2MAWA

Nmr structures of the alpha7 nachr transmembrane domain.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
EEELYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPSTSDSSPSIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGEGGGEGIDRLCLMAFSVFTIICTIGILMSAPNFVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into distinct modulation of alpha 7 and alpha 7 beta 2 nicotinic acetylcholine receptors by the volatile anesthetic isoflurane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Neuronal acetylcholine receptor subunit alpha-7
total genus 42
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2mawA00
4COFA 2MAWA 3JAFA 3RI5A 4HFDA 2LM2A 4ILBA 2XQAA 3UU8A 3TLSA 2XQ9A 3UUBA 3UQ7A 2VL0A 2XQ3A 3EAMA 4QH5A 2BG9A 3TLUA 5HEJA 4Z91A 2KSRA 5IUXA 3UU5A 3TLVA 2BG9E 3JADA 1OEDB 4HFCA 2M6IA 3UU6A 5HEGA 2LLYA 3RQUA 3TLTA 4Z90A 4LMJA 3LSVA 3RIFA 2LKGA 5LG3A 3UQ4A 3RQWA 4HFEA 5L4HA 4IL4A 4X5TA 3P4WA 4TNVA 4TNWA 2M6BA 5J0ZA 1OEDE 2BG9B 4ILCA 5HEHA 1OEDA 4QH1A 2YOEA 4TWHA 1OEDC 4HFBA 5HEOA 3JAEA 4IL9A 4TWFA 3ZKRA 5CFBA 2BG9C 3RIAA 3TLWA 5L4EA 2YKSA 4A98A 3UU4A 4F8HA 4TWDA 4NPPA 4HFHA 2XQ4A 2XQ7A 3EI0A 5L47A 2LKHA 3P50A 4IREA 4A97A 4QH4A 2XQ5A 5HEUA 2YN6A 5HCJA 4ZZBA 3UU3A 5HCMA 2XQ6A 4ZZCA 4LMKA 3RHWA 4ILAA 2XQ8A 4HFIA 3EHZA 4LMLA
chains in the Genus database with same CATH superfamily
2D0UA 5GONE 2A3DA 3H3AA 5LCYA 4COFA 4B3RT 5JRCB 4HFDA 2K24A 1WFDA 2W66A 4B3ST 4DV5T 4LFBT 3AEBA 5JDLA 2W62A 2XZEA 4IHJE 3MK7C 3RYFE 5L3BB 5BR8T 2LSIA 2XQAA 2WMOA 1LRZA 2CRBA 2LSGA 4K0KT 3DJBA 4A5XA 1D0XA 5FXZA 2BDEA 1W09A 2EHOC 4CXXA 1HG5A 4LF4T 3AA0B 1WR6A 4HWHA 2XAFB 4YTPA 2KT9A 3BK9A 4UEMA 2ZM0A 2J1DG 4WNKA 4QH5A 5M4YA 1I94T 4YTMA 4ZI2D 4LF6T 2F4VT 1NAFA 3AVSA 5J2TE 2EHOA 1UGOA 4ASKA 5H6RB 3OVUA 4JEHB 2KWIB 2K48A 2YU1A 5J2UE 4KP3C 3C98B 3NZQA 2DI4A 4QHOA 1YXRA 1MIYA 2UUBT 2E9XB 4HE8A 5KMGP 2JMKA 3AE3A 3HKEE 4DVDA 5HEJA 4LF5T 5LBQB 1M7KA 2J47A 4X1IE 1ZV4X 2Z6EA 1KK7A 3RYIE 2X0YA 5IUXA 5DQVA 3GMIA 3AE1A 4NXMT 2D0TA 1HCIA 3ONJA 2BG9E 5FVLA 4UF0B 2CMRA 2BS2A 2XSAA 4EEDA 1OEDB 5FY7A 4TN7B 4DV3T 2V6YB 4HFCA 5LHHB 4AXPA 2W4XA 5L2LA 5HEGA 2VKDA 4DNDA 4C91A 4QXHB 4B6XA 5HXCA 3ZT7A 5CJ5A 5JDQA 5JTGA 3O9XA 4X65T 1KNZA 2YU2A 4DR7T 4K0UA 2D5UA 4CI1B 2V7IA 4N78D 3RC3A 2HPLA 5TAOA 2JQHA 2PJQA 3UUNA 5IWAT 5L3EB 2ACZA 5LG3A 2P9BA 3ZMSB 4AQYT 4HFEA 3PUAA 2NWBA 3ZLIA 3AEDA 3K3OA 5L4HA 3H37A 2ZMAA 4HWDA 2PFVA 4C90A 2OA5A 3P4WA 3SWHA 5LJMA 2RA1A 1US7B 1KF6A 2E9XC 2M6BA 4NUUA 4TNWA 2VASA 2ODUA 2VKOA 3KFWX 5LB7B 1OEDE 3VHLA 4A56A 1WCRA 2X9WA 2YEVC 5LNKA 2BG9B 2AXDS 1HX8A 2HH7A 1KNPA 5KDMC 3RH3A 3K8PC 2Y48B 5ABGA 2BBHA 2YOEA 4HEAA 1N32T 4G63A 2XTLA 4AQFC 2ZLYA 4FI5A 1N36T 2LM9A 5IYZE 2G0UA 4O4IE 3PUSA 5LMNT 3UULA 3NKZA 2DCFA 5H6QB 3KV4A 4JUYA 2V26A 4OHFA 3I0QA 3RIUC 3UU4A 4HKAA 3ZCJA 4U3CA 2KWHA 4F8HA 2UXXB 3HR0A 4DV0T 2JQQA 2KZ7B 4UVCB 4ANJA 3Q2MA 4WZXA 1HTJF 3MZKB 2V8SV 2XQ7A 2BZBA 2MYSA 3LK3B 2LOSA 3NRXA 4O4HE 2W00A 3KV5A 2D2SA 2H88A 2VB6A 2NW7A 3V5SA 3RC8A 2LKHA 2X9YA 3B57A 3QC9A 2YDSA 3CX7B 4U31A 2ODVA 1D1AA 3OKQA 4QX8B 4IREA 2V7MA 4H9OC 