2MATA

E.coli methionine aminopeptidase at 1.9 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2matA00
4FKCA 1R58A 2GG5A 3MR1A 4FO8A 5CLSA 5E5BA 2ZSGA 2V3XA 4U69A 2EVOA 2NQ6A 4ZNGA 4ZWUA 4OOKA 3MATA 1C22A 4RGZ1 4Z7MA 4IKSA 1W7VA 1WL6A 4U75A 4FO7A 5CDLA 2MATA 2BWVA 2GA2A 2P98A 4IECA 3CTZA 1YW9A 3BITA 4IPAA 4ZWPA 1XGNA 2GU5A 5CNXA 5JFRA 3L7GA 4HXXA 4IKRA 1WKMA 2BWXA 4MATA 3RORA 4A6VA 4B28A 2BWWA 1QZYA 4IDYA 4PNCA 4U76A 4FUKA 2BWTA 2EA4A 1JAWA 3IG4A 4PV4A 2EVMA 1MATA 1WN1A 2GG3A 3FMQA 2BHDA 1C23A 1WY2A 2GGBA 2V3YA 5FCHA 1PV9A 4QR8A 5JHUA 3S6BA 2Q92A 4U71A 2GG9A 4KM3A 1KQ9A 4JUQA 1O0XA 2GU6A 2BWYA 2B3KA 4U73A 4RZYA 4U6JA 2Q94A 1YJ3A 1KQ0A 3IU8A 4FLIA 4FLLA 1YW8A 3D27A 1YVMA 3PKDA 2G6PA 3BIQA 4FLJA 4IU6A 1M35A 1CHMA 1WBQA 3FMRA 4EGEA 2Q95A 4U6WA 1W2MA 1B59A 2Q8KA 2OAZA 3PKBA 2GG7A 1C21A 1KP0A 2P99A 2IW2A 4ZWOA 5CE6A 5FCFA 4R60A 2HOWA 1R5GA 2V3ZA 1QXWA 1B6AA 3IU7A 1WLRA 2ADUA 3IU9A 1R5HA 4U6CA 1N51A 4FLKA 3CB5A 5JI6A 3FM3A 2B3LA 3CB6A 3L24A 4S2RP 4U6ZA 1XGOA 5D6EA 3TAVA 3PKEA 2DFIA 1XGSA 2GTXA 2BWSA 5D6FA 5CDVA 2GGCA 4U70A 2BHBA 3BIPA 3Q6DA 4S01A 1QXZA 2GU7A 4S00A 4IKTA 4S2TP 2BN7A 1BOAA 2BB7A 1BN5A 2EA2A 2B3HA 2GU4A 4RZZA 1C24A 1XGMA 1QXYA 4U6EA 2OKNA 2BHAA 1WL9A 2GG8A 2Q96A 3TB5A 5CIKA 2BWUA 5CDEA 2GZ5A 3PKAA 3MX6A 4IF7A 3PKCA 2P9AA 2BHCA 2EVCA 2GG0A 2NQ7A 2V6CA 4A6WA 1XNZA 3RVAA 2Q93A 1A16A 2GG2A 4IKUA 1YW7A 2BH3A 1Y1NA 4U1BA 1C27A
chains in the Genus database with same CATH superfamily
4FKCA 1R58A 2GG5A 3MR1A 4FO8A 5CLSA 5E5BA 2ZSGA 2V3XA 4U69A 2EVOA 2NQ6A 4ZNGA 4ZWUA 4OOKA 3MATA 1C22A 4RGZ1 4Z7MA 4IKSA 1W7VA 1WL6A 4U75A 4FO7A 5CDLA 2MATA 2BWVA 2GA2A 2P98A 4IECA 3CTZA 1YW9A 3BITA 4IPAA 4ZWPA 1XGNA 2GU5A 5CNXA 5JFRA 3L7GA 4HXXA 4IKRA 1WKMA 2BWXA 4MATA 3RORA 4A6VA 4B28A 2BWWA 1QZYA 4IDYA 4PNCA 4U76A 4FUKA 2BWTA 2EA4A 1JAWA 3IG4A 4PV4A 2EVMA 1MATA 1WN1A 2GG3A 3FMQA 2BHDA 1C23A 1WY2A 2GGBA 2V3YA 5FCHA 1PV9A 4QR8A 5JHUA 3S6BA 2Q92A 4U71A 2GG9A 4KM3A 1KQ9A 4JUQA 1O0XA 2GU6A 2BWYA 2B3KA 4U73A 4RZYA 4U6JA 2Q94A 1YJ3A 1KQ0A 3IU8A 