2MC4A

The solution structure of the c-terminal domain of bldd from streptomyces coelicolor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
MEPPPKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAVASHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA binding protein
publication title The solution structure of the C-terminal domain of BldD from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mc4A00
5KHDA 4OAZA 2MC4A 4OAYA
chains in the Genus database with same CATH superfamily
3BZ6A 3E7LA 3TO7A 4MGRA 2E34A 4LB6B 3H92A 2L54A 1K61A 3LSIA 1WWXA 2P7CB 3HGYA 2NNNA 1IUYA 1RKTA 2Y31A 4B4CA 1FIPA 1UMQA 4NB5A 3ECHA 1B9NA 2DXIA 2CQNA 2HVRA 2R7FA 2VIXA 5HNFA 3JRCA 1BM9A 3BOQA 4HNVA 1F43A 1STZA 4CDGA 2LTPA 3AFHA 1AU7A 2P5KA 3OS1A 2CUJA 2UXNA 3OWTA 1NH3A 1V5FA 1ZG3A 2H8RA 4PCQA 3PNTA 3WG9A 3E97A 2HU9A 4XM3A 5HNHA 3K2AA 3R0JA 1JJ6C 4MEXF 5HODA 5JHFA 4HNUA 5D4RA 2DA7A 3QPHA 2D2WA 1ONVA 4I02A 4F92B 5K7FA 5F08A 1MMDA 2ZFWA 3AG1H 3E0JB 4AVZA 1AKHA 1DP7P 4DQ2A 3TO9A 3L2VA 3VEPA 2KIUA 5CVRA 2PMHA 2VC1A 3QYBA 4XBFA 1WJFA 2YS9A 2PMUA 5J6XA 1MBGA 2NOJB 3CCVI 5GPAA 2AO9A 2K9SA 1HQCA 2WB1N 1Y39A 1UHMA 1X3WB 2JPCA 2V6CA 4N0BA 2CQKA 2LKSA 4YIIA 2KDZA 4KNYA 2R5YA 1T6SA 1PYVA 1FJLA 2IS1A 2OA4A 3PO3J 3GWZA 1HSJA 2EFNA 4JOMA 3ABLH 2CGPA 2K3PA 3KZYA 3A02A 3C2HA 1GLNA 4YG2F 3C18A 4IHSA 4BJ5C 3I59A 4UUSB 4MNUA 4XNFA 3DF8A 2XRNA 3OYHA 4HAMA 2VJ4A 3S15J 5EG0B 2F4OB 4LMYA 2XKOA 4BEHA 1J75A 2W82A 2E36A 2DN0A 4EGYA 3OOPA 4IOCF 2JA7J 1G2HA 1OCRH 1X1BA 3IRQA 1UHWA 4G7OF 2MH2A 3ZQFA 2CW7A 4G94A 4U88A 3CUQC 5EEGA 3BR2A 3KP4A 1WGXA 4YEJA 4CUGA 5E17F 3KETA 3HOXJ 1QZEA 2LY9A 3ROUA 4IRIA 4IHTA 4RDUA 2MBFA 2E5NA 1ORKA 1Z7UA 4XONA 4KUMA 2XC7A 2BXZA 3BG3A 2P5LC 3AL0B 4UXNA 2FX0A 5DDGA 2PN6A 3GEZA 4HG2A 3BLYA 2VPLA 2BHYA 2XAJA 1KZHA 4BUPA 5GTIC 3HPHA 4I76A 2NVYJ 1WRJA 1T56A 3CCRI 5J8FA 2DT7B 3CUQA 2LF8A 3KP2A 2X4HA 1XN7A 2M1BA 5HS8A 5FKNA 4BQAA 2OQGA 5DCFA 1IN6A 2KRFA 1ZR4A 1IF1A 2B7EA 2HTSA 4NUBA 3GTJJ 2YUSA 4PGHA 3IAM2 3LA7A 2VLAA 2LY1A 3TOBA 4PJ0C 4EJWA 3S14J 1B72A 2GIVA 2RDPA 2XROA 2DMQA 3FXKA 1LDKB 3L2QA 4OAZA 1BW5A 3M3YJ 1AHDP 1MGTA 2DI3A 3K2ZA 2IGOA 2OU2A 4ENMA 2K86A 3S2DJ 1W7PD 4G6DA 1TQPA 2STWA 1S7OA 5DTDA 4II3A 4ABZA 3FXRA 3S1RJ 1ZRDA 3DEEA 3L2RA 3DKXA 3RZDJ 3DPUA 1EH7A 2DPUA 4E6KG 1TNSA 3TEDA 2IA1A 4LJZF 4LITA 3GVAA 4QPOA 3RQ4A 1P92A 4S05A 3MMYB 4XOPA 1J59A 1FSHA 3FXOA 4P1WA 2VJIA 4UNOA 3ZQQA 4L9VA 5FLMJ 3WU0A 9ANTA 