4XAXB 5HXRA 4BJMA 4YSYA 4ZHQE 3PE0A 5LYJE 3EVYA 4X64T 1IBMT 1W0AA 4FJOA 5HEUA 5IHYA 4X1YE 5AQIB 5HWXA 3RYHE 3RKOA 3AEGA 5E0OA 5FP3A 3J9X1 4NXNT 3PTRB 2XQ6A 2WY2A 2NW8A 3AXJB 2EHOB 2YK0A 4JI0T 2OLTA 2H7OA 3P4RA 5CB4E 2LEHA 4DMVA 4U74A 4DV6T 2CWOA 3RHWA 1MNDA 5J1GA 2HN2A 4ILAA 2XQ8A 4AKIA 3PUWF 1IAPA 2BKNA 1QUUA 4EOZB 2MAWA 1T8BA 2D9DA 1ZHCA 2KINB 5AQVB 2MOZA 3HL6A 5FKYA 4Q25A 3LK42 2KNDA 2WS3A 3PUGA 3O1HA 3U3IA 5LGUB 2BS3A 2BS4A 5LGTB 4DV7T 4DR2T 4LF7T 1ZOYA 3P4PA 4ILBA 2Q9QC 3I1AA 5F3JA 4NIQA 3PU8A 1LVKA 2DNXA 2FUPA 1UX4A 3N9NA 5JH7E 4ZEYA 5KX5E 3UTKA 5JREA 2XAHB 3ABVA 2UXDT 3VKGA 2XQ9A 2C5IT 4IE5A 2WQYA 5DJQC 4E7SA 3IEEA 4OFZA 3CVRA 1HNWT 2W2UA 3I9YA 3PJAA 1G73A 5JDNA 3H3MA 1ZKEA 2LE8A 4YSXA 3ZN0B 2WAUA 3ZMVB 2LSJA 4CZZB 2CXLA 2DWKA 3PV0F 2NTYA 4AQGA 2QYWA 4IDPA 3TKLB 3ZC0A 2K3WA 2YINA 2CLYB 3PUYF 4QXCB 3JC6C 4PJNA 3TLUA 3RYCE 5L4EA 2JJ9A 1XNQT 1XNRT 4AIUA 2JMHA 3KBTA 3AA6B 1UUSA 2LRLA 3MACA 3O1IA 1BR1A 1QLBA 3ZSTA 4I43B 5AQOB 1XWMA 3FZHB 2JQKA 3N2OA 3NRYA 2UXNB 4IDNA 3ZC1A 2FJAA 2HHHT 3C64A 5JRCA 2CBIA 1XDPA 3PDYA 1HR0T 3UU6A 4UV8B 4B3MT 2E9XD 3QK6A 2LLYA 4QKNA 4Z8XA 4Z90A 1D0ZA 1VCSA 4EV6A 3A8YC 3IA3A 4ISSA 2JIWA 4IGUA 4MHCA 4IE6A 4PJMA 4PK5A 4ZS3A 2L8KA 3ZCIA 5AQFB 3WI3A 3G06A 4O2BE 2KLQA 4GYRA 2I59A 5FY0A 5L3GB 1BR2A 4PK6A 3RQWA 1SE7A 2JRKA 1YKEB 1E2AA 3IF8B 3AB3B 5FMNA 5JR9A 2X0HA 4X5TA 3ANWA 3M65A 4JI2T 2NTXA 3ZT5A 3P4QA 3L39A 5L3CB 5J0ZA 4KI0F 2Q9QA 3E0ZA 4JI8T 2DHRA 1H7CA 2H3RA 3GA8A 4PAGA 4P09A 2BVMA 3OYZA 3Q5DA 1MMDA 4X1KE 3SFEA 2R6GF 2X68A 3PURA 5F8PA 4ADZA 3OJAA 2WWUA 4WYVA 4PW8A 4KMCA 4QH1A 5C8YE 1D1BA 3ONLC 4HGAA 4JI4T 4MFRA 5HXEA 4JV5T 3P8CD 3O1JA 5CFBA 5JDGA 3LJCA 4YSZA 2LJLA 1Y01A 2AE9A 1G8XA 2Y6XA 4OYJA 4IDZA 3I0OA 4WBOA 4YHJA 5ABFB 5JDMA 1MIVA 5LHIB 3B13A 1U4QA 1LVFA 5AQQB 4AISA 3ETUA 4UR9A 4CI3B 3FZLB 2W67A 1CUNA 2C0SA 3QUJA 1NENA 3N9QA 3Q5XA 2XAGB 1IJ6A 5LXTE 4M1PA 4UV9B 3ZPOA 4BA9A 2IMLA 2LT3A 2FJDA 2XQ4A 4O4JE 3EDUA 5FY1A 4GOUA 4CN1A 2DLRA 4CXWA 2VQET 1OWAA 4DUZT 3P50A 3N2KE 4DUYT 2E2AA 3DTOA 2CCQA 5CA0E 4CXYA 4DR6T 4EYUA 4U33A 1IJ5A 2XQ5A 1HG2A 5KXJA 3CQXC 4ZZBA 5HXHA 3AE2A 3NVOA 2V5CA 3AEAA 4EIWA 2WZIA 5JDHA 1UURA 3CQGB 2MBGA 5FVKA 2Q9QD 4HWFA 5AQLB 2IC9A 2XQYA 4AKRB 3FXEB 4P1NA 4YT0A 4G2AA 2E9XA 4X62T 3CX6B 1R8IA 4IE0A 5ABHA 4I55E 3JCFA 3IHRA 1FEWA 3OPCA 1WR0A 4KX6A 4TV9E 1BR4A 1X9BA 5LBMA 5LHGB 2CE7A 4QXBB 3IBPA 3N2GE 3UT5E 2B1EA 3HKDE 3GN5B 4ZI2C 4L0RA 2L3LA 4UVAB 2YDQA 4CN6A 2WSSV 2CBJA 2CHNA 2IC6A 3SFDA 3SS1A 4KBMB 2IIUA 4ERRA 4YJ3E 3UUXB 3VKHA 3LG7A 3UU8A 5HYAA 2OV9A 2IHR1 2I0MA 3MA9A 4TX5A 4F6RC 2QRXA 1EZ3A 2NOXA 2C5JA 3R6NA 5FXVA 1GQEA 2C5KT 2CA5A 4HFVA 5AQRB 4DR4T 2WDRA 2BKOA 2WMNA 4UIGA 4LFCT 2IDOB 2V7KA 1JNRA 3JC6D 3J7Yq 4KHPT 1Z8UA 3CQCB 4BAYB 3RX6A 1FJGT 4P0AA 1Y64B 1ZP0A 3N9LA 2N2NA 1DU2A 4GYSA 4HWCA 3RRWA 2H7VC 2BVLA 4GK5E 2EHOD 1JNZA 2LRKA 4TV8E 1S94A 2Y8DA 4HTEA 1MIWA 2KSRA 4X20E 5C3JA 1XMQT 3AA1B 1WRDA 3Q5WA 3FZFB 4DV1T 3PU3A 3MJXA 3V5UA 1NWMX 3KV6A 3AAEB 3UU5A 3EDVA 3TLVA 4ZI3D 4V1Av 4YLHA 4QWNB 5JDFA 2V5DA 5C2TA 1UK5A 3KVAA 4ZI3C 5AQPB 4QX7B 3WAKA 4DBQA 1IBLT 