4FLIA 4FLLA 1YW8A 3D27A 1YVMA 3PKDA 2G6PA 3BIQA 4FLJA 4IU6A 1M35A 1CHMA 1WBQA 3FMRA 4EGEA 2Q95A 4U6WA 1W2MA 1B59A 2Q8KA 2OAZA 3PKBA 2GG7A 1C21A 1KP0A 2P99A 2IW2A 4ZWOA 5CE6A 5FCFA 4R60A 2HOWA 1R5GA 2V3ZA 1QXWA 1B6AA 3IU7A 1WLRA 2ADUA 3IU9A 1R5HA 4U6CA 1N51A 4FLKA 3CB5A 5JI6A 3FM3A 2B3LA 3CB6A 3L24A 4S2RP 4U6ZA 1XGOA 5D6EA 3TAVA 3PKEA 2DFIA 1XGSA 2GTXA 2BWSA 5D6FA 5CDVA 2GGCA 4U70A 2BHBA 3BIPA 3Q6DA 4S01A 1QXZA 2GU7A 4S00A 4IKTA 4S2TP 2BN7A 1BOAA 2BB7A 1BN5A 2EA2A 2B3HA 2GU4A 4RZZA 1C24A 1XGMA 1QXYA 4U6EA 2OKNA 2BHAA 1WL9A 2GG8A 2Q96A 3TB5A 5CIKA 2BWUA 5CDEA 2GZ5A 3PKAA 3MX6A 4IF7A 3PKCA 2P9AA 2BHCA 2EVCA 2GG0A 2NQ7A 2V6CA 4A6WA 1XNZA 3RVAA 2Q93A 1A16A 2GG2A 4IKUA 1YW7A 2BH3A 1Y1NA 4U1BA 1C27A
chains in the Genus database with same CATH topology
4FKCA 1R58A 2GG5A 3MR1A 4FO8A 5CLSA 5E5BA 2ZSGA 2V3XA 4U69A 2EVOA 2NQ6A 4ZNGA 4ZWUA 4OOKA 3MATA 1C22A 4RGZ1 4Z7MA 4IKSA 1W7VA 1WL6A 4U75A 4FO7A 5CDLA 2MATA 2BWVA 2GA2A 2P98A 4IECA 3CTZA 1YW9A 3BITA 4IPAA 4ZWPA 1XGNA 2GU5A 5CNXA 5JFRA 3L7GA 4HXXA 4IKRA 1WKMA 2BWXA 4MATA 3RORA 4A6VA 4B28A 2BWWA 1QZYA 4IDYA 4PNCA 4U76A 4FUKA 2BWTA 2EA4A 1JAWA 3IG4A 4PV4A 2EVMA 1MATA 1WN1A 2GG3A 3FMQA 2BHDA 1C23A 1WY2A 2GGBA 2V3YA 5FCHA 1PV9A 4QR8A 5JHUA 3S6BA 2Q92A 4U71A 2GG9A 4KM3A 1KQ9A 4JUQA 1O0XA 2GU6A 2BWYA 2B3KA 4U73A 4RZYA 4U6JA 2Q94A 1YJ3A 1KQ0A 3IU8A 4FLIA 4FLLA 1YW8A 3D27A 1YVMA 3PKDA 2G6PA 3BIQA 4FLJA 4IU6A 1M35A 1CHMA 1WBQA 3FMRA 4EGEA 2Q95A 4U6WA 1W2MA 1B59A 2Q8KA 2OAZA 3PKBA 2GG7A 1C21A 1KP0A 2P99A 2IW2A 4ZWOA 5CE6A 5FCFA 4R60A 2HOWA 1R5GA 2V3ZA 1QXWA 1B6AA 3IU7A 1WLRA 2ADUA 3IU9A 1R5HA 4U6CA 1N51A 4FLKA 3CB5A 5JI6A 3FM3A 2B3LA 3CB6A 3L24A 4S2RP 4U6ZA 1XGOA 5D6EA 3TAVA 3PKEA 2DFIA 1XGSA 2GTXA 2BWSA 5D6FA 5CDVA 2GGCA 4U70A 2BHBA 3BIPA 3Q6DA 4S01A 1QXZA 2GU7A 4S00A 4IKTA 4S2TP 2BN7A 1BOAA 2BB7A 1BN5A 2EA2A 2B3HA 2GU4A 4RZZA 1C24A 1XGMA 1QXYA 4U6EA 2OKNA 2BHAA 1WL9A 2GG8A 2Q96A 3TB5A 5CIKA 2BWUA 5CDEA 2GZ5A 3PKAA 3MX6A 4IF7A 3PKCA 2P9AA 2BHCA 2EVCA 2GG0A 2NQ7A 2V6CA 4A6WA 1XNZA 3RVAA 2Q93A 