4IVNA 1MJ9A 1FWZA 2FQ3A 3W2WA 1VQPI 5E18F 4ZDPA 3SDGA 1F4KA 3QODA 2BBYA 2VASA 3JAMK 4Q4ZF 3Q3SA 3A01B 1SFOJ 1XB4A 3BR1A 4PJNA 3DXJF 4EM1A 1Z67A 1X4PA 2F4IA 1QZZA 2JSCA 2N8GA 1RUNA 4OIPF 1SVLA 4AYBN 5C44J 1HC8A 4UUTA 3RIRA 2ZXJA 4IX7A 4UVCA 3DEWA 2PEXA 2QUFA 2LK2A 4K2EA 2EA4A 2R7SA 3ZQ7A 2LSOA 2PI0A 3I59B 1EA3A 1ZR2A 1I39A 2XF5A 3COAC 3NARA 1ZKGA 1FOYA 4A0YA 1TC3C 4BEHB 4HW0A 3OYBA 3ABTA 2Y9YA 4E7KA 2PMZA 1V4RA 1FTTA 1QVTA 5L3CA 2UWMA 3P9CA 5H6RA 1W0UA 3W6JB 1R22A 2LYCA 4KIBA 1K4TA 5HDNA 4HX8A 3S17J 2HR3A 4GFBA 2WADA 1MJAA 2DOFA 1XD7A 1B8IA 1ENHA 2VJ5A 4KN7X 2MC3A 4CICA 4E7LA 1HDPA 1TQIA 4L9NA 4UY8I 2P6TA 4AD9A 1MZBA 1XGNA 2M2EA 4XKVA 1WI3A 2VXDA 2MFZA 1USTA 4PJMA 3F72A 3ONQA 1P7JA 5M3FJ 3B02A 1P4AA 1WJDA 4MTDA 2DFEA 2WAQN 1HKSA 4U87A 2MLGA 4LG3A 4DBRA 5B5EC 3H9QA 4PGGA 1QU3A 3K10A 3R6SA 1X1PA 4D5FA 2R93J 3W6KB 5L3FA 2CJJA 1U8RA 4E7IA 5AIQA 3CDIA 3GX4X 2GM4A 2ID6A 3IH2A 5ICCA 2XF6A 2HVSA 5E3LA 3BG6A 3S3MA 5EEHA 2EPFA 2K5CA 1X19A 1ZTRA 3QOEA 4RBOA 2Z16A 5LFAA 1UJ8A 5IP7J 3RQIA 2RREA 4XKBA 1IRFA 5H2FC 5LD2C 1U0JA 2AHQA 2IAIA 3WHCA 2EA2A 1SC7A 2G7HA 4A93J 3PFIA 3JSPA 3KP7A 2HGCA 2LF7A 2VOOA 1H9TA 2HTJA 2OBPA 2GBYA 4ESJA 1C0WA 3VDXA 1DGWY 2QLZA 3LA3A 3VYUB 3OOUA 5D8LB 4L0YB 4M3BA 1FPQA 2NAZA 3E6MA 1SANA 3QU6A 4A5MA 4I0AA 1ON1A 2RN7A 2JN6A 3GLLA 5TRDA 1POGA 1TBXA 2OTJI 2DDAA 3RYRA 4BE1A 1ZQ3P 3U21A 4C2UA 1IDZA 2E7WA 2F5EA 3VYTB 1R4NB 1I1GA 2GA1A 2O3FA 2CW8A 2VL8A 3BG5A 3DTIA 1GUUA 1YE9A 3JRGA 3HC7A 3H5AA 1CGPA 5IT9K 3CCMI 2CYYA 4V19K 2HPIA 4HF0A 2LVSA 1FT9A 1V5GA 5D5UB 4A69C 4R79A 1HDDC 4A0XA 3D0SA 1ACIA 3I56I 2BV6A 3BTJA 2H09A 3PIOF 2VE8A 3F6VA 2R5ZA 3F0CA 2E1MC 3E5XA 2DO7A 3SXYA 3ZQGA 1K4SA 2IS6A 4ASNA 5LHIA 4XRSA 3WU2C 3S8PA 2ELHA 3KYCB 3CC2I 2FF4A 1T08B 2BVMA 2BVLA 2BXYA 4CHUA 1OR7C 2KISA 5J4VA 5E8IA 1QBJA 2OUMA 4DYQA 4CYDA 4JYKA 1ETYA 3LMMA 3DBRB 2QBYB 5ERIA 2XGCA 3ZMUA 1QPMA 2LD5A 3KCCA 2RQPA 4KA4A 1RR7A 1U6GA 2YU3A 5HLHA 4ZYDA 4OINF 4J01A 2OQRA 2DYSH 4BH9A 1DUXC 1V55H 3KP6A 3ZN0A 4D1QA 1JTXA 5KK1A 1PP8F 2K9QA 1Q1VA 2HQNA 2EK5A 3IP4B 2CQQA 2O7OA 1OPCA 2JZYA 3CJNA 3MD2A 2CO5A 1S7EA 4F3QA 4O6JA 3WE2A 4A3JJ 5DEQA 2KRHA 2ZO4A 3E6DA 3ZQCA 2KLOA 2W84A 4M9XA 3JRHA 2P5VA 3KYDB 3GZ6A 2L02A 3FK6A 2DA4A 3HTUA 4OOIA 2EH3A 2JTVA 5DS9A 1ZELA 1WI9A 2ZMEA 3K4KA 3D1NI 5FKKA 2WAFA 1VQKI 3VSKA 1MBHA 3P9IA 3ABMH 2HVQA 2DA6A 3FWEA 1X2MA 1E3OC 1VQLI 3BJAA 2UUZA 2JUCA 1YX5A 4GDFA 2XV4S 3I4PA 3M1EA 1MIJA 4QIWN 