2MATA

E.coli methionine aminopeptidase at 1.9 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2matA00
4S2TP 1B6AA 3RVAA 2GU6A 3BIPA 1C27A 1XGOA 2BHDA 1YJ3A 4B28A 1B59A 4FLJA 1YW7A 3Q6DA 2GG3A 2V3YA 4FO7A 2ZSGA 4OOKA 4RZYA 2B3KA 4U6EA 4MATA 4RGZ1 5CE6A 4ZWUA 3PKBA 3RORA 1C21A 3S6BA 5JFRA 4U6CA 1KQ0A 2IW2A 5CIKA 3IU9A 3TAVA 2Q92A 4IU6A 1W2MA 4JUQA 2GG9A 1XGNA 1N51A 4U69A 2GU5A 4IKSA 4R60A 2Q93A 1QZYA 2BWUA 3IU8A 2GU7A 1R58A 2BWVA 2B3HA 5D6FA 1WN1A 3FMRA 2BB7A 5CNXA 5CDLA 4IECA 2BWSA 2Q94A 4S01A 1XGMA 2B3LA 1WLRA 4KM3A 5JI6A 3TB5A 2P99A 1PV9A 2OAZA 1WL9A 2Q96A 2BHBA 3PKAA 2BN7A 3D27A 1R5GA 4IDYA 4U70A 3FMQA 2Q8KA 4FLIA 3MX6A 3PKDA 4PV4A 2NQ6A 2P9AA 2EVCA 4FLKA 1WL6A 2EA4A 3BIQA 4S2RP 4FLLA 4Z7MA 2Q95A 5FCHA 3PKEA 2GA2A 3IU7A 4IKUA 1WKMA 5CLSA 2GG5A 2GG8A 2BWWA 3BITA 4U71A 3IG4A 1JAWA 3MATA 1C24A 2MATA 2V3XA 4U73A 1O0XA 2BWXA 1XNZA 3MR1A 5JHUA 1M35A 2GTXA 2V6CA 1C22A 4RZZA 2GG2A 4S00A 5CDEA 3L24A 1W7VA 1YW8A 1XGSA 4IF7A 2BWTA 3CB6A 1WBQA 2ADUA 2GG0A 3FM3A 2BH3A 2OKNA 4U6ZA 2EVOA 4FKCA 4A6WA 4U6WA 4FUKA 1BN5A 1C23A 1MATA 4A6VA 2V3ZA 4HXXA 2GGCA 1R5HA 2G6PA 4PNCA 5FCFA 2BWYA 4EGEA 4U1BA 2EA2A 4U76A 5D6EA 3CTZA 1QXYA 4QR8A 1QXZA 1BOAA 2GGBA 4IPAA 2P98A 3PKCA 4IKRA 2EVMA 2DFIA 4U6JA 2GG7A 1CHMA 2BHAA 2NQ7A 1Y1NA 2BHCA 4FO8A 5CDVA 4ZWPA 2GU4A 1QXWA 1KQ9A 1YVMA 4IKTA 1A16A 3CB5A 1WY2A 4ZWOA 2HOWA 3L7GA 4U75A 1KP0A 5E5BA 2GZ5A 4ZNGA 1YW9A
chains in the Genus database with same CATH superfamily
4S2TP 1B6AA 3RVAA 2GU6A 3BIPA 1C27A 1XGOA 2BHDA 1YJ3A 4B28A 1B59A 4FLJA 1YW7A 3Q6DA 2GG3A 2V3YA 4FO7A 2ZSGA 4OOKA 4RZYA 2B3KA 4U6EA 4MATA 4RGZ1 5CE6A 4ZWUA 3PKBA 3RORA 1C21A 3S6BA 5JFRA 4U6CA 1KQ0A 2IW2A 5CIKA 3IU9A 3TAVA 2Q92A 4IU6A 1W2MA 4JUQA 2GG9A 1XGNA 1N51A 4U69A 2GU5A 4IKSA 4R60A 2Q93A 1QZYA 2BWUA 3IU8A 2GU7A 1R58A 2BWVA 2B3HA 5D6FA 1WN1A 3FMRA 2BB7A 5CNXA 5CDLA 4IECA 2BWSA 2Q94A 4S01A 1XGMA 2B3LA 1WLRA 4KM3A 5JI6A 3TB5A 2P99A 1PV9A 2OAZA 1WL9A 2Q96A 2BHBA 3PKAA 2BN7A 3D27A 1R5GA 4IDYA 4U70A 3FMQA 2Q8KA 4FLIA 3MX6A 3PKDA 4PV4A 2NQ6A 