2MATA

E.coli methionine aminopeptidase at 1.9 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2matA00
1C27A 2BHDA 2GU4A 5CNXA 1YW8A 4EGEA 1WY2A 1KQ9A 3PKEA 4IPAA 4RZYA 3RVAA 3TB5A 2B3KA 3PKCA 2GG0A 3FM3A 3RORA 2GU7A 2IW2A 2Q96A 1YJ3A 1QXYA 3CB6A 3IG4A 2GG3A 2EVCA 2P9AA 5FCHA 4IF7A 2BWXA 2BN7A 3PKBA 1WLRA 4U73A 4Z7MA 1N51A 1R5GA 1B59A 3L24A 2BWUA 5CDLA 2Q93A 1QXWA 3S6BA 3BIPA 4OOKA 1W2MA 4MATA 3PKDA 4R60A 1XGNA 2BH3A 5D6EA 4IKSA 4KM3A 2GG9A 1C24A 1QXZA 3CTZA 1JAWA 5FCFA 1XGOA 2P98A 1CHMA 1YW7A 3BITA 2V3YA 2Q92A 2BHCA 3CB5A 1R58A 3FMQA 3MR1A 1YVMA 2GGBA 4S2TP 4U6JA 2B3LA 4HXXA 5CDEA 5JFRA 2GG8A 2GZ5A 2EVMA 4U1BA 2MATA 1YW9A 4IU6A 2V3ZA 1XGMA 1BN5A 3IU9A 2G6PA 2GGCA 1KP0A 1WL6A 2NQ6A 4PNCA 4RGZ1 4S01A 4RZZA 5E5BA 5CDVA 2BHBA 2V3XA 4FLKA 4FO8A 5CE6A 2OAZA 2EA2A 4FO7A 1BOAA 1A16A 4A6VA 4IKRA 1WBQA 1WL9A 1WN1A 2GG5A 4QR8A 2B3HA 2GU5A 3MX6A 3IU8A 1O0XA 2OKNA 2DFIA 4U76A 4U6WA 1MATA 4FKCA 4ZWPA 4ZNGA 4IDYA 4B28A 4U6EA 4U69A 5JHUA 4IKTA 2BWWA 4IECA 4U71A 1XGSA 2NQ7A 4FLLA 2P99A 2BB7A 1Y1NA 2BWSA 5JI6A 2GTXA 3D27A 3L7GA 1XNZA 2ADUA 2V6CA 2BHAA 2Q94A 2GG7A 2ZSGA 3MATA 3Q6DA 4U70A 4FUKA 1C22A 4ZWOA 4JUQA 1W7VA 1PV9A 4U6ZA 1KQ0A 5D6FA 2BWTA 3TAVA 1M35A 4FLJA 1C23A 2BWVA 4S2RP 4FLIA 2BWYA 2EA4A 2GU6A 2Q95A 3IU7A 4PV4A 3FMRA 1QZYA 2GG2A 4S00A 4U6CA 4U75A 4A6WA 4IKUA 4ZWUA 5CIKA 1R5HA 2GA2A 3BIQA 2EVOA 2Q8KA 5CLSA 2HOWA 3PKAA 1B6AA 1WKMA 1C21A
chains in the Genus database with same CATH superfamily
1C27A 2BHDA 2GU4A 5CNXA 1YW8A 4EGEA 1WY2A 1KQ9A 3PKEA 4IPAA 4RZYA 3RVAA 3TB5A 2B3KA 3PKCA 2GG0A 3FM3A 3RORA 2GU7A 2IW2A 2Q96A 1YJ3A 1QXYA 3CB6A 3IG4A 2GG3A 2EVCA 2P9AA 5FCHA 4IF7A 2BWXA 2BN7A 3PKBA 1WLRA 4U73A 4Z7MA 1N51A 1R5GA 1B59A 3L24A 2BWUA 5CDLA 2Q93A 1QXWA 3S6BA 3BIPA 4OOKA 1W2MA 4MATA 3PKDA 4R60A 1XGNA 2BH3A 5D6EA 4IKSA 4KM3A 2GG9A 1C24A 1QXZA 3CTZA 1JAWA 5FCFA 1XGOA 2P98A 1CHMA 1YW7A 3BITA 2V3YA 2Q92A 2BHCA 3CB5A 1R58A 3FMQA 3MR1A 1YVMA 2GGBA 4S2TP 4U6JA 2B3LA 4HXXA 5CDEA 5JFRA 2GG8A 2GZ5A 2EVMA 4U1BA 2MATA 1YW9A 4IU6A 2V3ZA 1XGMA 