4ZYHA 3OS0A 1W5TA 4H4KC 1KU7A 4NBQA 1XTAA 2VJJA 2EIMH 3KEOA 4GRIA 3OYIA 1JGGA 2PX9A 5DD8A 2XKPA 2CU7A 5F1RA 1VQOI 5J8CA 2DFHA 1U5TC 3RKYA 3LQQA 3UKGA 4HSTA 1O3SA 1BC8C 3S1MJ 1IRZA 2DA5A 4Y52J 3N05A 3E3VA 1S3JA 3F8NA 3U1KA 4XORA 3GZNB 3TP0A 2VBWA 2V1NA 5BPIA 2DOAA 4A3GJ 1WCMJ 3KX2A 5E79C 3QU3A 2COBA 5CPRB 3I71A 3MKYB 2KMUA 3QP6A 4EVIA 3BCAA 3PNVA 3QQAA 3K1PA 1CF7B 4B47A 5J4YA 5K5RA 4G9YA 3MQ0A 4OIOF 4I98B 4CXFA 1U5TA 5IP9J 3GFJA 1MBJA 4XN0A 3MFKA 1APLC 3FKJA 4YRVA 1VQMI 4PFOA 2H27A 2O0YA 1RZ4A 4ESBA 3JRBA 4NQWB 2IXSA 3WHBA 2FSWA 5C4JJ 5EZHA 4IO9F 5GADJ 2BEOA 1IN4A 1I6HJ 4X6AJ 1BA5A 4HOBA 2KIQA 3OIQA 4E70A 4AIJA 2FEZA 3A1YA 4UB8C 2VBYA 4HX4A 1PVEA 2PJRA 2DAOA 4BU2A 3BR6A 2L4AA 2XAGA 3PNYA 3W2AA 1FP1D 5DUKA 3SFZA 5M5WJ 3FXMA 1K7AA 1LQ1A 3RPUD 4XRMA 1G3WA 5IYCJ 2IA0A 2HYFA 3JCUC 1D0YA 4HRIA 4XLAA 2PQ8A 2E2IJ 3HHGA 4Y33A 1UZCA 2LP0A 3O2PE 4E7SA 4J00A 4OMYA 2NNYA 2VI6A 3CC4I 4KMUX 2LR8A 1VQNI 1X3ZB 3GTLJ 3PQJA 4HSRA 4YELA 5LRSA 3K4CA 2KQRA 2LDUA 4ETSA 1R00A 3OYAA 4RA2A 3M8FA 3Q0WA 5FKLA 2VXZA 2GAUA 4EEFG 2DQRA 2K9LA 1T95A 4CCOA 1XCVA 4ENJA 4QLCU 3QAHA 2KL4A 3DCFA 3H5NA 2JT1A 3RZOJ 5IYDJ 2IW5A 2FBKA 2CH0A 1HSTA 1TQMA 1YOVB 2PBIA 1VQ4I 3MZYA 1HXDA 5D8KB 3TO6A 3E5QA 3RKQA 2E19A 3GZ5A 2ZMEB 3HOVJ 3FXLA 2VONA 3I58A 4FX4A 2GXGA 2M8GX 3K1MA 3OIPA 1S72I 2HDWA 1PJRA 2UV1A 3AG3H 2L7MP 4XRSG 4B3XA 2KHMA 1R58A 1RESA 3L7WA 1LJ9A 3S2HJ 3TL4X 2MD5A 3O3KA 1A36A 5D5VB 2HOTA 2XUBA 3FBNB 3AL0C 4N9HA 2XB0X 3JREA 1SFUA 2OV7A 4KIFA 3RDIA 4C2TA 4RB3C 2YX7A 2EFQA 1FY7A 1TT5B 4D9JA 4FCYA 3U9GA 2E1CA 5LEKA 3IKVA 4Z6YA 1YRNA 1A04A 4WCGA 2E5ZA 4M71A 1IXSB 5K5QA 3G3ZA 1W36C 3OSFA 1B59A 3MZHA 3T5XA 1K79A 1UAAA 3OYJA 4RS8A 2QM3A 1IGNA 1ZN2A 2QQBA 2OPTA 2YPRA 3PIPF 1Z9CA 3M1CA 1R36A 4L18B 3HM5A 1ZGJA 2W24A 3ASNH 2RVCA 1QZYA 2KIMA 3LSHA 3P5JA 2R0QC 2DLLA 3S16J 4FHTA 3T1BA 4OMZA 4MQ9F 4QTRA 1SD5A 4RM3A 4RLFA 2FUG2 1XCBA 4OAYA 1GVJA 1D1BA 2HQ5A 2NVXJ 1W7PB 3GFIA 4RAZA 1MH3A 2WV0A 2W57A 3NEUA 1VFCA 4LG0B 1CQTA 1BC7C 2V9KA 3CF2A 2PJRB 5DV5A 1VZ0A 4JP0A 3EQLF 1LKXA 2IT0A 4R8HA 2Y48A 1DP3A 1BBYA 1XSDA 1T2KA 3J81Z 1T33A 2ZJQF 3M9AA 4CCKA 1XX5A 2A07F 4OU0A 2YSRA 3GTKJ 4Q47A 5TJJA 5HLTA 3GMEA 1KQ8A 2EJRA 2VBXA 3BG9A 5CKTA 5F27A 4B1RA 2OZUA 2A5WA 3ZMVA 2OC6A 3F21A 2K9NA 5E1ZB 4HLXA 3GYHX 1OCPA 3WTSC 2YX4A 5HS7A 4MFDA 1LVKA 2OAZA 1FYMA 1R49A 1G3SA 5E1XA 2XIGA 3HYIA 1WJAA 1YITI 3TP3A 2QVOA 2HZDA 4XK4A 2ICWG 3WTUC 4Y7NJ 4PSWA 2R7ZJ 4DBQA 3B73A 