2P9AA 2EVCA 4FLKA 1WL6A 2EA4A 3BIQA 4S2RP 4FLLA 4Z7MA 2Q95A 5FCHA 3PKEA 2GA2A 3IU7A 4IKUA 1WKMA 5CLSA 2GG5A 2GG8A 2BWWA 3BITA 4U71A 3IG4A 1JAWA 3MATA 1C24A 2MATA 2V3XA 4U73A 1O0XA 2BWXA 1XNZA 3MR1A 5JHUA 1M35A 2GTXA 2V6CA 1C22A 4RZZA 2GG2A 4S00A 5CDEA 3L24A 1W7VA 1YW8A 1XGSA 4IF7A 2BWTA 3CB6A 1WBQA 2ADUA 2GG0A 3FM3A 2BH3A 2OKNA 4U6ZA 2EVOA 4FKCA 4A6WA 4U6WA 4FUKA 1BN5A 1C23A 1MATA 4A6VA 2V3ZA 4HXXA 2GGCA 1R5HA 2G6PA 4PNCA 5FCFA 2BWYA 4EGEA 4U1BA 2EA2A 4U76A 5D6EA 3CTZA 1QXYA 4QR8A 1QXZA 1BOAA 2GGBA 4IPAA 2P98A 3PKCA 4IKRA 2EVMA 2DFIA 4U6JA 2GG7A 1CHMA 2BHAA 2NQ7A 1Y1NA 2BHCA 4FO8A 5CDVA 4ZWPA 2GU4A 1QXWA 1KQ9A 1YVMA 4IKTA 1A16A 3CB5A 1WY2A 4ZWOA 2HOWA 3L7GA 4U75A 1KP0A 5E5BA 2GZ5A 4ZNGA 1YW9A
chains in the Genus database with same CATH topology
4S2TP 1B6AA 3RVAA 2GU6A 3BIPA 1C27A 1XGOA 2BHDA 1YJ3A 4B28A 1B59A 4FLJA 1YW7A 3Q6DA 2GG3A 2V3YA 4FO7A 2ZSGA 4OOKA 4RZYA 2B3KA 4U6EA 4MATA 4RGZ1 5CE6A 4ZWUA 3PKBA 3RORA 1C21A 3S6BA 5JFRA 4U6CA 1KQ0A 2IW2A 5CIKA 3IU9A 3TAVA 2Q92A 4IU6A 1W2MA 4JUQA 2GG9A 1XGNA 1N51A 4U69A 2GU5A 4IKSA 4R60A 2Q93A 1QZYA 2BWUA 3IU8A 2GU7A 1R58A 2BWVA 2B3HA 5D6FA 1WN1A 3FMRA 2BB7A 5CNXA 5CDLA 4IECA 2BWSA 2Q94A 4S01A 1XGMA 2B3LA 1WLRA 4KM3A 5JI6A 3TB5A 2P99A 1PV9A 2OAZA 1WL9A 2Q96A 2BHBA 3PKAA 2BN7A 3D27A 1R5GA 4IDYA 4U70A 3FMQA 2Q8KA 4FLIA 3MX6A 3PKDA 4PV4A 2NQ6A 2P9AA 2EVCA 4FLKA 1WL6A 2EA4A 3BIQA 4S2RP 4FLLA 4Z7MA 2Q95A 5FCHA 3PKEA 2GA2A 3IU7A 4IKUA 1WKMA 5CLSA 2GG5A 2GG8A 2BWWA 3BITA 4U71A 3IG4A 1JAWA 3MATA 1C24A 2MATA 2V3XA 4U73A 1O0XA 2BWXA 1XNZA 3MR1A 5JHUA 1M35A 2GTXA 2V6CA 1C22A 4RZZA 2GG2A 4S00A 5CDEA 3L24A 1W7VA 1YW8A 1XGSA 4IF7A 2BWTA 3CB6A 1WBQA 2ADUA 2GG0A 3FM3A 2BH3A 2OKNA 4U6ZA 2EVOA 4FKCA 4A6WA 4U6WA 4FUKA 1BN5A 1C23A 1MATA 4A6VA 2V3ZA 4HXXA 2GGCA 1R5HA 2G6PA 4PNCA 5FCFA 2BWYA 4EGEA 4U1BA 2EA2A 4U76A 5D6EA 3CTZA 1QXYA 4QR8A 1QXZA 1BOAA 2GGBA 4IPAA 2P98A 3PKCA 4IKRA 2EVMA 2DFIA 4U6JA 2GG7A 1CHMA 2BHAA 2NQ7A 1Y1NA 2BHCA 4FO8A 5CDVA 4ZWPA 2GU4A 1QXWA 1KQ9A 1YVMA 4IKTA 1A16A 3CB5A 1WY2A 4ZWOA 