2MAWA

Nmr structures of the alpha7 nachr transmembrane domain.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
b'EEELYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPSTSDSSPSIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGEGGGEGIDRLCLMAFSVFTIICTIGILMSAPNFVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit alpha-7
publication title Insights into distinct modulation of alpha 7 and alpha 7 beta 2 nicotinic acetylcholine receptors by the volatile anesthetic isoflurane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 42
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2mawA00
5HEUA 4IL9A 3UU8A 4LMJA 3UQ7A 2LKHA 3TLUA 3EAMA 5L4HA 2MAWA 4HFEA 3RQUA 3UU4A 5HEGA 3JAEA 5J0ZA 3TLTA 2KSRA 4ILAA 2XQ4A 3UU3A 3EHZA 4IREA 4F8HA 3JAFA 4HFBA 3RQWA 2XQ3A 2YN6A 3EI0A 2LKGA 3P4WA 4LMLA 4HFIA 3TLVA 2YKSA 4TWDA 2BG9B 2M6BA 5LG3A 4TWFA 2XQ6A 2XQ9A 4A97A 4X5TA 4COFA 4ILCA 4HFHA 5CFBA 3ZKRA 2LLYA 5HEHA 3P50A 5L47A 4Z90A 3RIFA 1OEDB 3RHWA 4HFCA 4Z91A 4TNWA 3JADA 4QH5A 2BG9C 5HEJA 3LSVA 4IL4A 3UQ4A 1OEDA 4TNVA 2M6IA 2XQ8A 4NPPA 2BG9A 3UU6A 3UUBA 3RIAA 2XQAA 4QH4A 2LM2A 3TLSA 2YOEA 4A98A 4QH1A 4LMKA 2VL0A 5HEOA 5L4EA 1OEDC 4ZZCA 4ILBA 5HCJA 5HCMA 1OEDE 4HFDA 2XQ7A 4ZZBA 3TLWA 3RI5A 2BG9E 3UU5A 5IUXA 2XQ5A 4TWHA
chains in the Genus database with same CATH superfamily
2NOXA 4ZOLE 1HNZT 3AEEA 4JI3T 1US7B 4HFEA 1YQ3A 2IMLA 3TLTA 4B3RT 3AXJA 3FBZA 3MZKB 4EV6A 4NUVA 3EI0A 2Q9QA 3QB5A 2XPKA 4HFIA 4YLHA 4IHJE 2A3DA 3WAJA 5JH7E 3TKLB 4O2BE 3IEEA 5ABFA 1H7CA 4GKKT 2J1DG 3ESLA 3SFEA 2X0YA 5ETWA 1MMDA 3RIFA 5M4YA 5BMVE 4TNWA 3LK2B 2V7LA 4QH5A 1XWMA 4MBQA 3ZJ1A 2LE8A 4ZS3A 1VRBA 3RC3A 2L3LA 5LHHB 2I6HA 4PNIA 2XM2A 4WYVA 3FBLA 3RX6A 2J4GA 3K3QC 5ABHA 4IIJE 3C4XA 5CB4E 1WYCA 2XHEB 5FY1A 3FZMB 5FXWA 1UGOA 3OTOT 3FXEB 2UXBT 1XNQT 5H6RB 5H6QB 2BS2A 2C5KT 1ZV4X 4MLKA 5J0ZA 3PUGA 2JQKA 3LFMA 3AE7A 3PUAA 4IREA 3ZSSA 3EDUA 3MKDA 2LHNA 2QRXA 5J1GA 3RKOA 3IA3A 3Q5EA 3CVRA 3PDYA 3AEAA 5FVKA 3PE0A 2PBIA 1SHZC 2ODVA 4IE4A 4JI8T 2XTLA 5CJ5A 4JI5T 2XQ6A 5EK2A 4IE5A 4QXHB 4COFA 4HTEA 2H7VC 1SE7A 4PJMA 4F6RC 1CUNA 5AQNB 4O4LE 5KMGP 4NUUA 3CMLA 1MNDA 1XMOT 3NVOA 3T1HT 3VKGA 2BBJA 2OV9A 1FIOA 4AIUA 3AA6B 2WSSV 3OJAA 4ASKA 4EGWA 2GK9A 4UR9A 3QC9A 3UU6A 2KXPB 3ZYKA 2VWAA 1GQEA 5AQLB 2W0GA 2YDQA 2YOEA 3D0TA 2YK0A 3C51A 4C90A 5HCMA 3TLWA 2KZ7B 2JQHA 4TWHA 4B3MT 2A9UA 3RYCE 3ZSTA 2YEVC 2YU1A 1D1BA 5CA0E 4CQIA 4YTNA 1UUSA 3N2KE 2R6GF 3KV5A 2RA1A 3EUHA 1HR0T 1G8XA 3AEFA 3P4WA 1T72A 4N78D 5F3JA 3WAKA 2UUAT 2V7JA 1BR4A 4GOUA 4H9NC 2OLTA 4B3TT 3UFEA 3UTKA 5FL0A 3T1YT 3I0OA 3OVUA 1MIVA 2MYSA 4BJMA 5LHIB 3E22E 3IBPA 2HN1A 3PV0F 4CXWA 2K9AA 1JNZA 2HN2A 3S4UA 5CGMA 2ODUA 4TX5A 3DTOA 1WYBA 4UVCB 4DMWA 5BR8T 5JVDE 1M62A 4JYAT 3AECA 5IYZE 4QH1A 5L4EA 3UUXB 3H37A 2YU2A 4IE7A 5FXXA 2Z6EA 4DO0A 4LFBT 1XDOA 3UUNA 3KV9A 2KMFA 2XQ5A 2XAGB 5JR9C 4LMJA 2XJ7A 4NXNT 3UFGA 1W09A 3GA8A 1J5ET 4ILUA 2DHRA 3ZEFB 4DR5T 2FJEA 4DNDA 1J1JA 5LOVE 3Q5WA 4UVBB 2DLRA 4LF6T 2BG9B 4PFPA 2E5LT 3GN5B 2X9YA 5KXJA 3W15B 3NRXA 1LVKA 1LKXA 2CLYC 3AE8A 3E08A 3U78A 5LG4A 2MTQA 4IDZA 