3HSRA 2VC0A 1ZG1A 4P5OA 2LNBA 2QWWA 4G12A 1RPWA 4A3IJ 3I54A 1W0TA 3A01A 4B3AA 1YHQI 5LEJA 1R71A 4FTHA 5KVRA 3I5UA 1J09A 2A6EF 1I6XA 2DBBA 4XICA 3TMOA 2FOKA 4DW6A 2QQ8A 2BW3A 4F91B 3VSLA 2L4MA 1KQ0A 4MIMA 4L5JA 3ZXSA 2MSYA 1MMSA 1MMGA 1I50J 3G2BA 3OYNA 4BGDA 1WFXA 3OL4A 1K6OA 2XGXA 1WJEA 2CG4A 3CMMA 5H20A 1U78A 1QRYA 4P96A 1MDMB 1GV5A 1QO0D 4KN4X 4HV5A 4QSHA 4ZDLA 4DYCA 3VFZA 2E7XA 3V8JA 2PG4A 3RI4A 5KHDA 1YRNB 2A3SA 4RB2C 3P9KA 4EJUA 3DBLB 1I3AA 2QKMB 4GGGA 3JRDA 4FT8A 2JSPA 4RAGA 4I2OA 5ICEA 1W5SA 3R4KA 3PQKA 4WK8F 3GO5A 3IWFA 2Q0OA 2BOLA 2GXBA 1X1CA 5TISC 4ZC3A 3D5LA 3H0GJ 2XPWA 3IV5A 1DDNA 2Y0SA 2EV0A 1UG0A 4RGUA 4G6TB 1MNMC 2Y69H 5ILUA 1JUMA 3HOTA 1Z1DA 4D7NA 4M73A 4F55A 4EJOA 3HBLA 3GTMJ 2E35A 1LVAA 2JVGA 1XDUA 2WA0A 3BT9A 1UB9A 3CTAA 1T0FA 4IQ4A 3SEZA 2EWNA 3HPGA 5EGOB 1FYKA 3KLOA 2V1UA 3E5UA 3CDLA 1JUPA 4XIDA 1JHHA 1SFXA 4YFKF 1ZRFA 2FBHA 5K7HA 1XGMA 5F0CA 2H6BA 3CZ6A 5FD5A 4UUVA 1JUSA 2L0KA 2WBMA 3BZKA 4M9ZA 3ZOBA 5JFRA 3H3ZA 3BJ6A 1VTNC 2NS8A 5HDKA 1IUFA 3HKZN 2DA2A 4ITVA 1UFMA 3L1PA 4OIQF 1BR1A 3BY6A 2HQAA 3VPRA 4JK1X 1J0RA 3MN2A 5EZGA 3CLQA 5E8GA 3S1QJ 1FOXA 1BJAA 1E3HA 3H5RA 4A3EJ 1S7AA 2CW0F 1P7IA 2DK8A 4KITB 1ZARA 3SDBA 1K6YA 2Q2EB 5J1YA 3WTTC 3CMYA 1XGOA 2Q1ZB 3PJRA 3QRFF 2MYSA 4XLHA 4BE0A 1ITYA 4I01A 2R4GA 4BQQA 4I09A 1XMAA 2AQEA 3BC8A 2ETHA 4NDLA 3HOYJ 3V7RA 3J7ZI 2KFDA 4AIHA 3G1MA 4Y4RA 4B43A 1A6QA 3CCUI 4XLFA 3O6BB 1SMYF 5CVJA 1D8KA 2BE5F 2ECBA 1U2WA 2WB1A 2WY7Q 4CSWA 5C3EJ 3TOAA 3OY9A 1EV7A 1IN7A 4PJJA 1KYZA 1N78A 2NVQJ 1ZYRF 2K4JA 2BY2A 2BW3B 4GXOA 1MBEA 2HXIA 5HLIA 1FBSA 1W4MA 1LEBA 4BHCA 4M6XA 4AIDA 3I0TA 1ZH5A 2HOAA 2K9MA 1FP2A 5ICGA 3C7JA 1A35A 2KRCA 2QGUA 4A0ZA 2Y9ZA 4KDPA 3BCBA 3K4BA 2XPVA 1U8BA 3L9FA 3LSPA 3BG7A 3F6OA 1VQ9I 2J5PA 3FXJA 4UV8A 2QSHX 2F2EA 3BROA 3Q0VA 4A3DJ 5F64A 1RC9A 3J80Z 5M3MJ 1I3QJ 1WPKA 4FE4A 5IT3A 2V79A 5EF6A 4CZCA 5TGTA 3OYMA 3KZIC 2NVUB 3JR9A 2FNPA 1X2NA 3MWMA 3DTKA 3K70C 2MH9A 2O9LA 2QBYA 1FBUA 3Q9SA 2QQ9A 3UNGC 3I4NJ 2TRTA 2DFFA 3G4SI 4LLNA 3QYFA 1WQ2A 2B0LA 2L3DA 1YLFA 3FHNA 3ML6A 1BI0A 3K6GA 5L3EA 1ETXA 2GOXB 3J7YJ 3VYSB 1O3QA 4ON0A 1WJCA 2DA3A 3CUOA 5EYRA 4JQFA 2O03A 4MO7A 4LLLA 1D3YA 5EJCA 4ZYAA 5D5XB 1D5VA 4A3BJ 3D5SC 5KCMA 1JKQC 3GUDA 3NWTA 2BHZA 1YJ9I 2XPUA 2A69F 4A3MJ 1Z0XA 2CQXA 2FRHA 2EV6A 3GTPJ 4M74A 3S3OA 4C2MJ 2NOGA 2OD5A 3K0LA 2IA2A 2MD0A 2XAQA 4BDZA 1Y1WJ 3CO7C 4IHXA 3CD6I 1U3EM 2D1VA 2P4WA 2LFBA 1FC3A 2X1EA 1XMKA 2ZXWH 