2HOWA 3L7GA 4U75A 1KP0A 5E5BA 2GZ5A 4ZNGA 1YW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2T P;  1B6A A;  3RVA A;  2GU6 A;  3BIP A;  1C27 A;  1XGO A;  2BHD A;  1YJ3 A;  4B28 A;  1B59 A;  4FLJ A;  1YW7 A;  3Q6D A;  2GG3 A;  2V3Y A;  4FO7 A;  2ZSG A;  4OOK A;  4RZY A;  2B3K A;  4U6E A;  4MAT A;  4RGZ 1;  5CE6 A;  4ZWU A;  3PKB A;  3ROR A;  1C21 A;  3S6B A;  5JFR A;  4U6C A;  1KQ0 A;  2IW2 A;  5CIK A;  3IU9 A;  3TAV A;  2Q92 A;  4IU6 A;  1W2M A;  4JUQ A;  2GG9 A;  1XGN A;  1N51 A;  4U69 A;  2GU5 A;  4IKS A;  4R60 A;  2Q93 A;  1QZY A;  2BWU A;  3IU8 A;  2GU7 A;  1R58 A;  2BWV A;  2B3H A;  5D6F A;  1WN1 A;  3FMR A;  2BB7 A;  5CNX A;  5CDL A;  4IEC A;  2BWS A;  2Q94 A;  4S01 A;  1XGM A;  2B3L A;  1WLR A;  4KM3 A;  5JI6 A;  3TB5 A;  2P99 A;  1PV9 A;  2OAZ A;  1WL9 A;  2Q96 A;  2BHB A;  3PKA A;  2BN7 A;  3D27 A;  1R5G A;  4IDY A;  4U70 A;  3FMQ A;  2Q8K A;  4FLI A;  3MX6 A;  3PKD A;  4PV4 A;  2NQ6 A;  2P9A A;  2EVC A;  4FLK A;  1WL6 A;  2EA4 A;  3BIQ A;  4S2R P;  4FLL A;  4Z7M A;  2Q95 A;  5FCH A;  3PKE A;  2GA2 A;  3IU7 A;  4IKU A;  1WKM A;  5CLS A;  2GG5 A;  2GG8 A;  2BWW A;  3BIT A;  4U71 A;  3IG4 A;  1JAW A;  3MAT A;  1C24 A;  2MAT A;  2V3X A;  4U73 A;  1O0X A;  2BWX A;  1XNZ A;  3MR1 A;  5JHU A;  1M35 A;  2GTX A;  2V6C A;  1C22 A;  4RZZ A;  2GG2 A;  4S00 A;  5CDE A;  3L24 A;  1W7V A;  1YW8 A;  1XGS A;  4IF7 A;  2BWT A;  3CB6 A;  1WBQ A;  2ADU A;  2GG0 A;  3FM3 A;  2BH3 A;  2OKN A;  4U6Z A;  2EVO A;  4FKC A;  4A6W A;  4U6W A;  4FUK A;  1BN5 A;  1C23 A;  1MAT A;  4A6V A;  2V3Z A;  4HXX A;  2GGC A;  1R5H A;  2G6P A;  4PNC A;  5FCF A;  2BWY A;  4EGE A;  4U1B A;  2EA2 A;  4U76 A;  5D6E A;  3CTZ A;  1QXY A;  4QR8 A;  1QXZ A;  1BOA A;  2GGB A;  4IPA A;  2P98 A;  3PKC A;  4IKR A;  2EVM A;  2DFI A;  4U6J A;  2GG7 A;  1CHM A;  2BHA A;  2NQ7 A;  1Y1N A;  2BHC A;  4FO8 A;  5CDV A;  4ZWP A;  2GU4 A;  1QXW A;  1KQ9 A;  1YVM A;  4IKT A;  1A16 A;  3CB5 A;  1WY2 A;  4ZWO A;  2HOW A;  3L7G A;  4U75 A;  1KP0 A;  5E5B A;  2GZ5 A;  4ZNG A;  1YW9 A; 