1HX8A 4KHPT 3AE9A 4AKLA 3ONLC 3VRBA 2VL8A 4AI6A 4B3ST 3VRAA 3J9X1 4DV7T 3MXZA 4X1YE 1ZEEA 3RRWA 3ZMVB 2XQAA 5AQHB 2CCQA 2W63A 2VQET 4BAYB 2DI4A 3AE1A 3SOLA 3CX8B 4X66T 4ZZBA 2H7OA 2V6YA 4UXNB 2JMKA 2V8SV 1LRZA 2FJDA 1EZ3A 3RGLA 4UIGA 4X20E 3ZC1A 3L39A 3Q9DA 4IE0A 4OYKA 4QXCB 1HX1B 2HH7A 5FYMA 2VKDA 2CWOA 2V7MA 2CMRA 3AVSA 3F2EA 4I50E 3OBVE 2MPKA 2YKSA 1KK7A 4XBFB 4A56A 4YXDA 1FEWA 1NEKA 2CLYB 4HKAA 1JNRA 2K3WA 4JI0T 2BS3A 5AQSB 4O4JE 2CWYA 4HEAA 2RPAA 3O4XE 5FKYA 3PTRB 4DBQA 1IBMT 3BQKA 3LDQB 3LBXA 4K0KT 4G2AA 3LSVA 4IL4A 3JC6C 2LM9A 5L3EB 4CN1A 5JDGA 5FNVE 3CQGB 4GKJT 5TAOA 4LFAT 3ZLIA 4LMKA 4L0RA 2DCFA 4ILBA 2E9XA 2D2SA 3HKDE 2XQ7A 2V1DB 2VVSA 2Y6XA 3R6NA 3C98B 3N9PA 4ERRA 3EAMA 5AQKB 2X9HA 2LOPA 2UU9T 3P7IA 3BK9A 4G63A 4TV9E 4UELA 4HWCA 4DV1T 4U74A 4P0AA 1FMWA 3R84B 2WCAA 2ACZA 4UEMA 1MIYA 3ZMUB 3RKGA 3KV4A 2V7KA 2G0UA 4CN4A 3N5LA 3Q5DA 1YD8G 4H9QC 1OXZA 3QUJA 2IC9A 1X79A 2I59A 5CFBA 2DL1A 2WWVA 4L9IA 2I0MA 3JC6D 3FZHB 1VOMA 3ZCIA 2EHOC 1OEDB 4YHJA 2M67A 3PJAA 2E2AA 2W00A 3P4QA 4DV3T 3ONXA 4U3CA 3AAEB 3P4RA 3ZT6A 2VKJA 4TV8E 2WM9A 4DV4T 2XUEA 4I55E 1VCTA 4TNVA 5FVLA 3KDSE 4U7IA 2P9BA 3PJAJ 2BVLA 3VR9A 4A98A 4LF4T 1UCUA 2Q9QB 4U72A 4ZZCA 3I1AA 5JQGE 5LJNA 3OPCA 4QX7B 3RPUA 1MMNA 3AEBA 3AE4A 2QA7A 3ANWB 3SRZA 5HEUA 2FJAA 3QK6A 4AQGA 2JPFA 2NTYA 2VK9A 3UU8A 3UQ7A 3HKBE 1E7PA 5JDQA 2MOZA 5HEGA 2B76A 3ZMTB 5LB7B 1YQ4A 4YHHT 4ILAA 1VCSA 4ZHQE 2X9XA 4H63V 3CQXC 3I9YA 3O9XA 2CE7A 2X0LB 2N2NA 1UX4A 1J5WA 4PK5A 5HWXA 3PUSA 4LMLA 3H3MA 3ZT5A 4WNKA 4DMVA 2K5BB 4OHFA 3ZYLA 2BKNA 4PJNA 2EHOD 2DNXA 3AE5A 3CX7B 5EK4A 4ZI2C 2XSBA 3P50A 2EHOB 2J47A 4YJ2E 1WCRA 4JI2T 3VHLA 1UURA 4Z91A 2JMHA 5HYAA 3SFDA 2ZM0A 4DV5T 4UF0B 1O3XA 4CXYA 3RLFF 3V5SA 3UUBA 4DBRA 3ETUA 2LOSA 1BR0A 2WU5A 5L2LA 1OEDE 2KWIB 4AXPA 3NKZA 2YDRA 5LYJE 2WZHA 4JI7T 3AA7B 4X1KE 2CHNA 5L3GB 4AISA 2JRKA 3B5MA 3MJXA 1T98A 4ADZA 4A5XA 2WBLA 5AQMB 1Z8UA 2XQYA 2PJQA 3AE6A 5LMNT 1WFDA 3Q5XA 2WAUA 3EVYA 5IWAT 4TWDA 1N36T 4KHZF 4ZI2D 2M6BA 3ABVA 5LP6E 5LG3A 1T7SA 2WDRA 5F5WA 2WB5A 4A97A 2NWBA 2D0UA 2CPTA 2YINA 3ONJA 2AE9A 3RYIE 4YY3T 2PG8A 1E1HB 3X1DA 3N9MA 4ISTA 3AEDA 2V26A 5AQJB 4X1IE 2CXFA 1U5PA 2KT9A 2BG9C 5AQOB 4TUYE 4CI2B 1HG2A 4NPPA 4PFOA 2NW8A 4E7ZA 4CI3B 2L8KA 3DP7A 5LGTB 5JDNA 3PU3A 1IBLT 4JLEA 2ZMAA 2RP4A 1SA0E 2UXDT 4J2CA 4U31A 1N34T 2XM1A 3LG7A 2C5IT 3FZKB 2UXCT 1N33T 4HWHA 3MACA 3RH3A 3UULA 4XAXB 4I43B 4H63H 3CIRA 5LNKA 2LHRA 3M3ZB 3M65A 1CHUA 5LBQB 4C91A 3K8PC 4I4TE 3C64A 4DVDA 2BZBA 5EK3A 2UUBT 2V5DA 2XAHB 3NZQA 1WR0A 4XZCA 3C50A 5JRCB 3BQLA 3HKCE 1XMQT 4PK4A 2VB6A 4GK5E 4X5TA 2LRKA 5L3BB 2LSGA 4HN9A 5A1LA 4ISSA 2A72A 5HEHA 5C3JA 1D0XA 1U4QA 1HF8A 3MK7C 4ZI3C 5HAXA 3GN5A 1W0BA 5GONE 3CWZB 3RHWA 1YKHB 1NAFA 2C5JA 5FL1A 2IUBA 3L09A 1HG5A 2ZLYA 2H88A 3A5XA 4YFSA 4JBWF 3N2OA 4IT4A 5DQWA 5LBMA 3K1SA 3TLSA 3GWHA 3QB5K 4GK0E 5HXRA 2OA5A 4MFRA 5AQFB 2VVNA 2WZIA 2F4VT 3RIUC 3FZFB 4OYJA 5L3FB 2YDSA 1FJGT 2CA5A 2BKOA 4DR4T 5FMNA 4PK6A 3TLUA 4X64T 4ZEYA 1IBKT 4JEUB 3ETVA 5JR9A 3JAEA 4JV5T 3PUVF 1WRDA 1W0AA 3MA9A 4IE6A 4WZXA 3J7Yq 4CN6A 3ZC0A 2PTFA 2VKHA 3AEGA 