1X1DA 5F0HA 2IEKA 2IGNA 5LBQA 5LGUA 1WJ5A 3TW6A 3H9GA 2X6YA 2VQGA 3DV8A 4BACA 3F22A 3DP7A 1AA7A 2ZNZA 3V8LA 2D45A 3O8HA 1YI2I 3A2KA 1JI8A 3AKZA 1LDDA 1TNTA 3IAS2 3WODF 3KEQA 5LGNA 2I5UA 5DUIA 3CCQI 1N77A 1JE8A 2M4KA 1VQ5I 2X51A 1LFUP 4ENKA 1TW2A 2JUGA 3CP2A 3HEFA 3LFUA 3RKXA 3K4LA 4HEA2 2CV1A 3Q0UA 2BY0A 2VUMJ 2BY1A 1CF7A 3FM3A 4V2FA 1W36D 2DMNA 1MNDA 3TGNA 5HDGA 2VE9A 4LGWA 4KMFA 4IHYA 4WXHA 3PSFA 1YW8A 1HW1A 3DU5A 4QPQA 3BDDA 3ZPLA 2EINH 1WZ2A 4JX6A 3SZPA 1DPRA 4MEYF 4NQWA 5K5OA 2XRLA 1LEAA 5D6EA 1BJZA 1KU2A 4PSXA 3OYGA 4AYBA 4U7BA 5A2QZ 3LSKA 1IZ1A 1WHUA 2NXNB 1FLIA 2CS3A 1BIAA 5F6FA 3QPLA 1JT0A 4IRGA 1MD0A 4MFEA 1YJNI 1DGRM 3CO6C 4B44A 2G0EA 2ZJRF 1OYWA 1SFEA 4A12A 5GAGJ 2FNAA 4HZFA 4BXFA 1TWAJ 4RAFA 2O8KA 2ELJA 3KFWX 3T8RA 3EPZA 2DOEA 2L5QA 2Z5UA 3GXOA 4I99C 1MH4A 2HPMA 3J7AY 1W1WE 2STTA 1E0EA 2X9DA 2F5FA 1IN5A 2AQFA 2A5YB 2ZMEC 3OIOA 4XMYA 3FBIB 3WU1B 3BQYA 2DYRH 4G7ZF 1J5YA 4ENNA 3K4NA 3LSTA 3WGHA 1YQAA 2PLYA 4A6DA 1RETA 2DU9A 2CSOA 3FMRA 4HNTA 4KFCA 2PJPA 3CC7I 1HKTA 1JT6A 2KDOA 4CGZA 1SD4A 1KU3A 1D1CA 4LFUA 2QSGX 1Z77A 2CFOA 5FKOA 1A5JA 4RGRA 1LPQA 1XS9A 4XKCA 3R60A 4M6YA 4N9IA 1ZGAA 3W3CA 4AIKA 4CCMA 1REPC 5CVUA 1RUOA 4A3LJ 4MQVA 2GQQA 2HZTA 2R7UA 2R7TA 1TZLA 1HA8A 1GV2A 3E1SA 1MJBA 2IGMA 2WAQA 1EKEA 4ZDOA 4EV0A 3I4MJ 3QOPA 2LMDA 2OJED 2V26A 1JTYA 2W48A 5H6QA 3PUFA 1IW7F 3CCYA 4PUSA 4CZZA 4L0ZB 1ODDA 5BOXA 3MEXA 3N97A 3IKTA 3DPTA 2L9NA 2X1CA 3SYTA 5AONA 2CFXA 2LOOA 2R7RA 1KA8A 3JTHA 4U7DA 3B6CA 1E2XA 2L9SA 3ABKH 3ELKA 1SD7A 3PFYA 1JXSA 4L5EA 1VQ6I 2LY2A 2IP2A 5JHUA 1I1SA 1P2FA 3CESA 2CV2A 2F48A 3FX3A 3FKIJ 3OYCA 5HS9A 2VT3A 1PUFB 4ZTJA 3SEQA 2JPBA 2ZJPF 2OCEA 2E1OA 3ULQB 2VODA 4E7HA 3J80K 1YIOA 3LWFA 5FRNA 3ZQIA 4D7MA 1MBKA 5L3GA 5LGTA 3GW2A 2ZBKA 3G73A 4CYCA 5EEAA 1K83J 5CYVA 4MHGA 3SQNA 1J9IA 2VKEA 2LBFA 4GO1A 4HA8A 2EZKA 2J5OA 2V9PA 3BPVA 1HCRA 4IHVA 4PZJA 5E1WA 1R4MB 1Y6IA 2QYOA 3SZGA 5IY5H 2VKDA 2P81A 2V9VA 2Z1DA 2ECCA 1V5EA 5LLQA 3WTYC 3CQZJ 3TDZC 1R5HA 1OKRA 3OSGA 4AU7A 1OCCH 4BJ6C 2KT0A 2GIZA 4EGZA 2GWRA 2ZNYA 3U1DA 2EZHA 4N4NB 2L2OA 4BNCA 5ILVA 3CF5F 5JI6A 1ZLJA 1EH6A 1MSEC 1W7PA 3HRUA 3KE2A 3HB9A 5GP9A 3DFGA 4D0PA 2K3FA 2WAEA 2HI3A 4LG0A 1QHGA 5CVIA 2XASA 3F3XA 2HOSA 2MGQA 2CWEA 5JVTA 1QA6A 4WXCA 4IRHA 4B09A 2CUEA 1KYWA 1OQYA 1YW9A 3DQVC 3M8JA 1P4WA 2IBDA 3HUGB 3RTRA 5F04A 4OIRF 3V7SA 4C3HJ 2WWYA 1ZREA 5DCMA 4RB0A 2KP6A 1O7FA 3CJTB 3X2QH 4BJTA 1G59A 2RGVA 1V3FA 3O8GA 3IHUA 