2LSKA 3F31A 4UELA 4TZ4C 3RQUA 3TLTA 2GK9A 3C4ZA 5ABFA 1MMNA 4H9SE 4OK0A 3VRBA 4LMJA 4O8SA 4ILUA 1HNZT 1HF8A 5DQWA 3R84B 2IW5B 3ZJ1A 4X66T 4YFSA 4JI6T 3HKCE 3RIFA 5EK2A 4JYAT 5AQUB 2V1DB 3KDSE 4JLEA 5AQKB 3UQ4A 1O3XA 4IE4A 2WU5A 4IL4A 2WDQA 1SA0E 1FIOA 2UUCT 4XBFB 5EK3A 5HAXA 2ZM8A 4DV2T 4JI1T 4IDQA 1XDOA 1YQ3A 3ZYLA 1VRBA 4EB6E 1YQ4A 5LA6E 2IUBA 2VVSA 2M67A 2L9QA 4UVBB 3RRCA 1I6ZA 3C51A 2X9XA 5HEHA 2X9HA 2VWAA 1T98A 2CHOA 4LFAT 5LP6E 4TWHA 4GK0E 3FHNA 4IL9A 4TWFA 1OXZA 4AKGA 1V9DA 2BG9C 3HKBE 2VVNA 4MALA 2PBIA 3B5MA 3QB5K 3AE8A 3UFEA 4EZHA 1M62A 4O2AE 3BQKA 2UXBT 3OBVE 2W63A 3SRZA 3D0TA 3P7IA 1WYBA 3ZMUB 2DL1A 1LKXA 2DWGA 4TWDA 4NPPA 3C4XA 4HFHA 3N5LA 4PJJA 5LOVE 4BJNA 4ZI7E 3ONXA 1XMOT 4OX9T 1MMGA 2XJ7A 3GN5A 3HA4A 4UXNB 5AQGB 3K1SA 3RPUA 2VQFT 3N9OA 2I6HA 5ETWA 5CGMA 4H9PC 4GKJT 4CI2B 2A9UA 3RLFF 3PUVF 3F2EA 4A97A 4DO0A 2SPCA 4QH4A 3BQLA 1N33T 3FBZA 5LG4A 5JR9B 4JEUB 1IBKT 3FB2A 1SHZC 2YN6A 3ANWB 5HCJA 1B7TA 2W61A 3KBUA 3UU3A 1HS7A 5HWYA 2Q9QB 4NUVA 5AQMB 3F57A 3ZEFB 3T1HT 3VU7H 1BR0A 4YHHT 3QOFA 2WP9A 4AKHA 3DP7A 5JR9C 1UX5A 1NEKA 4AI6A 3ZSSA 1MNEA 2QGSA 2XUEA 4LMKA 1D0YA 3W15B 2MTQA 3L09A 4JBWF 4OYKA 1SUMB 2IAKA 4PFPA 4DR3T 4HFIA 2UU9T 2V7LA 2WZHA 2V7JA 3AAIA 2CM0A 4LMLA 3RGLA 5EK4A 2K5BB 2UXCT 3JAFA 3RI5A 2LSYA 2XM2A 2NW9A 1W9RA 1YW0A 3ZN1B 3UFGA 3VRAA 5DABA 4JI3T 4MLKA 3LBXA 2X0LB 2CXDA 2VURA 3ESLA 3LK2B 2XSBA 2LM2A 2NR4A 3C4WA 2E5LT 2K9AA 4GKKT 3K3QC 3Q9DA 3CX8B 3E08A 4MBQA 2J4GA 3N9MA 2CEAA 4YTNA 2RPAA 1E7PA 4TUYE 3WAJA 1U5PA 4DBRA 1WLXA 3TLSA 3MXZA 4H9NC 3CK6A 2ZM6T 3O4XE 3UUBA 4PFOA 3UQ7A 4I4TE 4H63H 2PTFA 4LF9T 2VL0A 2XQ3A 3EAMA 4XZCA 2XY8B 3K3NA 3GWHA 3ZJ2A 3CPZA 3AE7A 3AXJA 1HNXT 2CWYA 2LHRA 4YY3T 3AEEA 1T72A 2X67A 3MKDA 3PUQA 5LMUT 4UF0A 5F5WA 3UUMA 2BG9A 3RIUA 4U7YA 5FXXA 3AE4A 1XZYA 3L3PA 1Z0PA 2BKPA 2V6YA 4Z91A 4ZXLA 5LGNB 2FBWA 2XAJB 2HN1A 3RF1A 3AEFA 4PJLA 2J62A 2PG8A 1L0VA 3N9PA 2ES0A 1J5ET 4H63V 3EUHA 1HX1B 4ZS2A 3QB5A 1S35A 1VOMA 4HN9A 3JADA 3NWIA 2LOPA 4L5GA 3X1DA 4B3TT 3AA7B 4WBNE 3FXDB 5FNVE 1CHUA 2M6IA 1D1CA 3A5XA 4EEBA 4DV4T 2A2FX 1WYCA 3QNUA 5AQNB 3ZMTB 4I0UA 5ADXL 5JVDE 3T8OA 3AVRA 3PJAJ 4IT4A 5FXWA 2VKHA 2FJEA 2WM9A 2QVAA 3C50A 3EABA 3LSVA 2LKGA 4CN4A 3ZT6A 3OTOT 1KEYA 3A7MA 2VKJA 3NBXX 5AQJB 3ETVA 3PUZF 2A72A 3T1YT 4E7ZA 5ABEA 1YKHB 3E22E 4U2ZA 2YDRA 3S4UA 2WU2A 2JQ9A 3BQIA 4ZOLE 4TNVA 4DIDB 2B76A 1ZEEA 2WB5A 2KMFA 2CLYC 2FJBA 3KV9A 1IZNB 2ACXA 2XHEB 2XM1A 4O4LE 3ZYKA 3KINB 5L3DB 1QSDA 4H9RC 3VR8A 2W0GA 5JQGE 1J1JA 1KNRA 3FZMB 2XPKA 4ILCA 1UCUA 3P4SA 4AKLA 5BMVE 1OEDA 1X79A 2E8IA 3AE5A 1OEDC 1T7SA 2XASB 2VL8A 3JAEA 2MPKA 2N1GA 4HFBA 3HI2A 4IDOA 4PNIA 4U2YA 5HEOA 3RIAA 2XAQB 3CIRA 3L8RA 4J2CA 4KUMB 3TLWA 4AQFA 5AQSB 4EYYR 2ZM2A 4L9IA 5HXSA 4EXTA 4U7IA 5CA1E 2YKSA 4A98A 4KHZF 4DR5T 5LJNA 5L3FB 5EZYE 5AFUL 5FL1A 4H9QC 2BBJA 2WCAA 3I9WA 3KVBA 3PUXF 5AQTB 4YXDA 5FL0A 2WDVA 3FZKB 4IE7A 1J5WA 3M3ZB 1E1HB 2CPTA 3EI0A 4LF8T 2WWVA 5L47A 4IIJE 4DR1T 3LBXB 5AQHB 4CQIA 1VCTA 1YD8G 2QA7A 2VK9A 3ZYMA 4JI5T 2HPJA 4EAHA 1KFYA 3AE6A 3CWZB 3SOLA 3LDQB 1MMAA 4ISTA 3OYXA 2X66A 4DMWA 3ZKRA 2JPFA 3CKDA 1FMWA 3Q5EA 2CXFA 3ZMZB 1FMVA 2UUAT 2V6XA 3U78A 1W0BA 4EGWA 1AJ3A 5FYMA 3VR9A 4YJ2E 3LFMA 5HCMA 2WBLA 3AAAB 4JI7T 2LHNA 3AE9A 3AECA 3CMLA 2N9DA 3NZPA 2RP4A 1N34T 2E5VA 2X51A 4PK4A 3RKGA 4GIWA 4ZZCA 5A1LA 4WW0A 4EZ4A 2KXPB 1HFAA 2H89A 2NP9A 4I50E 4HWIB 3FBLA 3EHZA 4P0BA 4U72A