1A16A 2GG2A 4IKUA 1YW7A 2BH3A 1Y1NA 4U1BA 1C27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKC A;  1R58 A;  2GG5 A;  3MR1 A;  4FO8 A;  5CLS A;  5E5B A;  2ZSG A;  2V3X A;  4U69 A;  2EVO A;  2NQ6 A;  4ZNG A;  4ZWU A;  4OOK A;  3MAT A;  1C22 A;  4RGZ 1;  4Z7M A;  4IKS A;  1W7V A;  1WL6 A;  4U75 A;  4FO7 A;  5CDL A;  2MAT A;  2BWV A;  2GA2 A;  2P98 A;  4IEC A;  3CTZ A;  1YW9 A;  3BIT A;  4IPA A;  4ZWP A;  1XGN A;  2GU5 A;  5CNX A;  5JFR A;  3L7G A;  4HXX A;  4IKR A;  1WKM A;  2BWX A;  4MAT A;  3ROR A;  4A6V A;  4B28 A;  2BWW A;  1QZY A;  4IDY A;  4PNC A;  4U76 A;  4FUK A;  2BWT A;  2EA4 A;  1JAW A;  3IG4 A;  4PV4 A;  2EVM A;  1MAT A;  1WN1 A;  2GG3 A;  3FMQ A;  2BHD A;  1C23 A;  1WY2 A;  2GGB A;  2V3Y A;  5FCH A;  1PV9 A;  4QR8 A;  5JHU A;  3S6B A;  2Q92 A;  4U71 A;  2GG9 A;  4KM3 A;  1KQ9 A;  4JUQ A;  1O0X A;  2GU6 A;  2BWY A;  2B3K A;  4U73 A;  4RZY A;  4U6J A;  2Q94 A;  1YJ3 A;  1KQ0 A;  3IU8 A;  4FLI A;  4FLL A;  1YW8 A;  3D27 A;  1YVM A;  3PKD A;  2G6P A;  3BIQ A;  4FLJ A;  4IU6 A;  1M35 A;  1CHM A;  1WBQ A;  3FMR A;  4EGE A;  2Q95 A;  4U6W A;  1W2M A;  1B59 A;  2Q8K A;  2OAZ A;  3PKB A;  2GG7 A;  1C21 A;  1KP0 A;  2P99 A;  2IW2 A;  4ZWO A;  5CE6 A;  5FCF A;  4R60 A;  2HOW A;  1R5G A;  2V3Z A;  1QXW A;  1B6A A;  3IU7 A;  1WLR A;  2ADU A;  3IU9 A;  1R5H A;  4U6C A;  1N51 A;  4FLK A;  3CB5 A;  5JI6 A;  3FM3 A;  2B3L A;  3CB6 A;  3L24 A;  4S2R P;  4U6Z A;  1XGO A;  5D6E A;  3TAV A;  3PKE A;  2DFI A;  1XGS A;  2GTX A;  2BWS A;  5D6F A;  5CDV A;  2GGC A;  4U70 A;  2BHB A;  3BIP A;  3Q6D A;  4S01 A;  1QXZ A;  2GU7 A;  4S00 A;  4IKT A;  4S2T P;  2BN7 A;  1BOA A;  2BB7 A;  1BN5 A;  2EA2 A;  2B3H A;  2GU4 A;  4RZZ A;  1C24 A;  1XGM A;  1QXY A;  4U6E A;  2OKN A;  2BHA A;  1WL9 A;  2GG8 A;  2Q96 A;  3TB5 A;  5CIK A;  2BWU A;  5CDE A;  2GZ5 A;  3PKA A;  3MX6 A;  4IF7 A;  3PKC A;  2P9A A;  2BHC A;  2EVC A;  2GG0 A;  2NQ7 A;  2V6C A;  4A6W A;  1XNZ A;  3RVA A;  2Q93 A;  1A16 A;  2GG2 A;  4IKU A;  1YW7 A;  2BH3 A;  1Y1N A;  4U1B A;  1C27 A; 