3TLVA 4EIWA 3EABA 1IJ6A 4KBMB 3LK3B 5F8PA 2JJ9A 2WMOA 4ZI3D 3NZPA 5HWYA 2XQ9A 4EEBA 1BR1A 4TN7B 4CZZB 2WMNA 4HWIB 3PU8A 2WQYA 2UXXB 3EDVA 4HFCA 4JI1T 4EOZB 4M1PA 3AA1B 4EB6E 3H3AA 2X67A 2NTXA 5JREA 5L3DB 5LHGB 4JI4T 3N9NA 2XASB 3V5UA 5AQQB 2N1GA 3RYHE 4DIDB 1OEDC 2X66A 5LA6E 1V9DA 2BG9E 2PFVA 5AQPB 2CXLA 2KWHA 4Q25A 2LT3A 3E0ZA 2IIUA 3RC8A 4EAHA 2HPLA 2LKHA 4PAGA 2K48A 2MAWA 1ZKEA 2DWKA 4PJLA 2Q9QC 3JCFA 2CXDA 2LSIA 5AQUB 4OFZA 4F8HA 5J2UE 3CQCB 3CKDA 1Y64B 3NBXX 1Z0PA 3RRCA 2JQQA 4BJNA 1YW0A 1T8BA 4EXTA 4KP3C 2FJBA 4JI6T 4AKRB 5KDMC 5HXSA 4U7YA 3FHNA 1MMAA 2CM0A 4YT0A 2ZM2A 3RYFE 3I0QA 2X0HA 3AE2A 2D0TA 2CBJA 4U2YA 4Z90A 4MALA 2X9WA 4YJ3E 4P09A 2W67A 1WR6A 2XZEA 3N9OA 3KFWX 1BR2A 3JADA 4IDNA 5AQRB 4WBOA 3UQ4A 2NP9A 2QVAA 3CK6A 1OEDA 3ZJ2A 3RIAA 3WI3A 1XNRT 2CHOA 5JDHA 4DR3T 4AKGA 4L5GA 4LF8T 4AQFC 4HFDA 4U2ZA 4UV8B 2VQFT 1HCIA 4X65T 4FI5A 3ZT7A 4ZI7E 2WY2A 2Q9QD 2Y48B 2UUCT 1DU2A 1MIWA 3N2GE 4CXXA 3AXJB 1WLXA 3P4SA 2MBGA 3NWIA 3KBUA 1XZYA 1HS7A 2CRBA 3ANWA 4K0UA 1KF6A 3PUYF 3RQWA 5ABFB 3ZYMA 4I0UA 3IF8B 4ZS2A 2VURA 4MHCA 2IW5B 1I94T 5FY7A 2SPCA 5LGUB 2VASA 1IAPA 4LF7T 2KNDA 5DQVA 2Y8DA 4OX9T 2V5CA 4YSXA 1D1AA 5L3CB 2WDQA 2KINB 5EZYE 3BQIA 1N32T 3Q2MA 3HKEE 2W61A 1UK5A 4YTMA 4P1NA 4GYSA 2EHOA 2NW9A 3HL6A 2M6IA 4V1Av 5JTGA 2J62A 3NRYA 4AQFA 5AQTB 3N9LA 4CI1B 1E2AA 2IDOB 4HE8A 4UF0A 4DV6T 3DJBA 1ZP0A 5IUXA 2BBHA 2W2UA 1HFAA 2DWGA 4QKNA 4KUMB 3AB3B 3OYXA 4TZ4C 5CA1E 1SUMB 3RQUA 3L8RA 2JQ9A 4KI0F 5AQGB 1B7TA 3ZN0B 2D5UA 2KSRA 2X68A 2AXDS 4QXBB 4O4HE 3JAFA 4FJOA 2C0SA 3KBTA 2LKGA 4HWFA 5KX5E 5LJMA 4E7SA 3PUXF 4EYYR 3A8YC 1G73A 3VU7H 3KINB 5HXHA 2L9QA 2LSKA 5LCYA 2WWUA 4DR6T 2IC6A 2LSJA 4DR7T 1KNPA 3ZCJA 2XY8B 4H9PC 1KNRA 2CEAA 1D0ZA 2H3RA 3FB2A 1L0VA 1KNZA 3CX6B 2H89A 5C8YE 1Y01A 3F31A 3F57A 3K3NA 5AQVB 2A2FX 2X51A 2W4XA 1LVFA 4IGUA 1W9RA 4QH4A 3G06A 4GYRA 5FY0A 3HI2A 3RF1A 4DV0T 2IHR1 2LRLA 3HR0A 3LK42 3N9QA 4EYUA 1M7KA 3AAIA 4WW0A 3CPZA 4NIQA 4EZHA 5LMUT 4GIWA 4DV2T 5DABA 3OYZA 3PURA 3PUWF 2YN6A 4Z8XA 4OK0A 2FUPA 3I9WA 1IJ5A 2ZM6T 4JUYA 2BVMA 4TWFA 5JDFA 3HA4A 4UVAB 4NXMT 5JRCA 2QGSA 4QHOA 4QX8B 2LSYA 5AFUL 3C4WA 4HGAA 1HTJF 5ABGA 1YXRA 1IZNB 4H9RC 2XAJB 4EZ4A 4O8SA 3FXDB 4H9SE 2W66A 4YTPA 3ZPOA 5FP3A 3ZN1B 4LF9T 2JIWA 2BG9A 3GMIA 2KLQA 4WBNE 2LM2A 3VR8A 4DR2T 3AE3A 3P4PA 2VL0A 4H9OC 4BA9A 2VKOA 5HCJA 4YSZA 2BS4A 4U33A 2LEHA 2V6XA 2N9DA 3O1JA 3UU5A 1YKEB 3LJCA 2BDEA 5IHYA 1ZHCA 3UT5E 2V7IA 5FXZA 3UU4A 3OKQA 2ES0A 5ADXL 4AQYT 3UU3A 1QUUA 4HFVA 4AKIA 3QNUA 4PW8A 4IDPA 1I6ZA 5HXEA 4LF5T 1QLBA 2UXNB 1QSDA 2D9DA 3KVAA 4QWNB 2WS3A 1UX5A 2QYWA 4HFHA 2LLYA 3ZMZB 5L47A 2K24A 4P0BA 4LFCT 1R8IA 3L3PA 3VKHA 2WP9A 1NWMX 5JDLA 2FBWA 3U3IA 2ACXA 5E0OA 4DUYT 2LJLA 5FXVA 5JR9B 3ZMSB 2XQ8A 5J2TE 4IDQA 2E9XC 1OWAA 3UUMA 3C4ZA 4X62T 2V6YB 2NR4A 5HEOA 3O1IA 5ABEA 2HPJA 5LXTE 1KEYA 4EEDA 4ANJA 1D0YA 2W62A 1ZOYA 3PUZF 4O4IE 3AAAB 4IL9A 2WDVA 5AQIB 2E8IA 4UV9B 3RIUA 1MMGA 2IAKA 5L4HA 3AVRA 2XSAA 5JDMA 4YSYA 1KFYA 4KX6A 2XQ4A 3EHZA 2CBIA 4HFBA 3PUQA 2XQ3A 1S35A 2ZM8A 5DJQC 2BKPA 1FMVA 4ZXLA 3A7MA 3P8CD 4O2AE 3IHRA 3LBXB 4ILCA 3KVBA 3ZKRA 5C2TA 4JEHB 3SS1A 4PJJA 3FZLB 1HNWT 4IDOA 3B57A 2XAQB 2HHHT 2E9XD 2XAFB 3O1HA 3AA0B 5HEJA 4B6XA 4HWDA 1MNEA 3T8OA 1X9BA 1NENA 3QOFA 2E5VA 2E9XB 2NW7A 1XDPA 4DR1T 3B13A 3K3OA 4KMCA 5LGNB 2B1EA 4DUZT 5HXCA 3SWHA 1D1CA 3KV6A 1AJ3A 2WU2A 1HNXT 1S94A 3RI5A 4AKHA