chains in the Genus database with same CATH topology
4COFA 2MAWA 3JAFA 3RI5A 4HFDA 2LM2A 4ILBA 2XQAA 3UU8A 3TLSA 2XQ9A 3UUBA 3UQ7A 2VL0A 2XQ3A 3EAMA 4QH5A 2BG9A 3TLUA 5HEJA 4Z91A 2KSRA 5IUXA 3UU5A 3TLVA 2BG9E 3JADA 1OEDB 4HFCA 2M6IA 3UU6A 5HEGA 2LLYA 3RQUA 3TLTA 4Z90A 4LMJA 3LSVA 3RIFA 2LKGA 5LG3A 3UQ4A 3RQWA 4HFEA 5L4HA 4IL4A 4X5TA 3P4WA 4TNVA 4TNWA 2M6BA 5J0ZA 1OEDE 2BG9B 4ILCA 5HEHA 1OEDA 4QH1A 2YOEA 4TWHA 1OEDC 4HFBA 5HEOA 3JAEA 4IL9A 4TWFA 3ZKRA 5CFBA 2BG9C 3RIAA 3TLWA 5L4EA 2YKSA 4A98A 3UU4A 4F8HA 4TWDA 4NPPA 4HFHA 2XQ4A 2XQ7A 3EI0A 5L47A 2LKHA 3P50A 4IREA 4A97A 4QH4A 2XQ5A 5HEUA 2YN6A 5HCJA 4ZZBA 3UU3A 5HCMA 2XQ6A 4ZZCA 4LMKA 3RHWA 4ILAA 2XQ8A 4HFIA 3EHZA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COF A;  2MAW A;  3JAF A;  3RI5 A;  4HFD A;  2LM2 A;  4ILB A;  2XQA A;  3UU8 A;  3TLS A;  2XQ9 A;  3UUB A;  3UQ7 A;  2VL0 A;  2XQ3 A;  3EAM A;  4QH5 A;  2BG9 A;  3TLU A;  5HEJ A;  4Z91 A;  2KSR A;  5IUX A;  3UU5 A;  3TLV A;  2BG9 E;  3JAD A;  1OED B;  4HFC A;  2M6I A;  3UU6 A;  5HEG A;  2LLY A;  3RQU A;  3TLT A;  4Z90 A;  4LMJ A;  3LSV A;  3RIF A;  2LKG A;  5LG3 A;  3UQ4 A;  3RQW A;  4HFE A;  5L4H A;  4IL4 A;  4X5T A;  3P4W A;  4TNV A;  4TNW A;  2M6B A;  5J0Z A;  1OED E;  2BG9 B;  4ILC A;  5HEH A;  1OED A;  4QH1 A;  2YOE A;  4TWH A;  1OED C;  4HFB A;  5HEO A;  3JAE A;  4IL9 A;  4TWF A;  3ZKR A;  5CFB A;  2BG9 C;  3RIA A;  3TLW A;  5L4E A;  2YKS A;  4A98 A;  3UU4 A;  4F8H A;  4TWD A;  4NPP A;  4HFH A;  2XQ4 A;  2XQ7 A;  3EI0 A;  5L47 A;  2LKH A;  3P50 A;  4IRE A;  4A97 A;  4QH4 A;  2XQ5 A;  5HEU A;  2YN6 A;  5HCJ A;  4ZZB A;  3UU3 A;  5HCM A;  2XQ6 A;  4ZZC A;  4LMK A;  3RHW A;  4ILA A;  2XQ8 A;  4HFI A;  3EHZ A;  4LML A; 
#chains in the Genus database with same CATH topology
 2D0U A;  5GON E;  2A3D A;  3H3A A;  5LCY A;  4COF A;  4B3R T;  5JRC B;  4HFD A;  2K24 A;  1WFD A;  2W66 A;  4B3S T;  4DV5 T;  4LFB T;  3AEB A;  5JDL A;  2W62 A;  2XZE A;  4IHJ E;  3MK7 C;  3RYF E;  5L3B B;  5BR8 T;  2LSI A;  2XQA A;  2WMO A;  1LRZ A;  2CRB A;  2LSG A;  4K0K T;  3DJB A;  4A5X A;  1D0X A;  5FXZ A;  2BDE A;  1W09 A;  2EHO C;  4CXX A;  1HG5 A;  4LF4 T;  3AA0 B;  1WR6 A;  4HWH A;  2XAF B;  4YTP A;  2KT9 A;  3BK9 A;  4UEM A;  2ZM0 A;  2J1D G;  4WNK A;  4QH5 A;  5M4Y A;  1I94 T;  4YTM A;  4ZI2 D;  4LF6 T;  2F4V T;  1NAF A;  3AVS A;  5J2T E;  2EHO A;  1UGO A;  4ASK A;  5H6R B;  3OVU A;  4JEH B;  2KWI B;  2K48 A;  2YU1 A;  5J2U E;  4KP3 C;  3C98 B;  3NZQ A;  2DI4 A;  4QHO A;  1YXR A;  1MIY A;  2UUB T;  2E9X B;  4HE8 A;  5KMG P;  2JMK A;  3AE3 A;  3HKE E;  4DVD A;  5HEJ A;  4LF5 T;  5LBQ B;  1M7K A;  2J47 A;  4X1I E;  1ZV4 X;  2Z6E A;  1KK7 A;  3RYI E;  2X0Y A;  5IUX A;  5DQV A;  3GMI A;  3AE1 A;  4NXM T;  2D0T A;  1HCI A;  3ONJ A;  2BG9 E;  5FVL