1BN5A 3IU9A 2G6PA 2GGCA 1KP0A 1WL6A 2NQ6A 4PNCA 4RGZ1 4S01A 4RZZA 5E5BA 5CDVA 2BHBA 2V3XA 4FLKA 4FO8A 5CE6A 2OAZA 2EA2A 4FO7A 1BOAA 1A16A 4A6VA 4IKRA 1WBQA 1WL9A 1WN1A 2GG5A 4QR8A 2B3HA 2GU5A 3MX6A 3IU8A 1O0XA 2OKNA 2DFIA 4U76A 4U6WA 1MATA 4FKCA 4ZWPA 4ZNGA 4IDYA 4B28A 4U6EA 4U69A 5JHUA 4IKTA 2BWWA 4IECA 4U71A 1XGSA 2NQ7A 4FLLA 2P99A 2BB7A 1Y1NA 2BWSA 5JI6A 2GTXA 3D27A 3L7GA 1XNZA 2ADUA 2V6CA 2BHAA 2Q94A 2GG7A 2ZSGA 3MATA 3Q6DA 4U70A 4FUKA 1C22A 4ZWOA 4JUQA 1W7VA 1PV9A 4U6ZA 1KQ0A 5D6FA 2BWTA 3TAVA 1M35A 4FLJA 1C23A 2BWVA 4S2RP 4FLIA 2BWYA 2EA4A 2GU6A 2Q95A 3IU7A 4PV4A 3FMRA 1QZYA 2GG2A 4S00A 4U6CA 4U75A 4A6WA 4IKUA 4ZWUA 5CIKA 1R5HA 2GA2A 3BIQA 2EVOA 2Q8KA 5CLSA 2HOWA 3PKAA 1B6AA 1WKMA 1C21A
chains in the Genus database with same CATH topology
1C27A 2BHDA 2GU4A 5CNXA 1YW8A 4EGEA 1WY2A 1KQ9A 3PKEA 4IPAA 4RZYA 3RVAA 3TB5A 2B3KA 3PKCA 2GG0A 3FM3A 3RORA 2GU7A 2IW2A 2Q96A 1YJ3A 1QXYA 3CB6A 3IG4A 2GG3A 2EVCA 2P9AA 5FCHA 4IF7A 2BWXA 2BN7A 3PKBA 1WLRA 4U73A 4Z7MA 1N51A 1R5GA 1B59A 3L24A 2BWUA 5CDLA 2Q93A 1QXWA 3S6BA 3BIPA 4OOKA 1W2MA 4MATA 3PKDA 4R60A 1XGNA 2BH3A 5D6EA 4IKSA 4KM3A 2GG9A 1C24A 1QXZA 3CTZA 1JAWA 5FCFA 1XGOA 2P98A 1CHMA 1YW7A 3BITA 2V3YA 2Q92A 2BHCA 3CB5A 1R58A 3FMQA 3MR1A 1YVMA 2GGBA 4S2TP 4U6JA 2B3LA 4HXXA 5CDEA 5JFRA 2GG8A 2GZ5A 2EVMA 4U1BA 2MATA 1YW9A 4IU6A 2V3ZA 1XGMA 1BN5A 3IU9A 2G6PA 2GGCA 1KP0A 1WL6A 2NQ6A 4PNCA 4RGZ1 4S01A 4RZZA 5E5BA 5CDVA 2BHBA 2V3XA 4FLKA 4FO8A 5CE6A 2OAZA 2EA2A 4FO7A 1BOAA 1A16A 4A6VA 4IKRA 1WBQA 1WL9A 1WN1A 2GG5A 4QR8A 2B3HA 2GU5A 3MX6A 3IU8A 1O0XA 2OKNA 2DFIA 4U76A 4U6WA 1MATA 4FKCA 4ZWPA 4ZNGA 4IDYA 4B28A 4U6EA 4U69A 5JHUA 4IKTA 2BWWA 4IECA 4U71A 1XGSA 2NQ7A 4FLLA 2P99A 2BB7A 1Y1NA 2BWSA 5JI6A 2GTXA 3D27A 3L7GA 1XNZA 2ADUA 2V6CA 2BHAA 2Q94A 2GG7A 2ZSGA 3MATA 3Q6DA 4U70A 4FUKA 1C22A 4ZWOA 4JUQA 1W7VA 1PV9A 4U6ZA 1KQ0A 5D6FA 2BWTA 3TAVA 1M35A 4FLJA 1C23A 2BWVA 4S2RP 4FLIA 2BWYA 2EA4A 2GU6A 2Q95A 3IU7A 4PV4A 3FMRA 1QZYA 2GG2A 4S00A 4U6CA 4U75A 4A6WA 4IKUA 4ZWUA 5CIKA 1R5HA 2GA2A 3BIQA 