#chains in the Genus database with same CATH topology
 4FKC A;  1R58 A;  2GG5 A;  3MR1 A;  4FO8 A;  5CLS A;  5E5B A;  2ZSG A;  2V3X A;  4U69 A;  2EVO A;  2NQ6 A;  4ZNG A;  4ZWU A;  4OOK A;  3MAT A;  1C22 A;  4RGZ 1;  4Z7M A;  4IKS A;  1W7V A;  1WL6 A;  4U75 A;  4FO7 A;  5CDL A;  2MAT A;  2BWV A;  2GA2 A;  2P98 A;  4IEC A;  3CTZ A;  1YW9 A;  3BIT A;  4IPA A;  4ZWP A;  1XGN A;  2GU5 A;  5CNX A;  5JFR A;  3L7G A;  4HXX A;  4IKR A;  1WKM A;  2BWX A;  4MAT A;  3ROR A;  4A6V A;  4B28 A;  2BWW A;  1QZY A;  4IDY A;  4PNC A;  4U76 A;  4FUK A;  2BWT A;  2EA4 A;  1JAW A;  3IG4 A;  4PV4 A;  2EVM A;  1MAT A;  1WN1 A;  2GG3 A;  3FMQ A;  2BHD A;  1C23 A;  1WY2 A;  2GGB A;  2V3Y A;  5FCH A;  1PV9 A;  4QR8 A;  5JHU A;  3S6B A;  2Q92 A;  4U71 A;  2GG9 A;  4KM3 A;  1KQ9 A;  4JUQ A;  1O0X A;  2GU6 A;  2BWY A;  2B3K A;  4U73 A;  4RZY A;  4U6J A;  2Q94 A;  1YJ3 A;  1KQ0 A;  3IU8 A;  4FLI A;  4FLL A;  1YW8 A;  3D27 A;  1YVM A;  3PKD A;  2G6P A;  3BIQ A;  4FLJ A;  4IU6 A;  1M35 A;  1CHM A;  1WBQ A;  3FMR A;  4EGE A;  2Q95 A;  4U6W A;  1W2M A;  1B59 A;  2Q8K A;  2OAZ A;  3PKB A;  2GG7 A;  1C21 A;  1KP0 A;  2P99 A;  2IW2 A;  4ZWO A;  5CE6 A;  5FCF A;  4R60 A;  2HOW A;  1R5G A;  2V3Z A;  1QXW A;  1B6A A;  3IU7 A;  1WLR A;  2ADU A;  3IU9 A;  1R5H A;  4U6C A;  1N51 A;  4FLK A;  3CB5 A;  5JI6 A;  3FM3 A;  2B3L A;  3CB6 A;  3L24 A;  4S2R P;  4U6Z A;  1XGO A;  5D6E A;  3TAV A;  3PKE A;  2DFI A;  1XGS A;  2GTX A;  2BWS A;  5D6F A;  5CDV A;  2GGC A;  4U70 A;  2BHB A;  3BIP A;  3Q6D A;  4S01 A;  1QXZ A;  2GU7 A;  4S00 A;  4IKT A;  4S2T P;  2BN7 A;  1BOA A;  2BB7 A;  1BN5 A;  2EA2 A;  2B3H A;  2GU4 A;  4RZZ A;  1C24 A;  1XGM A;  1QXY A;  4U6E A;  2OKN A;  2BHA A;  1WL9 A;  2GG8 A;  2Q96 A;  3TB5 A;  5CIK A;  2BWU A;  5CDE A;  2GZ5 A;  3PKA A;  3MX6 A;  4IF7 A;  3PKC A;  2P9A A;  2BHC A;  2EVC A;  2GG0 A;  2NQ7 A;  2V6C A;  4A6W A;  1XNZ A;  3RVA A;  2Q93 A;  1A16 A;  2GG2 A;  4IKU A;  1YW7 A;  2BH3 A;  1Y1N A;  4U1B A;  1C27 A; 