#chains in the Genus database with same CATH topology
 4S2T P;  1B6A A;  3RVA A;  2GU6 A;  3BIP A;  1C27 A;  1XGO A;  2BHD A;  1YJ3 A;  4B28 A;  1B59 A;  4FLJ A;  1YW7 A;  3Q6D A;  2GG3 A;  2V3Y A;  4FO7 A;  2ZSG A;  4OOK A;  4RZY A;  2B3K A;  4U6E A;  4MAT A;  4RGZ 1;  5CE6 A;  4ZWU A;  3PKB A;  3ROR A;  1C21 A;  3S6B A;  5JFR A;  4U6C A;  1KQ0 A;  2IW2 A;  5CIK A;  3IU9 A;  3TAV A;  2Q92 A;  4IU6 A;  1W2M A;  4JUQ A;  2GG9 A;  1XGN A;  1N51 A;  4U69 A;  2GU5 A;  4IKS A;  4R60 A;  2Q93 A;  1QZY A;  2BWU A;  3IU8 A;  2GU7 A;  1R58 A;  2BWV A;  2B3H A;  5D6F A;  1WN1 A;  3FMR A;  2BB7 A;  5CNX A;  5CDL A;  4IEC A;  2BWS A;  2Q94 A;  4S01 A;  1XGM A;  2B3L A;  1WLR A;  4KM3 A;  5JI6 A;  3TB5 A;  2P99 A;  1PV9 A;  2OAZ A;  1WL9 A;  2Q96 A;  2BHB A;  3PKA A;  2BN7 A;  3D27 A;  1R5G A;  4IDY A;  4U70 A;  3FMQ A;  2Q8K A;  4FLI A;  3MX6 A;  3PKD A;  4PV4 A;  2NQ6 A;  2P9A A;  2EVC A;  4FLK A;  1WL6 A;  2EA4 A;  3BIQ A;  4S2R P;  4FLL A;  4Z7M A;  2Q95 A;  5FCH A;  3PKE A;  2GA2 A;  3IU7 A;  4IKU A;  1WKM A;  5CLS A;  2GG5 A;  2GG8 A;  2BWW A;  3BIT A;  4U71 A;  3IG4 A;  1JAW A;  3MAT A;  1C24 A;  2MAT A;  2V3X A;  4U73 A;  1O0X A;  2BWX A;  1XNZ A;  3MR1 A;  5JHU A;  1M35 A;  2GTX A;  2V6C A;  1C22 A;  4RZZ A;  2GG2 A;  4S00 A;  5CDE A;  3L24 A;  1W7V A;  1YW8 A;  1XGS A;  4IF7 A;  2BWT A;  3CB6 A;  1WBQ A;  2ADU A;  2GG0 A;  3FM3 A;  2BH3 A;  2OKN A;  4U6Z A;  2EVO A;  4FKC A;  4A6W A;  4U6W A;  4FUK A;  1BN5 A;  1C23 A;  1MAT A;  4A6V A;  2V3Z A;  4HXX A;  2GGC A;  1R5H A;  2G6P A;  4PNC A;  5FCF A;  2BWY A;  4EGE A;  4U1B A;  2EA2 A;  4U76 A;  5D6E A;  3CTZ A;  1QXY A;  4QR8 A;  1QXZ A;  1BOA A;  2GGB A;  4IPA A;  2P98 A;  3PKC A;  4IKR A;  2EVM A;  2DFI A;  4U6J A;  2GG7 A;  1CHM A;  2BHA A;  2NQ7 A;  1Y1N A;  2BHC A;  4FO8 A;  5CDV A;  4ZWP A;  2GU4 A;  1QXW A;  1KQ9 A;  1YVM A;  4IKT A;  1A16 A;  3CB5 A;  1WY2 A;  4ZWO A;  2HOW A;  3L7G A;  4U75 A;  1KP0 A;  5E5B A;  2GZ5 A;  4ZNG A;  1YW9 A; 