A;  4UF0 B;  2CMR A;  2BS2 A;  2XSA A;  4EED A;  1OED B;  5FY7 A;  4TN7 B;  4DV3 T;  2V6Y B;  4HFC A;  5LHH B;  4AXP A;  2W4X A;  5L2L A;  5HEG A;  2VKD A;  4DND A;  4C91 A;  4QXH B;  4B6X A;  5HXC A;  3ZT7 A;  5CJ5 A;  5JDQ A;  5JTG A;  3O9X A;  4X65 T;  1KNZ A;  2YU2 A;  4DR7 T;  4K0U A;  2D5U A;  4CI1 B;  2V7I A;  4N78 D;  3RC3 A;  2HPL A;  5TAO A;  2JQH A;  2PJQ A;  3UUN A;  5IWA T;  5L3E B;  2ACZ A;  5LG3 A;  2P9B A;  3ZMS B;  4AQY T;  4HFE A;  3PUA A;  2NWB A;  3ZLI A;  3AED A;  3K3O A;  5L4H A;  3H37 A;  2ZMA A;  4HWD A;  2PFV A;  4C90 A;  2OA5 A;  3P4W A;  3SWH A;  5LJM A;  2RA1 A;  1US7 B;  1KF6 A;  2E9X C;  2M6B A;  4NUU A;  4TNW A;  2VAS A;  2ODU A;  2VKO A;  3KFW X;  5LB7 B;  1OED E;  3VHL A;  4A56 A;  1WCR A;  2X9W A;  2YEV C;  5LNK A;  2BG9 B;  2AXD S;  1HX8 A;  2HH7 A;  1KNP A;  5KDM C;  3RH3 A;  3K8P C;  2Y48 B;  5ABG A;  2BBH A;  2YOE A;  4HEA A;  1N32 T;  4G63 A;  2XTL A;  4AQF C;  2ZLY A;  4FI5 A;  1N36 T;  2LM9 A;  5IYZ E;  2G0U A;  4O4I E;  3PUS A;  5LMN T;  3UUL A;  3NKZ A;  2DCF A;  5H6Q B;  3KV4 A;  4JUY A;  2V26 A;  4OHF A;  3I0Q A;  3RIU C;  3UU4 A;  4HKA A;  3ZCJ A;  4U3C A;  2KWH A;  4F8H A;  2UXX B;  3HR0 A;  4DV0 T;  2JQQ A;  2KZ7 B;  4UVC B;  4ANJ A;  3Q2M A;  4WZX A;  1HTJ F;  3MZK B;  2V8S V;  2XQ7 A;  2BZB A;  2MYS A;  3LK3 B;  2LOS A;  3NRX A;  4O4H E;  2W00 A;  3KV5 A;  2D2S A;  2H88 A;  2VB6 A;  2NW7 A;  3V5S A;  3RC8 A;  2LKH A;  2X9Y A;  3B57 A;  3QC9 A;  2YDS A;  3CX7 B;  4U31 A;  2ODV A;  1D1A A;  3OKQ A;  4QX8 B;  4IRE A;  2V7M A;  4H9O C;  4XAX B;  5HXR A;  4BJM A;  4YSY A;  4ZHQ E;  3PE0 A;  5LYJ E;  3EVY A;  4X64 T;  1IBM T;  1W0A A;  4FJO A;  5HEU A;  5IHY A;  4X1Y E;  5AQI B;  5HWX A;  3RYH E;  3RKO A;  3AEG A;  5E0O A;  5FP3 A;  3J9X 1;  4NXN T;  3PTR B;  2XQ6 A;  2WY2 A;  2NW8 A;  3AXJ B;  2EHO B;  2YK0 A;  4JI0 T;  2OLT A;  2H7O A;  3P4R A;  5CB4 E;  2LEH A;  4DMV A;  4U74 A;  4DV6 T;  2CWO A;  3RHW A;  1MND A;  5J1G A;  2HN2 A;  4ILA A;  2XQ8 A;  4AKI A;  3PUW F;  1IAP A;  2BKN A;  1QUU A;  4EOZ B;  2MAW A;  1T8B A;  2D9D A;  1ZHC A;  2KIN B;  5AQV B;  2MOZ A;  3HL6 A;  5FKY A;  4Q25 A;  3LK4 2;  2KND A;  2WS3 A;  3PUG A;  3O1H A;  3U3I A;  5LGU B;  2BS3 A;  2BS4 A;  5LGT B;  4DV7 T;  4DR2 T;  4LF7 T;  1ZOY A;  3P4P A;  4ILB A;  2Q9Q C;  3I1A A;  5F3J A;  4NIQ A;  3PU8 A;  1LVK A;  2DNX A;  2FUP A;  1UX4 A;  3N9N A;  5JH7 E;  4ZEY A;  5KX5 E;  3UTK A;  5JRE A;  2XAH B;  3ABV A;  2UXD T;  3VKG A;  2XQ9 A;  2C5I T;  4IE5 A;  2WQY A;  5DJQ C;  4E7S A;  3IEE A;  4OFZ A;  3CVR A;  1HNW T;  2W2U A;  3I9Y A;  3PJA A;  1G73 A;  5JDN A;  3H3M A;  1ZKE A;  2LE8 A;  4YSX A;  3ZN0 B;  2WAU A;  3ZMV B;  2LSJ A;  4CZZ B;  2CXL A;  2DWK A;  3PV0 F;  2NTY A;  4AQG A;  2QYW A;  4IDP A;  3TKL B;  3ZC0 A;  2K3W A;  2YIN A;  2CLY B;  3PUY F;  4QXC B;  3JC6 C;  4PJN A;  3TLU A;  3RYC E;  5L4E A;  2JJ9 A;  1XNQ T;  1XNR T;  4AIU A;  2JMH A;  3KBT A;  3AA6 B;  1UUS A;  2LRL A;  3MAC A;  3O1I A;  1BR1 A;  1QLB A;  3ZST A;  4I43 B;  5AQO B;  1XWM A;  3FZH B;  2JQK A;  3N2O A;  3NRY