2MATA

E.coli methionine aminopeptidase at 1.9 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2matA00
2BHDA 3TB5A 1YVMA 4U6ZA 2OAZA 2Q94A 2B3KA 2BWUA 2OKNA 1XNZA 2BWVA 4FLKA 4S2TP 1WKMA 1C22A 4RZZA 2Q95A 4U75A 1WLRA 2BWXA 3PKCA 3MX6A 5FCHA 5JHUA 4U71A 4U70A 1Y1NA 4U73A 3RORA 2HOWA 2EVMA 2DFIA 3CB6A 1QXZA 4IU6A 2GU7A 1B6AA 1WN1A 4MATA 1C23A 1W2MA 1WL9A 1MATA 3PKDA 4A6VA 1XGSA 2GG0A 3FMQA 5JI6A 1O0XA 1C21A 2NQ6A 3MATA 3Q6DA 5CNXA 3IU7A 2Q96A 4JUQA 2V6CA 4HXXA 2BWTA 2V3ZA 2P9AA 4FLIA 4U69A 2ADUA 4U6CA 2BH3A 1M35A 4U1BA 2MATA 3L24A 2BWSA 2EA4A 5CIKA 2BHCA 4KM3A 5CE6A 5D6EA 1B59A 4FLJA 4EGEA 2GG9A 3BIQA 1QXYA 2GG8A 3PKAA 3PKEA 2GU5A 4IKSA 2GGCA 2P99A 4FO8A 1C27A 4RZYA 2G6PA 2GU4A 4U6WA 4IPAA 1QZYA 4U76A 4RGZ1 4IKRA 4QR8A 2Q93A 5CDVA 1R5GA 4IKTA 4IKUA 3IG4A 4ZWUA 1KP0A 1WL6A 4FLLA 1YW9A 1KQ0A 1WBQA 2EVOA 5CDLA 5FCFA 4FO7A 4S01A 1QXWA 2NQ7A 1A16A 4PNCA 2GG7A 3BIPA 1R58A 4S00A 2EA2A 3CB5A 5CLSA 2B3LA 2BHAA 2GU6A 3D27A 4OOKA 5E5BA 4Z7MA 2B3HA 3FM3A 5CDEA 4IECA 2GTXA 3IU8A 2GG5A 2Q92A 3CTZA 4R60A 2ZSGA 2IW2A 2P98A 1YJ3A 1N51A 1PV9A 1YW7A 2EVCA 4PV4A 1XGNA 3PKBA 4U6EA 4IDYA 2BN7A 1R5HA 1CHMA 1C24A 2GA2A 1JAWA 4U6JA 2GG3A 2GZ5A 3L7GA 2BB7A 2V3XA 4FKCA 4ZWPA 1YW8A 2BWYA 1XGOA 2GGBA 4S2RP 4A6WA 1XGMA 3RVAA 2BWWA 2V3YA 1KQ9A 4FUKA 1BN5A 3BITA 3MR1A 3TAVA 1WY2A 3IU9A 1BOAA 2BHBA 5D6FA 2Q8KA 3S6BA 4ZNGA 4B28A 4IF7A 1W7VA 2GG2A 3FMRA 5JFRA 4ZWOA
chains in the Genus database with same CATH superfamily
2BHDA 3TB5A 1YVMA 4U6ZA 2OAZA 2Q94A 2B3KA 2BWUA 2OKNA 1XNZA 2BWVA 4FLKA 4S2TP 1WKMA 1C22A 4RZZA 2Q95A 4U75A 1WLRA 2BWXA 3PKCA 3MX6A 5FCHA 5JHUA 4U71A 4U70A 1Y1NA 4U73A 3RORA 2HOWA 2EVMA 2DFIA 3CB6A 1QXZA 4IU6A 2GU7A 1B6AA 1WN1A 4MATA 1C23A 1W2MA 1WL9A 1MATA 3PKDA 4A6VA 1XGSA 2GG0A 3FMQA 5JI6A 1O0XA 1C21A 2NQ6A 3MATA 3Q6DA 5CNXA 3IU7A 2Q96A 4JUQA 2V6CA 4HXXA 2BWTA 2V3ZA 2P9AA 4FLIA 4U69A 2ADUA 4U6CA 2BH3A 1M35A 4U1BA 2MATA 3L24A 2BWSA 2EA4A 5CIKA 2BHCA 4KM3A 5CE6A 5D6EA 1B59A 4FLJA 4EGEA 2GG9A 3BIQA 1QXYA 2GG8A 3PKAA 3PKEA 2GU5A 4IKSA 2GGCA 