2EVOA 2Q8KA 5CLSA 2HOWA 3PKAA 1B6AA 1WKMA 1C21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C27 A;  2BHD A;  2GU4 A;  5CNX A;  1YW8 A;  4EGE A;  1WY2 A;  1KQ9 A;  3PKE A;  4IPA A;  4RZY A;  3RVA A;  3TB5 A;  2B3K A;  3PKC A;  2GG0 A;  3FM3 A;  3ROR A;  2GU7 A;  2IW2 A;  2Q96 A;  1YJ3 A;  1QXY A;  3CB6 A;  3IG4 A;  2GG3 A;  2EVC A;  2P9A A;  5FCH A;  4IF7 A;  2BWX A;  2BN7 A;  3PKB A;  1WLR A;  4U73 A;  4Z7M A;  1N51 A;  1R5G A;  1B59 A;  3L24 A;  2BWU A;  5CDL A;  2Q93 A;  1QXW A;  3S6B A;  3BIP A;  4OOK A;  1W2M A;  4MAT A;  3PKD A;  4R60 A;  1XGN A;  2BH3 A;  5D6E A;  4IKS A;  4KM3 A;  2GG9 A;  1C24 A;  1QXZ A;  3CTZ A;  1JAW A;  5FCF A;  1XGO A;  2P98 A;  1CHM A;  1YW7 A;  3BIT A;  2V3Y A;  2Q92 A;  2BHC A;  3CB5 A;  1R58 A;  3FMQ A;  3MR1 A;  1YVM A;  2GGB A;  4S2T P;  4U6J A;  2B3L A;  4HXX A;  5CDE A;  5JFR A;  2GG8 A;  2GZ5 A;  2EVM A;  4U1B A;  2MAT A;  1YW9 A;  4IU6 A;  2V3Z A;  1XGM A;  1BN5 A;  3IU9 A;  2G6P A;  2GGC A;  1KP0 A;  1WL6 A;  2NQ6 A;  4PNC A;  4RGZ 1;  4S01 A;  4RZZ A;  5E5B A;  5CDV A;  2BHB A;  2V3X A;  4FLK A;  4FO8 A;  5CE6 A;  2OAZ A;  2EA2 A;  4FO7 A;  1BOA A;  1A16 A;  4A6V A;  4IKR A;  1WBQ A;  1WL9 A;  1WN1 A;  2GG5 A;  4QR8 A;  2B3H A;  2GU5 A;  3MX6 A;  3IU8 A;  1O0X A;  2OKN A;  2DFI A;  4U76 A;  4U6W A;  1MAT A;  4FKC A;  4ZWP A;  4ZNG A;  4IDY A;  4B28 A;  4U6E A;  4U69 A;  5JHU A;  4IKT A;  2BWW A;  4IEC A;  4U71 A;  1XGS A;  2NQ7 A;  4FLL A;  2P99 A;  2BB7 A;  1Y1N A;  2BWS A;  5JI6 A;  2GTX A;  3D27 A;  3L7G A;  1XNZ A;  2ADU A;  2V6C A;  2BHA A;  2Q94 A;  2GG7 A;  2ZSG A;  3MAT A;  3Q6D A;  4U70 A;  4FUK A;  1C22 A;  4ZWO A;  4JUQ A;  1W7V A;  1PV9 A;  4U6Z A;  1KQ0 A;  5D6F A;  2BWT A;  3TAV A;  1M35 A;  4FLJ A;  1C23 A;  2BWV A;  4S2R P;  4FLI A;  2BWY A;  2EA4 A;  2GU6 A;  2Q95 A;  3IU7 A;  4PV4 A;  3FMR A;  1QZY A;  2GG2 A;  4S00 A;  4U6C A;  4U75 A;  4A6W A;  4IKU A;  4ZWU A;  5CIK A;  1R5H A;  2GA2 A;  3BIQ A;  2EVO A;  2Q8K A;  5CLS A;  2HOW A;  3PKA A;  1B6A A;  1WKM A;  1C21 A; 