A;  2UXN B;  4IDN A;  3ZC1 A;  2FJA A;  2HHH T;  3C64 A;  5JRC A;  2CBI A;  1XDP A;  3PDY A;  1HR0 T;  3UU6 A;  4UV8 B;  4B3M T;  2E9X D;  3QK6 A;  2LLY A;  4QKN A;  4Z8X A;  4Z90 A;  1D0Z A;  1VCS A;  4EV6 A;  3A8Y C;  3IA3 A;  4ISS A;  2JIW A;  4IGU A;  4MHC A;  4IE6 A;  4PJM A;  4PK5 A;  4ZS3 A;  2L8K A;  3ZCI A;  5AQF B;  3WI3 A;  3G06 A;  4O2B E;  2KLQ A;  4GYR A;  2I59 A;  5FY0 A;  5L3G B;  1BR2 A;  4PK6 A;  3RQW A;  1SE7 A;  2JRK A;  1YKE B;  1E2A A;  3IF8 B;  3AB3 B;  5FMN A;  5JR9 A;  2X0H A;  4X5T A;  3ANW A;  3M65 A;  4JI2 T;  2NTX A;  3ZT5 A;  3P4Q A;  3L39 A;  5L3C B;  5J0Z A;  4KI0 F;  2Q9Q A;  3E0Z A;  4JI8 T;  2DHR A;  1H7C A;  2H3R A;  3GA8 A;  4PAG A;  4P09 A;  2BVM A;  3OYZ A;  3Q5D A;  1MMD A;  4X1K E;  3SFE A;  2R6G F;  2X68 A;  3PUR A;  5F8P A;  4ADZ A;  3OJA A;  2WWU A;  4WYV A;  4PW8 A;  4KMC A;  4QH1 A;  5C8Y E;  1D1B A;  3ONL C;  4HGA A;  4JI4 T;  4MFR A;  5HXE A;  4JV5 T;  3P8C D;  3O1J A;  5CFB A;  5JDG A;  3LJC A;  4YSZ A;  2LJL A;  1Y01 A;  2AE9 A;  1G8X A;  2Y6X A;  4OYJ A;  4IDZ A;  3I0O A;  4WBO A;  4YHJ A;  5ABF B;  5JDM A;  1MIV A;  5LHI B;  3B13 A;  1U4Q A;  1LVF A;  5AQQ B;  4AIS A;  3ETU A;  4UR9 A;  4CI3 B;  3FZL B;  2W67 A;  1CUN A;  2C0S A;  3QUJ A;  1NEN A;  3N9Q A;  3Q5X A;  2XAG B;  1IJ6 A;  5LXT E;  4M1P A;  4UV9 B;  3ZPO A;  4BA9 A;  2IML A;  2LT3 A;  2FJD A;  2XQ4 A;  4O4J E;  3EDU A;  5FY1 A;  4GOU A;  4CN1 A;  2DLR A;  4CXW A;  2VQE T;  1OWA A;  4DUZ T;  3P50 A;  3N2K E;  4DUY T;  2E2A A;  3DTO A;  2CCQ A;  5CA0 E;  4CXY A;  4DR6 T;  4EYU A;  4U33 A;  1IJ5 A;  2XQ5 A;  1HG2 A;  5KXJ A;  3CQX C;  4ZZB A;  5HXH A;  3AE2 A;  3NVO A;  2V5C A;  3AEA A;  4EIW A;  2WZI A;  5JDH A;  1UUR A;  3CQG B;  2MBG A;  5FVK A;  2Q9Q D;  4HWF A;  5AQL B;  2IC9 A;  2XQY A;  4AKR B;  3FXE B;  4P1N A;  4YT0 A;  4G2A A;  2E9X A;  4X62 T;  3CX6 B;  1R8I A;  4IE0 A;  5ABH A;  4I55 E;  3JCF A;  3IHR A;  1FEW A;  3OPC A;  1WR0 A;  4KX6 A;  4TV9 E;  1BR4 A;  1X9B A;  5LBM A;  5LHG B;  2CE7 A;  4QXB B;  3IBP A;  3N2G E;  3UT5 E;  2B1E A;  3HKD E;  3GN5 B;  4ZI2 C;  4L0R A;  2L3L A;  4UVA B;  2YDQ A;  4CN6 A;  2WSS V;  2CBJ A;  2CHN A;  2IC6 A;  3SFD A;  3SS1 A;  4KBM B;  2IIU A;  4ERR A;  4YJ3 E;  3UUX B;  3VKH A;  3LG7 A;  3UU8 A;  5HYA A;  2OV9 A;  2IHR 1;  2I0M A;  3MA9 A;  4TX5 A;  4F6R C;  2QRX A;  1EZ3 A;  2NOX A;  2C5J A;  3R6N A;  5FXV A;  1GQE A;  2C5K T;  2CA5 A;  4HFV A;  5AQR B;  4DR4 T;  2WDR A;  2BKO A;  2WMN A;  4UIG A;  4LFC T;  2IDO B;  2V7K A;  1JNR A;  3JC6 D;  3J7Y q;  4KHP T;  1Z8U A;  3CQC B;  4BAY B;  3RX6 A;  1FJG T;  4P0A A;  1Y64 B;  1ZP0 A;  3N9L A;  2N2N A;  1DU2 A;  4GYS A;  4HWC A;  3RRW A;  2H7V C;  2BVL A;  4GK5 E;  2EHO D;  1JNZ A;  2LRK A;  4TV8 E;  1S94 A;  2Y8D A;  4HTE A;  1MIW A;  2KSR A;  4X20 E;  5C3J A;  1XMQ T;  3AA1 B;  1WRD A;  3Q5W A;  3FZF B;  4DV1 T;  3PU3 A;  3MJX A;  3V5U A;  1NWM X;  3KV6 A;  3AAE B;  3UU5 A;  3EDV A;  3TLV A;  4ZI3 D;  4V1A v;  4YLH A;  4QWN B;  5JDF A;  2V5D A;  5C2T A;  1UK5 A;  3KVA A;  4ZI3 C;  5AQP B;  4QX7 B;  3WAK