBI A;  2A7O A;  3PUU A;  2JD1 A;  2C82 A;  4R5T A;  1MW1 A;  4MS6 A;  4Q4I A;  2Y1F A;  3CZL A;  4XNA A;  3CZE A;  3FUL A;  4FLQ A;  1T1S A;  4KP7 A;  4XN8 A;  4AR8 A;  2JCY A;  2JV7 A;  1SQM A;  1H3L A;  4GAA A;  1G5A A;  1GW6 A;  2JD2 A;  2R70 A;  4NQW A;  4A03 A;  4RCV A;  4BKX A;  3ANM A;  3IIE A;  2JCV A;  3FU0 A;  1JVS A;  3EBG A;  3AUA A;  4ZQE A;  4Y6S A;  2HPT A;  2B61 A;  4ARF A;  1OR7 A;  4FLR A;  4ZW7 A;  4ZN6 A;  3FUJ A;  3RC8 A;  3FUI A;  4ZQH A;  4XN7 A;  1K5H A;  2DQ6 A;  2WZG A;  3Q43 A;  4Y6P A;  3CHQ A;  5JMW A;  5AEN A;  3FUM A;  4J3B A;  3CHO A;  4ZW5 A;  4QIR A;  3FUN A;  4XMT A;  4R7L A;  3RAS A;  2MAP A;  3UCQ A;  2XPZ A;  4XN5 A;  2QVW A;  3FHE A;  2VLA A;  3CZK A;  3CHS A;  2EGH A;  4PVB A;  2Y1E A;  3ZHZ A;  2WZF A;  4XMX A;  3A06 A;  4XO3 A;  4ZQT A;  2XQ0 A;  4R5X A;  1ONO A;  4XO4 A;  2Y1D A;  4K5N A;  1ONN A;  1R0L A;  1T1R A;  3AU9 A;  4ZX6 A;  3FTZ A;  3T8V A;  1MW2 A;  4QPE A;  4ZW6 A;  4XMV A;  3FUE A;  3QJX A;  4K5P A;  3EBH A;  5HLT A;  3FUF A;  5JAZ A;  3FTU A;  3FTS A;  2DQM A;  4RSY A;  4XO5 A;  1JGI A;  3T0Y A;  5DYF A;  4ZX5 A;  4ZX3 A;  4AIC A;  2Y1C A;  3A14 A;  4ZQG A;  3Q44 A;  4K5O A;  3FTV A;  3CHR A;  3FH5 A;  1MW3 A;  2PL5 A;  4DPR A;  5JMP A;  3FU5 A;  5HNF A;  2QJ1 A;  4FLO A;  4K5M A;  1ONP A;  2FFL A;  1Q0L A;  3B7S A;  3CHP A;  3FTW A;  4Y67 A;  4XN1 A;  3WQR A;  3ZI0 A;  3R0I A;  1MW0 A;  4AR9 A;  1HS6 A;  3B2X A;  3ANL A;  5EV7 A;  4XN2 A;  4X2U A;  2JCX A;  1JG9 A;  4AR1 A;  3B7U X;  3B37 A;  3JT1 A;  3JSZ A;  3RC3 A;  4FLS A;  4XND A;  3FTX A;  5HNH A;  1ZS2 A;  1Q0H A;  3CIA A;  3CZG A;  3FH7 A;  3U9W A;  2C5Z A;  4QME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...