chains in the Genus database with same CATH topology
5HEUA 4IL9A 3UU8A 4LMJA 3UQ7A 2LKHA 3TLUA 3EAMA 5L4HA 2MAWA 4HFEA 3RQUA 3UU4A 5HEGA 3JAEA 5J0ZA 3TLTA 2KSRA 4ILAA 2XQ4A 3UU3A 3EHZA 4IREA 4F8HA 3JAFA 4HFBA 3RQWA 2XQ3A 2YN6A 3EI0A 2LKGA 3P4WA 4LMLA 4HFIA 3TLVA 2YKSA 4TWDA 2BG9B 2M6BA 5LG3A 4TWFA 2XQ6A 2XQ9A 4A97A 4X5TA 4COFA 4ILCA 4HFHA 5CFBA 3ZKRA 2LLYA 5HEHA 3P50A 5L47A 4Z90A 3RIFA 1OEDB 3RHWA 4HFCA 4Z91A 4TNWA 3JADA 4QH5A 2BG9C 5HEJA 3LSVA 4IL4A 3UQ4A 1OEDA 4TNVA 2M6IA 2XQ8A 4NPPA 2BG9A 3UU6A 3UUBA 3RIAA 2XQAA 4QH4A 2LM2A 3TLSA 2YOEA 4A98A 4QH1A 4LMKA 2VL0A 5HEOA 5L4EA 1OEDC 4ZZCA 4ILBA 5HCJA 5HCMA 1OEDE 4HFDA 2XQ7A 4ZZBA 3TLWA 3RI5A 2BG9E 3UU5A 5IUXA 2XQ5A 4TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  4IL9 A;  3UU8 A;  4LMJ A;  3UQ7 A;  2LKH A;  3TLU A;  3EAM A;  5L4H A;  2MAW A;  4HFE A;  3RQU A;  3UU4 A;  5HEG A;  3JAE A;  5J0Z A;  3TLT A;  2KSR A;  4ILA A;  2XQ4 A;  3UU3 A;  3EHZ A;  4IRE A;  4F8H A;  3JAF A;  4HFB A;  3RQW A;  2XQ3 A;  2YN6 A;  3EI0 A;  2LKG A;  3P4W A;  4LML A;  4HFI A;  3TLV A;  2YKS A;  4TWD A;  2BG9 B;  2M6B A;  5LG3 A;  4TWF A;  2XQ6 A;  2XQ9 A;  4A97 A;  4X5T A;  4COF A;  4ILC A;  4HFH A;  5CFB A;  3ZKR A;  2LLY A;  5HEH A;  3P50 A;  5L47 A;  4Z90 A;  3RIF A;  1OED B;  3RHW A;  4HFC A;  4Z91 A;  4TNW A;  3JAD A;  4QH5 A;  2BG9 C;  5HEJ A;  3LSV A;  4IL4 A;  3UQ4 A;  1OED A;  4TNV A;  2M6I A;  2XQ8 A;  4NPP A;  2BG9 A;  3UU6 A;  3UUB A;  3RIA A;  2XQA A;  4QH4 A;  2LM2 A;  3TLS A;  2YOE A;  4A98 A;  4QH1 A;  4LMK A;  2VL0 A;  5HEO A;  5L4E A;  1OED C;  4ZZC A;  4ILB A;  5HCJ A;  5HCM A;  1OED E;  4HFD A;  2XQ7 A;  4ZZB A;  3TLW A;  3RI5 A;  2BG9 E;  3UU5 A;  5IUX A;  2XQ5 A;  4TWH A; 
#chains in the Genus database with same CATH topology
 2NOX A;  4ZOL E;  1HNZ T;  3AEE A;  4JI3 T;  1US7 B;  4HFE A;  1YQ3 A;  2IML A;  3TLT A;  4B3R T;  3AXJ A;  3FBZ A;  3MZK B;  4EV6 A;  4NUV A;  3EI0 A;  2Q9Q A;  3QB5 A;  2XPK A;  4HFI A;  4YLH A;  4IHJ E;  2A3D A;  3WAJ A;  5JH7 E;  3TKL B;  4O2B E;  3IEE A;  5ABF A;  1H7C A;  4GKK T;  2J1D G;  3ESL A;  3SFE A;  2X0Y A;  5ETW A;  1MMD A;  3RIF A;  5M4Y A;  5BMV E;  4TNW A;  3LK2 B;  2V7L A;  4QH5 A;  1XWM A;  4MBQ A;  3ZJ1 A;  2LE8 A;  4ZS3 A;  1VRB A;  3RC3 A;  2L3L A;  5LHH B;  2I6H A;  4PNI A;  2XM2 A;  4WYV A;  3FBL A;  3RX6 A;  2J4G A;  3K3Q C;  5ABH A;  4IIJ E;  3C4X A;  5CB4 E;  1WYC A;  2XHE B;  5FY1 A;  3FZM B;  5FXW A;  1UGO A;  3OTO T;  3FXE B;  2UXB T;  1XNQ T;  5H6R B;  5H6Q B;  2BS2 A;  2C5K T;  1ZV4 X;  4MLK A;  5J0Z A;  3PUG A;  2JQK A;  3LFM A;  3AE7 A;  3PUA A;  4IRE A;  3ZSS A;  3EDU A;  3MKD A;  2LHN A;  2QRX A;  5J1G A;  3RKO A;  3IA3 A;  3Q5E A;  3CVR A;  3PDY A;  3AEA A;  5FVK A;  3PE0 A;  2PBI A;  1SHZ C;  2ODV A;  4IE4 A;  4JI8 T;  2XTL A;  