2L01A 4HYEA 4XN3A 2HDCA 2EBIA 3ECOA 3K4MA 2O6GE 4XRFA 5BMZA 4RB1A 1ETWA 3H9JA 4RLQA 5FLXZ 2DODA 2TDXA 3EUHA 1JGSA 1IO2A 2VB6A 1TWGJ 4PFPA 3T8TA 1F5TA 3MKZA 1D0ZA 3HL2A 3LSJA 2M9HA 2VQLA 3VYRB 5B3SH 2D5VA 3G71I 1X3UA 1F1ZA 3DLAA 3FMSA 3ZMTA 5GAHJ 2ID3A 1UELB 2DA1A 4V2GA 2P0WA 3ERMA 4KIGA 2M7BA 1L0OC 4BL0B 2UZKA 2Y0MA 3E6BA 1ZGWA 1RIOH 3BR5A 2M4GA 5D4SA 4M9SA 3BP8A 2E1MB 1DU0A 2JA5J 3FM5A 1ON2A 4XLEA 3P7NA 3FF5A 1L3LA 1BI3A 4IPAA 5A2QK 4Y17A 1FMVA 3F8FA 4RMNA 4DOZA 4EMSA 3ASOH 3K4JA 5BNGA 1MBFA 3CMEI 3HTSB 1Z7LA 2KKOA 3GFMA 1HW5A 5FGMA 1BI2A 3KP5A 2M0MA 4IJAA 4G7HF 2O61A 2E60A 1MDMA 1ZAOA 2W25A 2XB5A 3LSRA 1QQIA 2DTRA 3FISA 5E3OA 3LAJA 4O3MA 3HOSA 1ZRCA 2IPQX 4IF4A 4HX7A 4IOAF 1SFKA 4E4HA 4CYCB 5L3DA 4A3FJ 2NVTJ 4AM3A 4JBAA 4XR6A 2RNGA 3RSNA 3KZZA 3TDUC 4A5NA 3MAJA 4R1HA 2LLKA 4IXAA 2LBFB 3K70D 3UR3C 4F52A 4BXXJ 1LNWA 2EQRA 3S93A 1QNTA 1OFCX 1R9TJ 2JQ7A 4IZZA 1IXRC 4HBLA 2DJIA 5J47A 4UV9A 2VKHA 2X85A 3MKWB 2JA6J 3FMQA 3MCZA 3LNQA 5IOYA 3RCOA 3CDHA 3ZCOA 3QP5A 2B9SA 3WTWC 2JWTA 1XG1A 2DMPA 3DPLC 4U0WA 2W00A 4RGXA 4CCNA 4C3IJ 3FZVA 3LSMA 1B1BA 3OV8A 1TTYA 2XDVA 4P9FA 2MG4A 5EGOA 3BQZA 4GYIA 4WX9A 4CCLA 3RJPA 4AVPA 3QWLA 3KIOA 1YW7A 3B6AA 1BI1A 3TBIA 1OCTC 2ZFUA 3Q9VA 3J7AO 1SAXA 3RYPA 5DCMB 4A2UA 4LLGF 1R1VA 2HYGD 4NC8A 2QZ8A 4O5VA 3FXUA 5CJ9A 2VT2A 1MSFC 4Q48A 2QKLB 2OZ6A 1YX3A 5ED4A 2ZXHA 3SHFA 3DWLE 1KGSA 3JTGA 1M1EB 4NNJA 1G3TA 3OMYA 4BKXA 1ETOA 1U9NA 2EB7A 4DZJA 3GTOJ 1SVMA 1TW3A 5FD6A 3Q5FA 2CQ7A 3ABUA 2Q2EA 2ZSIB 3S32A 1B6AA 2KZVA 2C6YA 2ISYA 2W85A 1Z3YA 1VQ8I 2DK5A 1P6RA 2JRTA 4UVAA 6PAXA 1TWFJ 3LQRA 1TL8A 2AS5F 2H94A 1QPIA 2HNHA 2R92J 2UXXA 1WJBA 5JVGF 3W6VA 1MMNA 1BN5A 1QGPA 3V8KA 2FD5A 2ADUA 3MVPA 1JKRC 4A3CJ 1BOAA 2Q8KA 4MLOA 4HQMA 4L5IA 1YO5C 3S1NJ 4IQJA 1FX7A 3GLXA 5LRRA 4HLYA 2FU4A 2FBIA 3IH3A 2DFIA 1FSEA 1JHFA 1Z6RA 1S9HA 2M3AA 3PSIA 4RAYA 1FBQA 4II2A 3L00A 2COMA 3PM1A 1T39A 1LFBA 3A4CA 5KAIC 4U0VA 2WC2A 2K27A 2Y75A 5FB2A 4UB6C 4ZJZA 1Z91A 1Z6TA 2P8TA 5DD4A 4U0YA 1IDYA 5F1JA 4WWCA 2Z9OA 1KQ9A 3EETA 5K1YA 2JVHA 5F0FA 2CV0A 1ETQA 4YFXF 1OISA 3DKWA 2Z3YA 1WKMA 2TCTA 4Y3OA 2XGDA 4L9TA 2JJ7A 3K9TA 1T0FC 2H6CA 4XL9A 2ZJ2A 3WG7H 2PMZN 4E7JA 4XOTA 5FLXK 2AXTC 2CRGA 3S3NA 3RKWA 2RAEA 3OYLA 4KISA 1R5ID 4IHWA 1N75A 2M5WA 2H1KA 2Y30A 3A0HC 2JK3A 2HXOA 3GFLA 3D5RC 2PFBA 2X6OA 1Y8QB 4DGWB 4B8XA 4EM2A 2M30A 2GZWA 1WH7A 5BS6A 2R7VA 5KAFC 2XAUA 2M8EA 3HGGA 2GLOA 3ZGKA 2W7NA 1HBXG 4YIFA 2NS7A 2XAFA 