A;  4DBQ A;  1IBL T;  2LSK A;  3F31 A;  4UEL A;  4TZ4 C;  3RQU A;  3TLT A;  2GK9 A;  3C4Z A;  5ABF A;  1MMN A;  4H9S E;  4OK0 A;  3VRB A;  4LMJ A;  4O8S A;  4ILU A;  1HNZ T;  1HF8 A;  5DQW A;  3R84 B;  2IW5 B;  3ZJ1 A;  4X66 T;  4YFS A;  4JI6 T;  3HKC E;  3RIF A;  5EK2 A;  4JYA T;  5AQU B;  2V1D B;  3KDS E;  4JLE A;  5AQK B;  3UQ4 A;  1O3X A;  4IE4 A;  2WU5 A;  4IL4 A;  2WDQ A;  1SA0 E;  1FIO A;  2UUC T;  4XBF B;  5EK3 A;  5HAX A;  2ZM8 A;  4DV2 T;  4JI1 T;  4IDQ A;  1XDO A;  1YQ3 A;  3ZYL A;  1VRB A;  4EB6 E;  1YQ4 A;  5LA6 E;  2IUB A;  2VVS A;  2M67 A;  2L9Q A;  4UVB B;  3RRC A;  1I6Z A;  3C51 A;  2X9X A;  5HEH A;  2X9H A;  2VWA A;  1T98 A;  2CHO A;  4LFA T;  5LP6 E;  4TWH A;  4GK0 E;  3FHN A;  4IL9 A;  4TWF A;  1OXZ A;  4AKG A;  1V9D A;  2BG9 C;  3HKB E;  2VVN A;  4MAL A;  2PBI A;  3B5M A;  3QB5 K;  3AE8 A;  3UFE A;  4EZH A;  1M62 A;  4O2A E;  3BQK A;  2UXB T;  3OBV E;  2W63 A;  3SRZ A;  3D0T A;  3P7I A;  1WYB A;  3ZMU B;  2DL1 A;  1LKX A;  2DWG A;  4TWD A;  4NPP A;  3C4X A;  4HFH A;  3N5L A;  4PJJ A;  5LOV E;  4BJN A;  4ZI7 E;  3ONX A;  1XMO T;  4OX9 T;  1MMG A;  2XJ7 A;  3GN5 A;  3HA4 A;  4UXN B;  5AQG B;  3K1S A;  3RPU A;  2VQF T;  3N9O A;  2I6H A;  5ETW A;  5CGM A;  4H9P C;  4GKJ T;  4CI2 B;  2A9U A;  3RLF F;  3PUV F;  3F2E A;  4A97 A;  4DO0 A;  2SPC A;  4QH4 A;  3BQL A;  1N33 T;  3FBZ A;  5LG4 A;  5JR9 B;  4JEU B;  1IBK T;  3FB2 A;  1SHZ C;  2YN6 A;  3ANW B;  5HCJ A;  1B7T A;  2W61 A;  3KBU A;  3UU3 A;  1HS7 A;  5HWY A;  2Q9Q B;  4NUV A;  5AQM B;  3F57 A;  3ZEF B;  3T1H T;  3VU7 H;  1BR0 A;  4YHH T;  3QOF A;  2WP9 A;  4AKH A;  3DP7 A;  5JR9 C;  1UX5 A;  1NEK A;  4AI6 A;  3ZSS A;  1MNE A;  2QGS A;  2XUE A;  4LMK A;  1D0Y A;  3W15 B;  2MTQ A;  3L09 A;  4JBW F;  4OYK A;  1SUM B;  2IAK A;  4PFP A;  4DR3 T;  4HFI A;  2UU9 T;  2V7L A;  2WZH A;  2V7J A;  3AAI A;  2CM0 A;  4LML A;  3RGL A;  5EK4 A;  2K5B B;  2UXC T;  3JAF A;  3RI5 A;  2LSY A;  2XM2 A;  2NW9 A;  1W9R A;  1YW0 A;  3ZN1 B;  3UFG A;  3VRA A;  5DAB A;  4JI3 T;  4MLK A;  3LBX A;  2X0L B;  2CXD A;  2VUR A;  3ESL A;  3LK2 B;  2XSB A;  2LM2 A;  2NR4 A;  3C4W A;  2E5L T;  2K9A A;  4GKK T;  3K3Q C;  3Q9D A;  3CX8 B;  3E08 A;  4MBQ A;  2J4G A;  3N9M A;  2CEA A;  4YTN A;  2RPA A;  1E7P A;  4TUY E;  3WAJ A;  1U5P A;  4DBR A;  1WLX A;  3TLS A;  3MXZ A;  4H9N C;  3CK6 A;  2ZM6 T;  3O4X E;  3UUB A;  4PFO A;  3UQ7 A;  4I4T E;  4H63 H;  2PTF A;  4LF9 T;  2VL0 A;  2XQ3 A;  3EAM A;  4XZC A;  2XY8 B;  3K3N A;  3GWH A;  3ZJ2 A;  3CPZ A;  3AE7 A;  3AXJ A;  1HNX T;  2CWY A;  2LHR A;  4YY3 T;  3AEE A;  1T72 A;  2X67 A;  3MKD A;  3PUQ A;  5LMU T;  4UF0 A;  5F5W A;  3UUM A;  2BG9 A;  3RIU A;  4U7Y A;  5FXX A;  3AE4 A;  1XZY A;  3L3P A;  1Z0P A;  2BKP A;  2V6Y A;  4Z91 A;  4ZXL A;  5LGN B;  2FBW A;  2XAJ B;  2HN1 A;  3RF1 A;  3AEF A;  4PJL A;  2J62 A;  2PG8 A;  1L0V A;  3N9P A;  2ES0 A;  1J5E T;  4H63 V;  3EUH A;  1HX1 B;  4ZS2 A;  3QB5 A;  1S35 A;  1VOM A;  4HN9 A;  3JAD A;  3NWI A;  2LOP A;  4L5G A;  3X1D A;  4B3T T;  3AA7 B;  4WBN E;  3FXD B;  5FNV E;  1CHU A;  