5CJ5 A;  4JI5 T;  2XQ6 A;  5EK2 A;  4IE5 A;  4QXH B;  4COF A;  4HTE A;  2H7V C;  1SE7 A;  4PJM A;  4F6R C;  1CUN A;  5AQN B;  4O4L E;  5KMG P;  4NUU A;  3CML A;  1MND A;  1XMO T;  3NVO A;  3T1H T;  3VKG A;  2BBJ A;  2OV9 A;  1FIO A;  4AIU A;  3AA6 B;  2WSS V;  3OJA A;  4ASK A;  4EGW A;  2GK9 A;  4UR9 A;  3QC9 A;  3UU6 A;  2KXP B;  3ZYK A;  2VWA A;  1GQE A;  5AQL B;  2W0G A;  2YDQ A;  2YOE A;  3D0T A;  2YK0 A;  3C51 A;  4C90 A;  5HCM A;  3TLW A;  2KZ7 B;  2JQH A;  4TWH A;  4B3M T;  2A9U A;  3RYC E;  3ZST A;  2YEV C;  2YU1 A;  1D1B A;  5CA0 E;  4CQI A;  4YTN A;  1UUS A;  3N2K E;  2R6G F;  3KV5 A;  2RA1 A;  3EUH A;  1HR0 T;  1G8X A;  3AEF A;  3P4W A;  1T72 A;  4N78 D;  5F3J A;  3WAK A;  2UUA T;  2V7J A;  1BR4 A;  4GOU A;  4H9N C;  2OLT A;  4B3T T;  3UFE A;  3UTK A;  5FL0 A;  3T1Y T;  3I0O A;  3OVU A;  1MIV A;  2MYS A;  4BJM A;  5LHI B;  3E22 E;  3IBP A;  2HN1 A;  3PV0 F;  4CXW A;  2K9A A;  1JNZ A;  2HN2 A;  3S4U A;  5CGM A;  2ODU A;  4TX5 A;  3DTO A;  1WYB A;  4UVC B;  4DMW A;  5BR8 T;  5JVD E;  1M62 A;  4JYA T;  3AEC A;  5IYZ E;  4QH1 A;  5L4E A;  3UUX B;  3H37 A;  2YU2 A;  4IE7 A;  5FXX A;  2Z6E A;  4DO0 A;  4LFB T;  1XDO A;  3UUN A;  3KV9 A;  2KMF A;  2XQ5 A;  2XAG B;  5JR9 C;  4LMJ A;  2XJ7 A;  4NXN T;  3UFG A;  1W09 A;  3GA8 A;  1J5E T;  4ILU A;  2DHR A;  3ZEF B;  4DR5 T;  2FJE A;  4DND A;  1J1J A;  5LOV E;  3Q5W A;  4UVB B;  2DLR A;  4LF6 T;  2BG9 B;  4PFP A;  2E5L T;  3GN5 B;  2X9Y A;  5KXJ A;  3W15 B;  3NRX A;  1LVK A;  1LKX A;  2CLY C;  3AE8 A;  3E08 A;  3U78 A;  5LG4 A;  2MTQ A;  4IDZ A;  1HX8 A;  4KHP T;  3AE9 A;  4AKL A;  3ONL C;  3VRB A;  2VL8 A;  4AI6 A;  4B3S T;  3VRA A;  3J9X 1;  4DV7 T;  3MXZ A;  4X1Y E;  1ZEE A;  3RRW A;  3ZMV B;  2XQA A;  5AQH B;  2CCQ A;  2W63 A;  2VQE T;  4BAY B;  2DI4 A;  3AE1 A;  3SOL A;  3CX8 B;  4X66 T;  4ZZB A;  2H7O A;  2V6Y A;  4UXN B;  2JMK A;  2V8S V;  1LRZ A;  2FJD A;  1EZ3 A;  3RGL A;  4UIG A;  4X20 E;  3ZC1 A;  3L39 A;  3Q9D A;  4IE0 A;  4OYK A;  4QXC B;  1HX1 B;  2HH7 A;  5FYM A;  2VKD A;  2CWO A;  2V7M A;  2CMR A;  3AVS A;  3F2E A;  4I50 E;  3OBV E;  2MPK A;  2YKS A;  1KK7 A;  4XBF B;  4A56 A;  4YXD A;  1FEW A;  1NEK A;  2CLY B;  4HKA A;  1JNR A;  2K3W A;  4JI0 T;  2BS3 A;  5AQS B;  4O4J E;  2CWY A;  4HEA A;  2RPA A;  3O4X E;  5FKY A;  3PTR B;  4DBQ A;  1IBM T;  3BQK A;  3LDQ B;  3LBX A;  4K0K T;  4G2A A;  3LSV A;  4IL4 A;  3JC6 C;  2LM9 A;  5L3E B;  4CN1 A;  5JDG A;  5FNV E;  3CQG B;  4GKJ T;  5TAO A;  4LFA T;  3ZLI A;  4LMK A;  4L0R A;  2DCF A;  4ILB A;  2E9X A;  2D2S A;  3HKD E;  2XQ7 A;  2V1D B;  2VVS A;  2Y6X A;  3R6N A;  3C98 B;  3N9P A;  4ERR A;  3EAM A;  5AQK B;  2X9H A;  2LOP A;  2UU9 T;  3P7I A;  3BK9 A;  4G63 A;  4TV9 E;  4UEL A;  4HWC A;  4DV1 T;  4U74 A;  4P0A A;  1FMW A;  3R84 B;  2WCA A;  2ACZ A;  4UEM A;  1MIY A;  3ZMU B;  3RKG A;  3KV4 A;  2V7K A;  2G0U A;  4CN4 A;  3N5L A;  3Q5D A;  1YD8 G;  4H9Q C;  1OXZ A;  3QUJ A;  2IC9 A;  1X79 A;  2I59 A;  5CFB A;  2DL1 A;  2WWV A;  4L9I A;  2I0M A;  3JC6 D;  3FZH B;  1VOM A;  3ZCI A;  2EHO C;  1OED