2P99A 4FO8A 1C27A 4RZYA 2G6PA 2GU4A 4U6WA 4IPAA 1QZYA 4U76A 4RGZ1 4IKRA 4QR8A 2Q93A 5CDVA 1R5GA 4IKTA 4IKUA 3IG4A 4ZWUA 1KP0A 1WL6A 4FLLA 1YW9A 1KQ0A 1WBQA 2EVOA 5CDLA 5FCFA 4FO7A 4S01A 1QXWA 2NQ7A 1A16A 4PNCA 2GG7A 3BIPA 1R58A 4S00A 2EA2A 3CB5A 5CLSA 2B3LA 2BHAA 2GU6A 3D27A 4OOKA 5E5BA 4Z7MA 2B3HA 3FM3A 5CDEA 4IECA 2GTXA 3IU8A 2GG5A 2Q92A 3CTZA 4R60A 2ZSGA 2IW2A 2P98A 1YJ3A 1N51A 1PV9A 1YW7A 2EVCA 4PV4A 1XGNA 3PKBA 4U6EA 4IDYA 2BN7A 1R5HA 1CHMA 1C24A 2GA2A 1JAWA 4U6JA 2GG3A 2GZ5A 3L7GA 2BB7A 2V3XA 4FKCA 4ZWPA 1YW8A 2BWYA 1XGOA 2GGBA 4S2RP 4A6WA 1XGMA 3RVAA 2BWWA 2V3YA 1KQ9A 4FUKA 1BN5A 3BITA 3MR1A 3TAVA 1WY2A 3IU9A 1BOAA 2BHBA 5D6FA 2Q8KA 3S6BA 4ZNGA 4B28A 4IF7A 1W7VA 2GG2A 3FMRA 5JFRA 4ZWOA
chains in the Genus database with same CATH topology
2BHDA 3TB5A 1YVMA 4U6ZA 2OAZA 2Q94A 2B3KA 2BWUA 2OKNA 1XNZA 2BWVA 4FLKA 4S2TP 1WKMA 1C22A 4RZZA 2Q95A 4U75A 1WLRA 2BWXA 3PKCA 3MX6A 5FCHA 5JHUA 4U71A 4U70A 1Y1NA 4U73A 3RORA 2HOWA 2EVMA 2DFIA 3CB6A 1QXZA 4IU6A 2GU7A 1B6AA 1WN1A 4MATA 1C23A 1W2MA 1WL9A 1MATA 3PKDA 4A6VA 1XGSA 2GG0A 3FMQA 5JI6A 1O0XA 1C21A 2NQ6A 3MATA 3Q6DA 5CNXA 3IU7A 2Q96A 4JUQA 2V6CA 4HXXA 2BWTA 2V3ZA 2P9AA 4FLIA 4U69A 2ADUA 4U6CA 2BH3A 1M35A 4U1BA 2MATA 3L24A 2BWSA 2EA4A 5CIKA 2BHCA 4KM3A 5CE6A 5D6EA 1B59A 4FLJA 4EGEA 2GG9A 3BIQA 1QXYA 2GG8A 3PKAA 3PKEA 2GU5A 4IKSA 2GGCA 2P99A 4FO8A 1C27A 4RZYA 2G6PA 2GU4A 4U6WA 4IPAA 1QZYA 4U76A 4RGZ1 4IKRA 4QR8A 2Q93A 5CDVA 1R5GA 4IKTA 4IKUA 3IG4A 4ZWUA 1KP0A 1WL6A 4FLLA 1YW9A 1KQ0A 1WBQA 2EVOA 5CDLA 5FCFA 4FO7A 4S01A 1QXWA 2NQ7A 1A16A 4PNCA 2GG7A 3BIPA 1R58A 4S00A 2EA2A 3CB5A 5CLSA 2B3LA 2BHAA 2GU6A 3D27A 4OOKA 5E5BA 4Z7MA 2B3HA 3FM3A 5CDEA 4IECA 2GTXA 3IU8A 2GG5A 2Q92A 3CTZA 4R60A 2ZSGA 2IW2A 2P98A 1YJ3A 1N51A 1PV9A 1YW7A 2EVCA 4PV4A 1XGNA 3PKBA 4U6EA 4IDYA 2BN7A 1R5HA 1CHMA 1C24A 2GA2A 1JAWA 4U6JA 2GG3A 2GZ5A 3L7GA 2BB7A 2V3XA 4FKCA 4ZWPA 1YW8A 2BWYA 1XGOA 2GGBA 4S2RP 4A6WA 1XGMA 3RVAA 2BWWA 2V3YA 1KQ9A 4FUKA 1BN5A 3BITA 3MR1A 3TAVA 1WY2A 3IU9A 1BOAA 2BHBA 5D6FA 2Q8KA 3S6BA 