1H0MA 3A03A 3L09A 2F5VA 2R7OA 3IWZA 1Y56A 4ZYEA 3KP3A 1O3RA 3M4OJ 3H35A 5BPDA 1LE8A 2V1DA 1Q1HA 1TWHJ 5IPAA 3LAPA 4HQEA 4JX4A 4BXUA 5IT9Z 3EYIA 4E7ZA 1BR2A 1WVRA 1BIBA 4AC0A 4KYWA 3HRMA 4AUXA 5FJ8J 1F9NA 2V4JC 1FYLA 3I9V2 2XGEA 4B48A 1NG7A 5C4XJ 3PUBA 1EJ9A 4NC6A 4BDYA 3FK7A 4ZYGA 2M7AA 5DYMA 2A6HF 2H8WA 3HOZJ 1R23A 2K4BA 3BJOA 1AOYA 2K85A 2BY3A 2L7KA 3K69A 1ZK8A 2DPDA 1O3TA 3CJRB 5E3MA 4LB5A 2H1LA 3AG2H 1W5CC 1I27A 1MMAA 5CLSA 2VOPA 2MC4A 5FKMA 3CMAI 3NQOA 2L7FP 1LDJA 3BTCA 1IJWC 1S8NA 3C1DA 3BZCA 3H3UA 2KJBA 5BQTA 5M5XJ 4BBSJ 1TWCJ 2IJLA 3LL7A 3NWSA 1D5YA 2M34A 3QPTA 3V7CA 4XSXF 1AKHB 1FTZA 1G4DA 1Z21A 4KT5C 3ZN1A 5IOZA 5FO5A 4BAYA 4BBRJ 3RPUA 3OYDA 1HKQA 3BTIA 3VWBA 3LA2A 3HDDA 4G6QA 3RPQA 1E3PA 2QF7A 2DTZA 3F8CA 5K7ZA 1YFHA 4UVBA 1OYIA 3R0AA 1D1AA 4PJLA 4FQGA 1GVDA 1VNDA 2XF7A 2O5RA 4BHPA 2QQAA 3HOUJ 1ZLKA 1FIAA 4GYGA 3J81K 4AWXB 1RNLA 2R5YB 3PL8A 4KJZA 3HG9A 1OMIA 2KZGA 1GDTA 1TT0A 5IYBJ 1K78A 2RC4A 1VI0A 5GAEJ 1BW6A 1XSXA 4WF2A 3GCMA 1FNNA 3TKYA 3HXLA 1UHSA 3DTEA 1KU9A 2V7FA 3IC7A 2ME6A 4P55A 2F5CA 1Y0NA 2I10A 1OJLA 1B9MA 2EIKH 2R7WA 3M7GA 4FE7A 2OCCH 4KICA 1RR8C 2MLKA 1HLVA 2E2HJ 3N4MA 5FLVA 4BE2A 3BTLA 3ERED 1ULYA 2EFPA 4M6VA 4F93B 2K40A 2L9VA 3ZQHA 4DZPA 1P9QC 2LRDA 3OYEA 4ZH4F 1MKMA 2QSFX 2HOEA 3AG4H 3VOEA 3FHZA 3EYYA 1WH5A 4ZTFA 1OCOH 2QA4I 5AIPA 1ETKA 1OCZH 2B63J 3PO2J 5DM7F 2JRMA 1LE8B 3BR0A 2ZC2A 1Y8RB 1F36A 3QPSA 4ZZLA 4YIRX 3TQNA 3FIWA 2FOWA 1BL0A 3CCLI 3I64A 4W97A 3C2BA 4UHTA 2ZCWA 2VBZA 3CUQB 4S0HB 3WTZA 2WY8Q 2M87A 4X1EA 1P4XA 3OYFA 3E6CC 5FRMA 2LKXA 3HIFA 3EUKL 2ZSHB 3OR1C 2X1DA 2XHKA 5CQGA 4ANJA 1PUFA 4HF1A 1YS6A 1ZHFA 4M3GA 2BYVE 5FFXA 3HKZA 4X0GA 3OYKA 1DQUA 2VPRA 1NK3P 1B72B 3DEUA 4NC7A 4M72A 1LB2A 4Y15A 1D0XA 4BQNA 2A61A 4FETA 2EFOA 1ZG5A 1RRJA 4DJAA 1XMXA 2RNJA 5J1UA 1IRXA 4IKFA 1DU6A 1IAWA 4PK4A 1QHHD 1R1TA 1S6LA 1GXQA 2NRAC 2HQRA 3KYLA 2IS2A 1R1UA 1TLHB 3H3VK 1NG6A 3I55I 1WSUA 1FMWA 2KJCA 2JA2A 2HFHA 2QEXI 2LG4A 5FFZA 2XSJC 2E2JJ 5JR3A 2FMLA 1GHCA 1YS7A 4EM0B 2OF7A 2VN2A 1N25A 3NRVA 1O4XA 5L3BA 1X4OA 2WV1A 4G8XA 3C3WA 1YTYA 1FOKA 4MTEA 1J2XA 3DBHB 2DJNA 2ME0A 3WTXC 4I7HA 3REOA 2ZXIA 2XVCA 2A05A 4LIVA 2EZLA 3SFIA 1R5GA 2ESNA 3MZ8A 4XKWA 1PUEE 4CA0A 5E3NA 2L7ZA 2RQQA 2DT5A 4DNCA 4Z2YA 2G9WA 2M45A 3DU6A 3HUGA 2V6EA 1S29A 3C2GA 3LSGA 3HSEA 3IRRA 1OYYA 4RM2A 3VB2A 5HLGA 3L2UA 5E20A 1K78B 3ZMSA 3M07A 2R7XA 3OS2A 4FASD 1HW2A 2F4MB 2VKVA 4LOCA 3TW7A 5CVVA 1I5ZA 1OLTA 