B;  4YHJ A;  2M67 A;  3PJA A;  2E2A A;  2W00 A;  3P4Q A;  4DV3 T;  3ONX A;  4U3C A;  3AAE B;  3P4R A;  3ZT6 A;  2VKJ A;  4TV8 E;  2WM9 A;  4DV4 T;  2XUE A;  4I55 E;  1VCT A;  4TNV A;  5FVL A;  3KDS E;  4U7I A;  2P9B A;  3PJA J;  2BVL A;  3VR9 A;  4A98 A;  4LF4 T;  1UCU A;  2Q9Q B;  4U72 A;  4ZZC A;  3I1A A;  5JQG E;  5LJN A;  3OPC A;  4QX7 B;  3RPU A;  1MMN A;  3AEB A;  3AE4 A;  2QA7 A;  3ANW B;  3SRZ A;  5HEU A;  2FJA A;  3QK6 A;  4AQG A;  2JPF A;  2NTY A;  2VK9 A;  3UU8 A;  3UQ7 A;  3HKB E;  1E7P A;  5JDQ A;  2MOZ A;  5HEG A;  2B76 A;  3ZMT B;  5LB7 B;  1YQ4 A;  4YHH T;  4ILA A;  1VCS A;  4ZHQ E;  2X9X A;  4H63 V;  3CQX C;  3I9Y A;  3O9X A;  2CE7 A;  2X0L B;  2N2N A;  1UX4 A;  1J5W A;  4PK5 A;  5HWX A;  3PUS A;  4LML A;  3H3M A;  3ZT5 A;  4WNK A;  4DMV A;  2K5B B;  4OHF A;  3ZYL A;  2BKN A;  4PJN A;  2EHO D;  2DNX A;  3AE5 A;  3CX7 B;  5EK4 A;  4ZI2 C;  2XSB A;  3P50 A;  2EHO B;  2J47 A;  4YJ2 E;  1WCR A;  4JI2 T;  3VHL A;  1UUR A;  4Z91 A;  2JMH A;  5HYA A;  3SFD A;  2ZM0 A;  4DV5 T;  4UF0 B;  1O3X A;  4CXY A;  3RLF F;  3V5S A;  3UUB A;  4DBR A;  3ETU A;  2LOS A;  1BR0 A;  2WU5 A;  5L2L A;  1OED E;  2KWI B;  4AXP A;  3NKZ A;  2YDR A;  5LYJ E;  2WZH A;  4JI7 T;  3AA7 B;  4X1K E;  2CHN A;  5L3G B;  4AIS A;  2JRK A;  3B5M A;  3MJX A;  1T98 A;  4ADZ A;  4A5X A;  2WBL A;  5AQM B;  1Z8U A;  2XQY A;  2PJQ A;  3AE6 A;  5LMN T;  1WFD A;  3Q5X A;  2WAU A;  3EVY A;  5IWA T;  4TWD A;  1N36 T;  4KHZ F;  4ZI2 D;  2M6B A;  3ABV A;  5LP6 E;  5LG3 A;  1T7S A;  2WDR A;  5F5W A;  2WB5 A;  4A97 A;  2NWB A;  2D0U A;  2CPT A;  2YIN A;  3ONJ A;  2AE9 A;  3RYI E;  4YY3 T;  2PG8 A;  1E1H B;  3X1D A;  3N9M A;  4IST A;  3AED A;  2V26 A;  5AQJ B;  4X1I E;  2CXF A;  1U5P A;  2KT9 A;  2BG9 C;  5AQO B;  4TUY E;  4CI2 B;  1HG2 A;  4NPP A;  4PFO A;  2NW8 A;  4E7Z A;  4CI3 B;  2L8K A;  3DP7 A;  5LGT B;  5JDN A;  3PU3 A;  1IBL T;  4JLE A;  2ZMA A;  2RP4 A;  1SA0 E;  2UXD T;  4J2C A;  4U31 A;  1N34 T;  2XM1 A;  3LG7 A;  2C5I T;  3FZK B;  2UXC T;  1N33 T;  4HWH A;  3MAC A;  3RH3 A;  3UUL A;  4XAX B;  4I43 B;  4H63 H;  3CIR A;  5LNK A;  2LHR A;  3M3Z B;  3M65 A;  1CHU A;  5LBQ B;  4C91 A;  3K8P C;  4I4T E;  3C64 A;  4DVD A;  2BZB A;  5EK3 A;  2UUB T;  2V5D A;  2XAH B;  3NZQ A;  1WR0 A;  4XZC A;  3C50 A;  5JRC B;  3BQL A;  3HKC E;  1XMQ T;  4PK4 A;  2VB6 A;  4GK5 E;  4X5T A;  2LRK A;  5L3B B;  2LSG A;  4HN9 A;  5A1L A;  4ISS A;  2A72 A;  5HEH A;  5C3J A;  1D0X A;  1U4Q A;  1HF8 A;  3MK7 C;  4ZI3 C;  5HAX A;  3GN5 A;  1W0B A;  5GON E;  3CWZ B;  3RHW A;  1YKH B;  1NAF A;  2C5J A;  5FL1 A;  2IUB A;  3L09 A;  1HG5 A;  2ZLY A;  2H88 A;  3A5X A;  4YFS A;  4JBW F;  3N2O A;  4IT4 A;  5DQW A;  5LBM A;  3K1S A;  3TLS A;  3GWH A;  3QB5 K;  4GK0 E;  5HXR A;  2OA5 A;  4MFR A;  5AQF B;  2VVN A;  2WZI A;  2F4V T;  3RIU C;  3FZF B;  4OYJ A;  5L3F B;  2YDS A;  1FJG T;  2CA5 A;  2BKO A;  4DR4 T;  5FMN A;  4PK6 A;  3TLU A;  4X64 T;  4ZEY A;  1IBK T;  4JEU B;  3ETV A;  5JR9 A;  3JAE A;  4JV5 T;  3PUV F;  1WRD A;  1W0A A;  3MA9 A;  4IE6 A;  4WZX A;  3J7Y q;  4CN6 