2M6I A;  1D1C A;  3A5X A;  4EEB A;  4DV4 T;  2A2F X;  1WYC A;  3QNU A;  5AQN B;  3ZMT B;  4I0U A;  5ADX L;  5JVD E;  3T8O A;  3AVR A;  3PJA J;  4IT4 A;  5FXW A;  2VKH A;  2FJE A;  2WM9 A;  2QVA A;  3C50 A;  3EAB A;  3LSV A;  2LKG A;  4CN4 A;  3ZT6 A;  3OTO T;  1KEY A;  3A7M A;  2VKJ A;  3NBX X;  5AQJ B;  3ETV A;  3PUZ F;  2A72 A;  3T1Y T;  4E7Z A;  5ABE A;  1YKH B;  3E22 E;  4U2Z A;  2YDR A;  3S4U A;  2WU2 A;  2JQ9 A;  3BQI A;  4ZOL E;  4TNV A;  4DID B;  2B76 A;  1ZEE A;  2WB5 A;  2KMF A;  2CLY C;  2FJB A;  3KV9 A;  1IZN B;  2ACX A;  2XHE B;  2XM1 A;  4O4L E;  3ZYK A;  3KIN B;  5L3D B;  1QSD A;  4H9R C;  3VR8 A;  2W0G A;  5JQG E;  1J1J A;  1KNR A;  3FZM B;  2XPK A;  4ILC A;  1UCU A;  3P4S A;  4AKL A;  5BMV E;  1OED A;  1X79 A;  2E8I A;  3AE5 A;  1OED C;  1T7S A;  2XAS B;  2VL8 A;  3JAE A;  2MPK A;  2N1G A;  4HFB A;  3HI2 A;  4IDO A;  4PNI A;  4U2Y A;  5HEO A;  3RIA A;  2XAQ B;  3CIR A;  3L8R A;  4J2C A;  4KUM B;  3TLW A;  4AQF A;  5AQS B;  4EYY R;  2ZM2 A;  4L9I A;  5HXS A;  4EXT A;  4U7I A;  5CA1 E;  2YKS A;  4A98 A;  4KHZ F;  4DR5 T;  5LJN A;  5L3F B;  5EZY E;  5AFU L;  5FL1 A;  4H9Q C;  2BBJ A;  2WCA A;  3I9W A;  3KVB A;  3PUX F;  5AQT B;  4YXD A;  5FL0 A;  2WDV A;  3FZK B;  4IE7 A;  1J5W A;  3M3Z B;  1E1H B;  2CPT A;  3EI0 A;  4LF8 T;  2WWV A;  5L47 A;  4IIJ E;  4DR1 T;  3LBX B;  5AQH B;  4CQI A;  1VCT A;  1YD8 G;  2QA7 A;  2VK9 A;  3ZYM A;  4JI5 T;  2HPJ A;  4EAH A;  1KFY A;  3AE6 A;  3CWZ B;  3SOL A;  3LDQ B;  1MMA A;  4IST A;  3OYX A;  2X66 A;  4DMW A;  3ZKR A;  2JPF A;  3CKD A;  1FMW A;  3Q5E A;  2CXF A;  3ZMZ B;  1FMV A;  2UUA T;  2V6X A;  3U78 A;  1W0B A;  4EGW A;  1AJ3 A;  5FYM A;  3VR9 A;  4YJ2 E;  3LFM A;  5HCM A;  2WBL A;  3AAA B;  4JI7 T;  2LHN A;  3AE9 A;  3AEC A;  3CML A;  2N9D A;  3NZP A;  2RP4 A;  1N34 T;  2E5V A;  2X51 A;  4PK4 A;  3RKG A;  4GIW A;  4ZZC A;  5A1L A;  4WW0 A;  4EZ4 A;  2KXP B;  1HFA A;  2H89 A;  2NP9 A;  4I50 E;  4HWI B;  3FBL A;  3EHZ A;  4P0B A;  4U72 A; 
#chains in the Genus database with same CATH homology
 4COF A;  2MAW A;  3JAF A;  3RI5 A;  4HFD A;  2LM2 A;  4ILB A;  2XQA A;  3UU8 A;  3TLS A;  2XQ9 A;  3UUB A;  3UQ7 A;  2VL0 A;  2XQ3 A;  3EAM A;  4QH5 A;  2BG9 A;  3TLU A;  5HEJ A;  4Z91 A;  2KSR A;  5IUX A;  3UU5 A;  3TLV A;  2BG9 E;  3JAD A;  1OED B;  4HFC A;  2M6I A;  3UU6 A;  5HEG A;  2LLY A;  3RQU A;  3TLT A;  4Z90 A;  4LMJ A;  3LSV A;  3RIF A;  2LKG A;  5LG3 A;  3UQ4 A;  3RQW A;  4HFE A;  5L4H A;  4IL4 A;  4X5T A;  3P4W A;  4TNV A;  4TNW A;  2M6B A;  5J0Z A;  1OED E;  2BG9 B;  4ILC A;  5HEH A;  1OED A;  4QH1 A;  2YOE A;  4TWH A;  1OED C;  4HFB A;  5HEO A;  3JAE A;  4IL9 A;  4TWF A;  3ZKR A;  5CFB A;  2BG9 C;  3RIA A;  3TLW A;  5L4E A;  2YKS A;  4A98 A;  3UU4 A;  4F8H A;  4TWD A;  4NPP A;  4HFH A;  2XQ4 A;  2XQ7 A;  3EI0 A;  5L47 A;  2LKH A;  3P50 A;  4IRE A;  4A97 A;  4QH4 A;  2XQ5 A;  5HEU A;  2YN6 A;  5HCJ A;  4ZZB A;  3UU3 A;  5HCM A;  2XQ6 A;  4ZZC A;  4LMK A;  3RHW A;  4ILA A;  2XQ8 A;  4HFI A;  3EHZ A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...