4ZNGA 4B28A 4IF7A 1W7VA 2GG2A 3FMRA 5JFRA 4ZWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHD A;  3TB5 A;  1YVM A;  4U6Z A;  2OAZ A;  2Q94 A;  2B3K A;  2BWU A;  2OKN A;  1XNZ A;  2BWV A;  4FLK A;  4S2T P;  1WKM A;  1C22 A;  4RZZ A;  2Q95 A;  4U75 A;  1WLR A;  2BWX A;  3PKC A;  3MX6 A;  5FCH A;  5JHU A;  4U71 A;  4U70 A;  1Y1N A;  4U73 A;  3ROR A;  2HOW A;  2EVM A;  2DFI A;  3CB6 A;  1QXZ A;  4IU6 A;  2GU7 A;  1B6A A;  1WN1 A;  4MAT A;  1C23 A;  1W2M A;  1WL9 A;  1MAT A;  3PKD A;  4A6V A;  1XGS A;  2GG0 A;  3FMQ A;  5JI6 A;  1O0X A;  1C21 A;  2NQ6 A;  3MAT A;  3Q6D A;  5CNX A;  3IU7 A;  2Q96 A;  4JUQ A;  2V6C A;  4HXX A;  2BWT A;  2V3Z A;  2P9A A;  4FLI A;  4U69 A;  2ADU A;  4U6C A;  2BH3 A;  1M35 A;  4U1B A;  2MAT A;  3L24 A;  2BWS A;  2EA4 A;  5CIK A;  2BHC A;  4KM3 A;  5CE6 A;  5D6E A;  1B59 A;  4FLJ A;  4EGE A;  2GG9 A;  3BIQ A;  1QXY A;  2GG8 A;  3PKA A;  3PKE A;  2GU5 A;  4IKS A;  2GGC A;  2P99 A;  4FO8 A;  1C27 A;  4RZY A;  2G6P A;  2GU4 A;  4U6W A;  4IPA A;  1QZY A;  4U76 A;  4RGZ 1;  4IKR A;  4QR8 A;  2Q93 A;  5CDV A;  1R5G A;  4IKT A;  4IKU A;  3IG4 A;  4ZWU A;  1KP0 A;  1WL6 A;  4FLL A;  1YW9 A;  1KQ0 A;  1WBQ A;  2EVO A;  5CDL A;  5FCF A;  4FO7 A;  4S01 A;  1QXW A;  2NQ7 A;  1A16 A;  4PNC A;  2GG7 A;  3BIP A;  1R58 A;  4S00 A;  2EA2 A;  3CB5 A;  5CLS A;  2B3L A;  2BHA A;  2GU6 A;  3D27 A;  4OOK A;  5E5B A;  4Z7M A;  2B3H A;  3FM3 A;  5CDE A;  4IEC A;  2GTX A;  3IU8 A;  2GG5 A;  2Q92 A;  3CTZ A;  4R60 A;  2ZSG A;  2IW2 A;  2P98 A;  1YJ3 A;  1N51 A;  1PV9 A;  1YW7 A;  2EVC A;  4PV4 A;  1XGN A;  3PKB A;  4U6E A;  4IDY A;  2BN7 A;  1R5H A;  1CHM A;  1C24 A;  2GA2 A;  1JAW A;  4U6J A;  2GG3 A;  2GZ5 A;  3L7G A;  2BB7 A;  2V3X A;  4FKC A;  4ZWP A;  1YW8 A;  2BWY A;  1XGO A;  2GGB A;  4S2R P;  4A6W A;  1XGM A;  3RVA A;  2BWW A;  2V3Y A;  1KQ9 A;  4FUK A;  1BN5 A;  3BIT A;  3MR1 A;  3TAV A;  1WY2 A;  3IU9 A;  1BOA A;  2BHB A;  5D6F A;  2Q8K A;  3S6B A;  4ZNG A;  4B28 A;  4IF7 A;  1W7V A;  2GG2 A;  3FMR A;  5JFR A;  4ZWO A; 