A;  3ZC0 A;  2PTF A;  2VKH A;  3AEG A;  3TLV A;  4EIW A;  3EAB A;  1IJ6 A;  4KBM B;  3LK3 B;  5F8P A;  2JJ9 A;  2WMO A;  4ZI3 D;  3NZP A;  5HWY A;  2XQ9 A;  4EEB A;  1BR1 A;  4TN7 B;  4CZZ B;  2WMN A;  4HWI B;  3PU8 A;  2WQY A;  2UXX B;  3EDV A;  4HFC A;  4JI1 T;  4EOZ B;  4M1P A;  3AA1 B;  4EB6 E;  3H3A A;  2X67 A;  2NTX A;  5JRE A;  5L3D B;  5LHG B;  4JI4 T;  3N9N A;  2XAS B;  3V5U A;  5AQQ B;  2N1G A;  3RYH E;  4DID B;  1OED C;  2X66 A;  5LA6 E;  1V9D A;  2BG9 E;  2PFV A;  5AQP B;  2CXL A;  2KWH A;  4Q25 A;  2LT3 A;  3E0Z A;  2IIU A;  3RC8 A;  4EAH A;  2HPL A;  2LKH A;  4PAG A;  2K48 A;  2MAW A;  1ZKE A;  2DWK A;  4PJL A;  2Q9Q C;  3JCF A;  2CXD A;  2LSI A;  5AQU B;  4OFZ A;  4F8H A;  5J2U E;  3CQC B;  3CKD A;  1Y64 B;  3NBX X;  1Z0P A;  3RRC A;  2JQQ A;  4BJN A;  1YW0 A;  1T8B A;  4EXT A;  4KP3 C;  2FJB A;  4JI6 T;  4AKR B;  5KDM C;  5HXS A;  4U7Y A;  3FHN A;  1MMA A;  2CM0 A;  4YT0 A;  2ZM2 A;  3RYF E;  3I0Q A;  2X0H A;  3AE2 A;  2D0T A;  2CBJ A;  4U2Y A;  4Z90 A;  4MAL A;  2X9W A;  4YJ3 E;  4P09 A;  2W67 A;  1WR6 A;  2XZE A;  3N9O A;  3KFW X;  1BR2 A;  3JAD A;  4IDN A;  5AQR B;  4WBO A;  3UQ4 A;  2NP9 A;  2QVA A;  3CK6 A;  1OED A;  3ZJ2 A;  3RIA A;  3WI3 A;  1XNR T;  2CHO A;  5JDH A;  4DR3 T;  4AKG A;  4L5G A;  4LF8 T;  4AQF C;  4HFD A;  4U2Z A;  4UV8 B;  2VQF T;  1HCI A;  4X65 T;  4FI5 A;  3ZT7 A;  4ZI7 E;  2WY2 A;  2Q9Q D;  2Y48 B;  2UUC T;  1DU2 A;  1MIW A;  3N2G E;  4CXX A;  3AXJ B;  1WLX A;  3P4S A;  2MBG A;  3NWI A;  3KBU A;  1XZY A;  1HS7 A;  2CRB A;  3ANW A;  4K0U A;  1KF6 A;  3PUY F;  3RQW A;  5ABF B;  3ZYM A;  4I0U A;  3IF8 B;  4ZS2 A;  2VUR A;  4MHC A;  2IW5 B;  1I94 T;  5FY7 A;  2SPC A;  5LGU B;  2VAS A;  1IAP A;  4LF7 T;  2KND A;  5DQV A;  2Y8D A;  4OX9 T;  2V5C A;  4YSX A;  1D1A A;  5L3C B;  2WDQ A;  2KIN B;  5EZY E;  3BQI A;  1N32 T;  3Q2M A;  3HKE E;  2W61 A;  1UK5 A;  4YTM A;  4P1N A;  4GYS A;  2EHO A;  2NW9 A;  3HL6 A;  2M6I A;  4V1A v;  5JTG A;  2J62 A;  3NRY A;  4AQF A;  5AQT B;  3N9L A;  4CI1 B;  1E2A A;  2IDO B;  4HE8 A;  4UF0 A;  4DV6 T;  3DJB A;  1ZP0 A;  5IUX A;  2BBH A;  2W2U A;  1HFA A;  2DWG A;  4QKN A;  4KUM B;  3AB3 B;  3OYX A;  4TZ4 C;  5CA1 E;  1SUM B;  3RQU A;  3L8R A;  2JQ9 A;  4KI0 F;  5AQG B;  1B7T A;  3ZN0 B;  2D5U A;  2KSR A;  2X68 A;  2AXD S;  4QXB B;  4O4H E;  3JAF A;  4FJO A;  2C0S A;  3KBT A;  2LKG A;  4HWF A;  5KX5 E;  5LJM A;  4E7S A;  3PUX F;  4EYY R;  3A8Y C;  1G73 A;  3VU7 H;  3KIN B;  5HXH A;  2L9Q A;  2LSK A;  5LCY A;  2WWU A;  4DR6 T;  2IC6 A;  2LSJ A;  4DR7 T;  1KNP A;  3ZCJ A;  2XY8 B;  4H9P C;  1KNR A;  2CEA A;  1D0Z A;  2H3R A;  3FB2 A;  1L0V A;  1KNZ A;  3CX6 B;  2H89 A;  5C8Y E;  1Y01 A;  3F31 A;  3F57 A;  3K3N A;  5AQV B;  2A2F X;  2X51 A;  2W4X A;  1LVF A;  4IGU A;  1W9R A;  4QH4 A;  3G06 A;  4GYR A;  5FY0 A;  3HI2 A;  3RF1 A;  4DV0 T;  2IHR 1;  2LRL A;  3HR0 A;  3LK4 2;  3N9Q A;  4EYU A;  1M7K A;  3AAI A;  4WW0 A;  3CPZ A;  4NIQ A;  4EZH A;  5LMU T;  4GIW A;  4DV2 T;  5DAB A;  3OYZ A;  3PUR A;  3PUW F;  2YN6 A;  4Z8X A;  4OK0 A;  2FUP A;  