#chains in the Genus database with same CATH topology
 1C27 A;  2BHD A;  2GU4 A;  5CNX A;  1YW8 A;  4EGE A;  1WY2 A;  1KQ9 A;  3PKE A;  4IPA A;  4RZY A;  3RVA A;  3TB5 A;  2B3K A;  3PKC A;  2GG0 A;  3FM3 A;  3ROR A;  2GU7 A;  2IW2 A;  2Q96 A;  1YJ3 A;  1QXY A;  3CB6 A;  3IG4 A;  2GG3 A;  2EVC A;  2P9A A;  5FCH A;  4IF7 A;  2BWX A;  2BN7 A;  3PKB A;  1WLR A;  4U73 A;  4Z7M A;  1N51 A;  1R5G A;  1B59 A;  3L24 A;  2BWU A;  5CDL A;  2Q93 A;  1QXW A;  3S6B A;  3BIP A;  4OOK A;  1W2M A;  4MAT A;  3PKD A;  4R60 A;  1XGN A;  2BH3 A;  5D6E A;  4IKS A;  4KM3 A;  2GG9 A;  1C24 A;  1QXZ A;  3CTZ A;  1JAW A;  5FCF A;  1XGO A;  2P98 A;  1CHM A;  1YW7 A;  3BIT A;  2V3Y A;  2Q92 A;  2BHC A;  3CB5 A;  1R58 A;  3FMQ A;  3MR1 A;  1YVM A;  2GGB A;  4S2T P;  4U6J A;  2B3L A;  4HXX A;  5CDE A;  5JFR A;  2GG8 A;  2GZ5 A;  2EVM A;  4U1B A;  2MAT A;  1YW9 A;  4IU6 A;  2V3Z A;  1XGM A;  1BN5 A;  3IU9 A;  2G6P A;  2GGC A;  1KP0 A;  1WL6 A;  2NQ6 A;  4PNC A;  4RGZ 1;  4S01 A;  4RZZ A;  5E5B A;  5CDV A;  2BHB A;  2V3X A;  4FLK A;  4FO8 A;  5CE6 A;  2OAZ A;  2EA2 A;  4FO7 A;  1BOA A;  1A16 A;  4A6V A;  4IKR A;  1WBQ A;  1WL9 A;  1WN1 A;  2GG5 A;  4QR8 A;  2B3H A;  2GU5 A;  3MX6 A;  3IU8 A;  1O0X A;  2OKN A;  2DFI A;  4U76 A;  4U6W A;  1MAT A;  4FKC A;  4ZWP A;  4ZNG A;  4IDY A;  4B28 A;  4U6E A;  4U69 A;  5JHU A;  4IKT A;  2BWW A;  4IEC A;  4U71 A;  1XGS A;  2NQ7 A;  4FLL A;  2P99 A;  2BB7 A;  1Y1N A;  2BWS A;  5JI6 A;  2GTX A;  3D27 A;  3L7G A;  1XNZ A;  2ADU A;  2V6C A;  2BHA A;  2Q94 A;  2GG7 A;  2ZSG A;  3MAT A;  3Q6D A;  4U70 A;  4FUK A;  1C22 A;  4ZWO A;  4JUQ A;  1W7V A;  1PV9 A;  4U6Z A;  1KQ0 A;  5D6F A;  2BWT A;  3TAV A;  1M35 A;  4FLJ A;  1C23 A;  2BWV A;  4S2R P;  4FLI A;  2BWY A;  2EA4 A;  2GU6 A;  2Q95 A;  3IU7 A;  4PV4 A;  3FMR A;  1QZY A;  2GG2 A;  4S00 A;  4U6C A;  4U75 A;  4A6W A;  4IKU A;  4ZWU A;  5CIK A;  1R5H A;  2GA2 A;  3BIQ A;  2EVO A;  2Q8K A;  5CLS A;  2HOW A;  3PKA A;  1B6A A;  1WKM A;  1C21 A; 