#chains in the Genus database with same CATH topology
 2BHD A;  3TB5 A;  1YVM A;  4U6Z A;  2OAZ A;  2Q94 A;  2B3K A;  2BWU A;  2OKN A;  1XNZ A;  2BWV A;  4FLK A;  4S2T P;  1WKM A;  1C22 A;  4RZZ A;  2Q95 A;  4U75 A;  1WLR A;  2BWX A;  3PKC A;  3MX6 A;  5FCH A;  5JHU A;  4U71 A;  4U70 A;  1Y1N A;  4U73 A;  3ROR A;  2HOW A;  2EVM A;  2DFI A;  3CB6 A;  1QXZ A;  4IU6 A;  2GU7 A;  1B6A A;  1WN1 A;  4MAT A;  1C23 A;  1W2M A;  1WL9 A;  1MAT A;  3PKD A;  4A6V A;  1XGS A;  2GG0 A;  3FMQ A;  5JI6 A;  1O0X A;  1C21 A;  2NQ6 A;  3MAT A;  3Q6D A;  5CNX A;  3IU7 A;  2Q96 A;  4JUQ A;  2V6C A;  4HXX A;  2BWT A;  2V3Z A;  2P9A A;  4FLI A;  4U69 A;  2ADU A;  4U6C A;  2BH3 A;  1M35 A;  4U1B A;  2MAT A;  3L24 A;  2BWS A;  2EA4 A;  5CIK A;  2BHC A;  4KM3 A;  5CE6 A;  5D6E A;  1B59 A;  4FLJ A;  4EGE A;  2GG9 A;  3BIQ A;  1QXY A;  2GG8 A;  3PKA A;  3PKE A;  2GU5 A;  4IKS A;  2GGC A;  2P99 A;  4FO8 A;  1C27 A;  4RZY A;  2G6P A;  2GU4 A;  4U6W A;  4IPA A;  1QZY A;  4U76 A;  4RGZ 1;  4IKR A;  4QR8 A;  2Q93 A;  5CDV A;  1R5G A;  4IKT A;  4IKU A;  3IG4 A;  4ZWU A;  1KP0 A;  1WL6 A;  4FLL A;  1YW9 A;  1KQ0 A;  1WBQ A;  2EVO A;  5CDL A;  5FCF A;  4FO7 A;  4S01 A;  1QXW A;  2NQ7 A;  1A16 A;  4PNC A;  2GG7 A;  3BIP A;  1R58 A;  4S00 A;  2EA2 A;  3CB5 A;  5CLS A;  2B3L A;  2BHA A;  2GU6 A;  3D27 A;  4OOK A;  5E5B A;  4Z7M A;  2B3H A;  3FM3 A;  5CDE A;  4IEC A;  2GTX A;  3IU8 A;  2GG5 A;  2Q92 A;  3CTZ A;  4R60 A;  2ZSG A;  2IW2 A;  2P98 A;  1YJ3 A;  1N51 A;  1PV9 A;  1YW7 A;  2EVC A;  4PV4 A;  1XGN A;  3PKB A;  4U6E A;  4IDY A;  2BN7 A;  1R5H A;  1CHM A;  1C24 A;  2GA2 A;  1JAW A;  4U6J A;  2GG3 A;  2GZ5 A;  3L7G A;  2BB7 A;  2V3X A;  4FKC A;  4ZWP A;  1YW8 A;  2BWY A;  1XGO A;  2GGB A;  4S2R P;  4A6W A;  1XGM A;  3RVA A;  2BWW A;  2V3Y A;  1KQ9 A;  4FUK A;  1BN5 A;  3BIT A;  3MR1 A;  3TAV A;  1WY2 A;  3IU9 A;  1BOA A;  2BHB A;  5D6F A;  2Q8K A;  3S6B A;  4ZNG A;  4B28 A;  4IF7 A;  1W7V A;  2GG2 A;  3FMR A;  5JFR A;  4ZWO A; 