#chains in the Genus database with same CATH homology
 4S2T P;  1B6A A;  3RVA A;  2GU6 A;  3BIP A;  1C27 A;  1XGO A;  2BHD A;  1YJ3 A;  4B28 A;  1B59 A;  4FLJ A;  1YW7 A;  3Q6D A;  2GG3 A;  2V3Y A;  4FO7 A;  2ZSG A;  4OOK A;  4RZY A;  2B3K A;  4U6E A;  4MAT A;  4RGZ 1;  5CE6 A;  4ZWU A;  3PKB A;  3ROR A;  1C21 A;  3S6B A;  5JFR A;  4U6C A;  1KQ0 A;  2IW2 A;  5CIK A;  3IU9 A;  3TAV A;  2Q92 A;  4IU6 A;  1W2M A;  4JUQ A;  2GG9 A;  1XGN A;  1N51 A;  4U69 A;  2GU5 A;  4IKS A;  4R60 A;  2Q93 A;  1QZY A;  2BWU A;  3IU8 A;  2GU7 A;  1R58 A;  2BWV A;  2B3H A;  5D6F A;  1WN1 A;  3FMR A;  2BB7 A;  5CNX A;  5CDL A;  4IEC A;  2BWS A;  2Q94 A;  4S01 A;  1XGM A;  2B3L A;  1WLR A;  4KM3 A;  5JI6 A;  3TB5 A;  2P99 A;  1PV9 A;  2OAZ A;  1WL9 A;  2Q96 A;  2BHB A;  3PKA A;  2BN7 A;  3D27 A;  1R5G A;  4IDY A;  4U70 A;  3FMQ A;  2Q8K A;  4FLI A;  3MX6 A;  3PKD A;  4PV4 A;  2NQ6 A;  2P9A A;  2EVC A;  4FLK A;  1WL6 A;  2EA4 A;  3BIQ A;  4S2R P;  4FLL A;  4Z7M A;  2Q95 A;  5FCH A;  3PKE A;  2GA2 A;  3IU7 A;  4IKU A;  1WKM A;  5CLS A;  2GG5 A;  2GG8 A;  2BWW A;  3BIT A;  4U71 A;  3IG4 A;  1JAW A;  3MAT A;  1C24 A;  2MAT A;  2V3X A;  4U73 A;  1O0X A;  2BWX A;  1XNZ A;  3MR1 A;  5JHU A;  1M35 A;  2GTX A;  2V6C A;  1C22 A;  4RZZ A;  2GG2 A;  4S00 A;  5CDE A;  3L24 A;  1W7V A;  1YW8 A;  1XGS A;  4IF7 A;  2BWT A;  3CB6 A;  1WBQ A;  2ADU A;  2GG0 A;  3FM3 A;  2BH3 A;  2OKN A;  4U6Z A;  2EVO A;  4FKC A;  4A6W A;  4U6W A;  4FUK A;  1BN5 A;  1C23 A;  1MAT A;  4A6V A;  2V3Z A;  4HXX A;  2GGC A;  1R5H A;  2G6P A;  4PNC A;  5FCF A;  2BWY A;  4EGE A;  4U1B A;  2EA2 A;  4U76 A;  5D6E A;  3CTZ A;  1QXY A;  4QR8 A;  1QXZ A;  1BOA A;  2GGB A;  4IPA A;  2P98 A;  3PKC A;  4IKR A;  2EVM A;  2DFI A;  4U6J A;  2GG7 A;  1CHM A;  2BHA A;  2NQ7 A;  1Y1N A;  2BHC A;  4FO8 A;  5CDV A;  4ZWP A;  2GU4 A;  1QXW A;  1KQ9 A;  1YVM A;  4IKT A;  1A16 A;  3CB5 A;  1WY2 A;  4ZWO A;  2HOW A;  3L7G A;  4U75 A;  1KP0 A;  5E5B A;  2GZ5 A;  4ZNG A;  1YW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...