3I9W A;  1IJ5 A;  2ZM6 T;  4JUY A;  2BVM A;  4TWF A;  5JDF A;  3HA4 A;  4UVA B;  4NXM T;  5JRC A;  2QGS A;  4QHO A;  4QX8 B;  2LSY A;  5AFU L;  3C4W A;  4HGA A;  1HTJ F;  5ABG A;  1YXR A;  1IZN B;  4H9R C;  2XAJ B;  4EZ4 A;  4O8S A;  3FXD B;  4H9S E;  2W66 A;  4YTP A;  3ZPO A;  5FP3 A;  3ZN1 B;  4LF9 T;  2JIW A;  2BG9 A;  3GMI A;  2KLQ A;  4WBN E;  2LM2 A;  3VR8 A;  4DR2 T;  3AE3 A;  3P4P A;  2VL0 A;  4H9O C;  4BA9 A;  2VKO A;  5HCJ A;  4YSZ A;  2BS4 A;  4U33 A;  2LEH A;  2V6X A;  2N9D A;  3O1J A;  3UU5 A;  1YKE B;  3LJC A;  2BDE A;  5IHY A;  1ZHC A;  3UT5 E;  2V7I A;  5FXZ A;  3UU4 A;  3OKQ A;  2ES0 A;  5ADX L;  4AQY T;  3UU3 A;  1QUU A;  4HFV A;  4AKI A;  3QNU A;  4PW8 A;  4IDP A;  1I6Z A;  5HXE A;  4LF5 T;  1QLB A;  2UXN B;  1QSD A;  2D9D A;  3KVA A;  4QWN B;  2WS3 A;  1UX5 A;  2QYW A;  4HFH A;  2LLY A;  3ZMZ B;  5L47 A;  2K24 A;  4P0B A;  4LFC T;  1R8I A;  3L3P A;  3VKH A;  2WP9 A;  1NWM X;  5JDL A;  2FBW A;  3U3I A;  2ACX A;  5E0O A;  4DUY T;  2LJL A;  5FXV A;  5JR9 B;  3ZMS B;  2XQ8 A;  5J2T E;  4IDQ A;  2E9X C;  1OWA A;  3UUM A;  3C4Z A;  4X62 T;  2V6Y B;  2NR4 A;  5HEO A;  3O1I A;  5ABE A;  2HPJ A;  5LXT E;  1KEY A;  4EED A;  4ANJ A;  1D0Y A;  2W62 A;  1ZOY A;  3PUZ F;  4O4I E;  3AAA B;  4IL9 A;  2WDV A;  5AQI B;  2E8I A;  4UV9 B;  3RIU A;  1MMG A;  2IAK A;  5L4H A;  3AVR A;  2XSA A;  5JDM A;  4YSY A;  1KFY A;  4KX6 A;  2XQ4 A;  3EHZ A;  2CBI A;  4HFB A;  3PUQ A;  2XQ3 A;  1S35 A;  2ZM8 A;  5DJQ C;  2BKP A;  1FMV A;  4ZXL A;  3A7M A;  3P8C D;  4O2A E;  3IHR A;  3LBX B;  4ILC A;  3KVB A;  3ZKR A;  5C2T A;  4JEH B;  3SS1 A;  4PJJ A;  3FZL B;  1HNW T;  4IDO A;  3B57 A;  2XAQ B;  2HHH T;  2E9X D;  2XAF B;  3O1H A;  3AA0 B;  5HEJ A;  4B6X A;  4HWD A;  1MNE A;  3T8O A;  1X9B A;  1NEN A;  3QOF A;  2E5V A;  2E9X B;  2NW7 A;  1XDP A;  4DR1 T;  3B13 A;  3K3O A;  4KMC A;  5LGN B;  2B1E A;  4DUZ T;  5HXC A;  3SWH A;  1D1C A;  3KV6 A;  1AJ3 A;  2WU2 A;  1HNX T;  1S94 A;  3RI5 A;  4AKH A; 
#chains in the Genus database with same CATH homology
 5HEU A;  4IL9 A;  3UU8 A;  4LMJ A;  3UQ7 A;  2LKH A;  3TLU A;  3EAM A;  5L4H A;  2MAW A;  4HFE A;  3RQU A;  3UU4 A;  5HEG A;  3JAE A;  5J0Z A;  3TLT A;  2KSR A;  4ILA A;  2XQ4 A;  3UU3 A;  3EHZ A;  4IRE A;  4F8H A;  3JAF A;  4HFB A;  3RQW A;  2XQ3 A;  2YN6 A;  3EI0 A;  2LKG A;  3P4W A;  4LML A;  4HFI A;  3TLV A;  2YKS A;  4TWD A;  2BG9 B;  2M6B A;  5LG3 A;  4TWF A;  2XQ6 A;  2XQ9 A;  4A97 A;  4X5T A;  4COF A;  4ILC A;  4HFH A;  5CFB A;  3ZKR A;  2LLY A;  5HEH A;  3P50 A;  5L47 A;  4Z90 A;  3RIF A;  1OED B;  3RHW A;  4HFC A;  4Z91 A;  4TNW A;  3JAD A;  4QH5 A;  2BG9 C;  5HEJ A;  3LSV A;  4IL4 A;  3UQ4 A;  1OED A;  4TNV A;  2M6I A;  2XQ8 A;  4NPP A;  2BG9 A;  3UU6 A;  3UUB A;  3RIA A;  2XQA A;  4QH4 A;  2LM2 A;  3TLS A;  2YOE A;  4A98 A;  4QH1 A;  4LMK A;  2VL0 A;  5HEO A;  5L4E A;  1OED C;  4ZZC A;  4ILB A;  5HCJ A;  5HCM A;  1OED E;  4HFD A;  2XQ7 A;  4ZZB A;  3TLW A;  3RI5 A;  2BG9 E;  3UU5 A;  5IUX A;  2XQ5 A;  4TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...