#chains in the Genus database with same CATH homology
 4FKC A;  1R58 A;  2GG5 A;  3MR1 A;  4FO8 A;  5CLS A;  5E5B A;  2ZSG A;  2V3X A;  4U69 A;  2EVO A;  2NQ6 A;  4ZNG A;  4ZWU A;  4OOK A;  3MAT A;  1C22 A;  4RGZ 1;  4Z7M A;  4IKS A;  1W7V A;  1WL6 A;  4U75 A;  4FO7 A;  5CDL A;  2MAT A;  2BWV A;  2GA2 A;  2P98 A;  4IEC A;  3CTZ A;  1YW9 A;  3BIT A;  4IPA A;  4ZWP A;  1XGN A;  2GU5 A;  5CNX A;  5JFR A;  3L7G A;  4HXX A;  4IKR A;  1WKM A;  2BWX A;  4MAT A;  3ROR A;  4A6V A;  4B28 A;  2BWW A;  1QZY A;  4IDY A;  4PNC A;  4U76 A;  4FUK A;  2BWT A;  2EA4 A;  1JAW A;  3IG4 A;  4PV4 A;  2EVM A;  1MAT A;  1WN1 A;  2GG3 A;  3FMQ A;  2BHD A;  1C23 A;  1WY2 A;  2GGB A;  2V3Y A;  5FCH A;  1PV9 A;  4QR8 A;  5JHU A;  3S6B A;  2Q92 A;  4U71 A;  2GG9 A;  4KM3 A;  1KQ9 A;  4JUQ A;  1O0X A;  2GU6 A;  2BWY A;  2B3K A;  4U73 A;  4RZY A;  4U6J A;  2Q94 A;  1YJ3 A;  1KQ0 A;  3IU8 A;  4FLI A;  4FLL A;  1YW8 A;  3D27 A;  1YVM A;  3PKD A;  2G6P A;  3BIQ A;  4FLJ A;  4IU6 A;  1M35 A;  1CHM A;  1WBQ A;  3FMR A;  4EGE A;  2Q95 A;  4U6W A;  1W2M A;  1B59 A;  2Q8K A;  2OAZ A;  3PKB A;  2GG7 A;  1C21 A;  1KP0 A;  2P99 A;  2IW2 A;  4ZWO A;  5CE6 A;  5FCF A;  4R60 A;  2HOW A;  1R5G A;  2V3Z A;  1QXW A;  1B6A A;  3IU7 A;  1WLR A;  2ADU A;  3IU9 A;  1R5H A;  4U6C A;  1N51 A;  4FLK A;  3CB5 A;  5JI6 A;  3FM3 A;  2B3L A;  3CB6 A;  3L24 A;  4S2R P;  4U6Z A;  1XGO A;  5D6E A;  3TAV A;  3PKE A;  2DFI A;  1XGS A;  2GTX A;  2BWS A;  5D6F A;  5CDV A;  2GGC A;  4U70 A;  2BHB A;  3BIP A;  3Q6D A;  4S01 A;  1QXZ A;  2GU7 A;  4S00 A;  4IKT A;  4S2T P;  2BN7 A;  1BOA A;  2BB7 A;  1BN5 A;  2EA2 A;  2B3H A;  2GU4 A;  4RZZ A;  1C24 A;  1XGM A;  1QXY A;  4U6E A;  2OKN A;  2BHA A;  1WL9 A;  2GG8 A;  2Q96 A;  3TB5 A;  5CIK A;  2BWU A;  5CDE A;  2GZ5 A;  3PKA A;  3MX6 A;  4IF7 A;  3PKC A;  2P9A A;  2BHC A;  2EVC A;  2GG0 A;  2NQ7 A;  2V6C A;  4A6W A;  1XNZ A;  3RVA A;  2Q93 A;  1A16 A;  2GG2 A;  4IKU A;  1YW7 A;  2BH3 A;  1Y1N A;  4U1B A;  1C27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...