#chains in the Genus database with same CATH homology
 1C27 A;  2BHD A;  2GU4 A;  5CNX A;  1YW8 A;  4EGE A;  1WY2 A;  1KQ9 A;  3PKE A;  4IPA A;  4RZY A;  3RVA A;  3TB5 A;  2B3K A;  3PKC A;  2GG0 A;  3FM3 A;  3ROR A;  2GU7 A;  2IW2 A;  2Q96 A;  1YJ3 A;  1QXY A;  3CB6 A;  3IG4 A;  2GG3 A;  2EVC A;  2P9A A;  5FCH A;  4IF7 A;  2BWX A;  2BN7 A;  3PKB A;  1WLR A;  4U73 A;  4Z7M A;  1N51 A;  1R5G A;  1B59 A;  3L24 A;  2BWU A;  5CDL A;  2Q93 A;  1QXW A;  3S6B A;  3BIP A;  4OOK A;  1W2M A;  4MAT A;  3PKD A;  4R60 A;  1XGN A;  2BH3 A;  5D6E A;  4IKS A;  4KM3 A;  2GG9 A;  1C24 A;  1QXZ A;  3CTZ A;  1JAW A;  5FCF A;  1XGO A;  2P98 A;  1CHM A;  1YW7 A;  3BIT A;  2V3Y A;  2Q92 A;  2BHC A;  3CB5 A;  1R58 A;  3FMQ A;  3MR1 A;  1YVM A;  2GGB A;  4S2T P;  4U6J A;  2B3L A;  4HXX A;  5CDE A;  5JFR A;  2GG8 A;  2GZ5 A;  2EVM A;  4U1B A;  2MAT A;  1YW9 A;  4IU6 A;  2V3Z A;  1XGM A;  1BN5 A;  3IU9 A;  2G6P A;  2GGC A;  1KP0 A;  1WL6 A;  2NQ6 A;  4PNC A;  4RGZ 1;  4S01 A;  4RZZ A;  5E5B A;  5CDV A;  2BHB A;  2V3X A;  4FLK A;  4FO8 A;  5CE6 A;  2OAZ A;  2EA2 A;  4FO7 A;  1BOA A;  1A16 A;  4A6V A;  4IKR A;  1WBQ A;  1WL9 A;  1WN1 A;  2GG5 A;  4QR8 A;  2B3H A;  2GU5 A;  3MX6 A;  3IU8 A;  1O0X A;  2OKN A;  2DFI A;  4U76 A;  4U6W A;  1MAT A;  4FKC A;  4ZWP A;  4ZNG A;  4IDY A;  4B28 A;  4U6E A;  4U69 A;  5JHU A;  4IKT A;  2BWW A;  4IEC A;  4U71 A;  1XGS A;  2NQ7 A;  4FLL A;  2P99 A;  2BB7 A;  1Y1N A;  2BWS A;  5JI6 A;  2GTX A;  3D27 A;  3L7G A;  1XNZ A;  2ADU A;  2V6C A;  2BHA A;  2Q94 A;  2GG7 A;  2ZSG A;  3MAT A;  3Q6D A;  4U70 A;  4FUK A;  1C22 A;  4ZWO A;  4JUQ A;  1W7V A;  1PV9 A;  4U6Z A;  1KQ0 A;  5D6F A;  2BWT A;  3TAV A;  1M35 A;  4FLJ A;  1C23 A;  2BWV A;  4S2R P;  4FLI A;  2BWY A;  2EA4 A;  2GU6 A;  2Q95 A;  3IU7 A;  4PV4 A;  3FMR A;  1QZY A;  2GG2 A;  4S00 A;  4U6C A;  4U75 A;  4A6W A;  4IKU A;  4ZWU A;  5CIK A;  1R5H A;  2GA2 A;  3BIQ A;  2EVO A;  2Q8K A;  5CLS A;  2HOW A;  3PKA A;  1B6A A;  1WKM A;  1C21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...