#chains in the Genus database with same CATH homology
 2BHD A;  3TB5 A;  1YVM A;  4U6Z A;  2OAZ A;  2Q94 A;  2B3K A;  2BWU A;  2OKN A;  1XNZ A;  2BWV A;  4FLK A;  4S2T P;  1WKM A;  1C22 A;  4RZZ A;  2Q95 A;  4U75 A;  1WLR A;  2BWX A;  3PKC A;  3MX6 A;  5FCH A;  5JHU A;  4U71 A;  4U70 A;  1Y1N A;  4U73 A;  3ROR A;  2HOW A;  2EVM A;  2DFI A;  3CB6 A;  1QXZ A;  4IU6 A;  2GU7 A;  1B6A A;  1WN1 A;  4MAT A;  1C23 A;  1W2M A;  1WL9 A;  1MAT A;  3PKD A;  4A6V A;  1XGS A;  2GG0 A;  3FMQ A;  5JI6 A;  1O0X A;  1C21 A;  2NQ6 A;  3MAT A;  3Q6D A;  5CNX A;  3IU7 A;  2Q96 A;  4JUQ A;  2V6C A;  4HXX A;  2BWT A;  2V3Z A;  2P9A A;  4FLI A;  4U69 A;  2ADU A;  4U6C A;  2BH3 A;  1M35 A;  4U1B A;  2MAT A;  3L24 A;  2BWS A;  2EA4 A;  5CIK A;  2BHC A;  4KM3 A;  5CE6 A;  5D6E A;  1B59 A;  4FLJ A;  4EGE A;  2GG9 A;  3BIQ A;  1QXY A;  2GG8 A;  3PKA A;  3PKE A;  2GU5 A;  4IKS A;  2GGC A;  2P99 A;  4FO8 A;  1C27 A;  4RZY A;  2G6P A;  2GU4 A;  4U6W A;  4IPA A;  1QZY A;  4U76 A;  4RGZ 1;  4IKR A;  4QR8 A;  2Q93 A;  5CDV A;  1R5G A;  4IKT A;  4IKU A;  3IG4 A;  4ZWU A;  1KP0 A;  1WL6 A;  4FLL A;  1YW9 A;  1KQ0 A;  1WBQ A;  2EVO A;  5CDL A;  5FCF A;  4FO7 A;  4S01 A;  1QXW A;  2NQ7 A;  1A16 A;  4PNC A;  2GG7 A;  3BIP A;  1R58 A;  4S00 A;  2EA2 A;  3CB5 A;  5CLS A;  2B3L A;  2BHA A;  2GU6 A;  3D27 A;  4OOK A;  5E5B A;  4Z7M A;  2B3H A;  3FM3 A;  5CDE A;  4IEC A;  2GTX A;  3IU8 A;  2GG5 A;  2Q92 A;  3CTZ A;  4R60 A;  2ZSG A;  2IW2 A;  2P98 A;  1YJ3 A;  1N51 A;  1PV9 A;  1YW7 A;  2EVC A;  4PV4 A;  1XGN A;  3PKB A;  4U6E A;  4IDY A;  2BN7 A;  1R5H A;  1CHM A;  1C24 A;  2GA2 A;  1JAW A;  4U6J A;  2GG3 A;  2GZ5 A;  3L7G A;  2BB7 A;  2V3X A;  4FKC A;  4ZWP A;  1YW8 A;  2BWY A;  1XGO A;  2GGB A;  4S2R P;  4A6W A;  1XGM A;  3RVA A;  2BWW A;  2V3Y A;  1KQ9 A;  4FUK A;  1BN5 A;  3BIT A;  3MR1 A;  3TAV A;  1WY2 A;  3IU9 A;  1BOA A;  2BHB A;  5D6F A;  2Q8K A;  3S6B A;  4ZNG A;  4B28 A;  4IF7 A;  1W7V A;  2GG2 A;  3FMR A;  5JFR A;  4ZWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...