4D5CA 3IL2A 3MKLA 1PP7U 1E17A 2DT6A 2NYXA 1BOBA 4C3JJ 1LFPA 4DYRA 2HDDA 3W2VA 1TP4A 2DMUA 2Z33A 3HOWJ 4Q5SF 1IV8A 3OL3A 4HDUA 1IRGA 2LKPA 2GXAA 2Y2ZA 2FQ4A 3FDYA 5HVQC 1YG2A 3WGGA 2XAHA 2RKHA 2R7DA 3I53A 3SZTA 1B8IB 4ZZDA 3JSOA 3JW4A 2K02A 1SD6A 1H88C 1A6IA 2A6TA 4KT6A 5ILSA 4EJTA 4EJVA 3GF2A 2EIJH 1G8XA 1R6RA 3BPXA 1NK2P 2ZKZA 3H1CA 1SEUA 1VQ7I 3R61A 3F23A 2P7VB 3WTVC 2ELKA 1NTCA 2LH9A 4N4OB 1HF0A 3DLLF 1XC5A 1Z05A 2DMTA 2HKXA 1YJWI 4TV7A 1OR7A 1X58A 2ZB9A 5GTHC 3IUOA 2R3SA 1MNEA 4A3KJ 4EATA 5D5WB 4WXDA 1NHAA 3HHHA 3WE3A 4I6ZA 2O8XA 2YR2A 5M5YJ 1KONA 2DDBA 5JLWA 1FEXA 1AWCA 3K7AJ 1EF4A 4GCVA 2MA3A 1GXPA 1U9OA 1FZPB 2EILH 3K1NA 5IP6A 1Z3XA 4BQOA 1Y1VJ 1DPUA 1D8JA 2W1OA 2LREA 3HZJA 1T8IA 5LHHA 3ZQLA 1Y0UA 4NHJA 1PDNC 2F5DA 4HF2A 3KPHA 4I0BA 2LC2A 3G1OA 3VODA 4FISA 2BZTA 2E1NA 4BY7J 2V1XA 3NAUA 4M3EA 4M3DA 4LK1F 2OTLI 1SMTA 3G6EI 1IXCA 2X0LA 2GA2A 4YFNF 1T98A 1RKWA 2IGKA 1S5LC 1FOWA 2L9RA 3U2RA 2HYJA 2EZIA 3F8BA 4L9JA 3S2WA 4XSZF 4W1UA 2FMYA 2HKOA 3EUHC 2K7LA 3KLNA 5CQEA 3LOCA 4BYYA 3ISPA 5EDNA 1ETVA 4CCJA 1G3YA 3ZMDA 4HPQA 4LK0F 3HRTA 1A31A 3AAFA 1YYVA 2RV8A 5B1AH 1BR4A 1QVUA 5GPCA 2XSDC 2CMPA 2I8DA 3CCEI 3GTGJ 4QWQA 3G1LA 2CUFA 1X1AA 3L2WA 4H0EA 3CLOA 3ZMZA 1JJ8C 2R5ZB 2P6SA 5J3LA 2WTEA 5DM6F 1H9GA 4JX5A 1H8AC 4LD5A 3T0YA 1XDSA 3BWGA 4BY1J 3CP8A 1V54H 3JRFA 4FX0A 1XGSA 2QCOA 2W4SA 3M8EA 4HV6A 4HDVA 3CJQB 3LFKA 2D1HA 3GTQJ 4F7ZA 3BR3A 3EDPA 4A6EA 4C30A 4M3FA 2A68F 3ZP5A 4XLNF 2ISZA 1YIJI 2IVMA 3FXQA 1JKPC 2MW8A 4IL6C 2DQLA 4CO8A 5J1RA 4BS9A 4Y13A 4XLCA 3DKYA 2JA8J 1B4AA 1MW7A 3SJMA 1IN8A 3CCJI 2FXAA 3F9KA 2EV5A 1IV6A 2CUZA 1T38A 2FE3A 4ESFA 4DIQA 4PDKA 4CH7A 3ZR8X 5FROA 2VQCA 1XSVA 1VF9A 1XPXA 1EH8A 2YU9J 2FA5A 5ICFA 3WGIA 3CCSI 2G7UA 3V42A 2X6XA 1GT0C 1IC8A 3I3LA 4LIUA 5B66C 3HSFA 1LUJB 2JMWA 1UCRA 2HEOA 5J40A 2M0CA 2EFWA 2KPMA 3JRIA 1H89C 1G6NA 4J19A 1JKOC 3EUAA 4IEJA 1RI7A 2X48A 2Z2SB 3JRAA 5KNLA 3F8MA 4OWRB 1UG2A 2FJ1A 5JLXA 2VQHA 4RGSA 2DW4A 4XLPF 2KIFA 2HWVA 5HOOA 5D6FA 4UUSA 3L2CA 1O57A 2F6CA 1USSA 5EG0A 2GOMA 2BGCA 4P9UA 4EQQA 2NS0A 2IRFG 3IH4A 1O7LA 3H36A 2Z99A 3A0BC 3OR2C 2E71A 1HOMA 1SVOA 4XQFA 1IG7A 3HJEA 3ZRGA 5B1BH 2HS5A 1ERDA 4S04A 2ESHA 2DCEA 3QYEA 3HRSA 2IS4A 4C9YA 2ACJA 1J7KA 1R7JA 3ESWB 3KEYA 3V4GA 2QENA 2Y0SN 4BHBA 1U5TB 1SAUA 2AXLA 2MABA 3JAMZ 3H0DA 2X6WA 5LHGA 2R7QA 3GBGA
chains in the Genus database with same CATH topology
2M7AA 1N77A 2M4KA 2X51A 2JUGA 3CP2A 3LFUA 4XN0A 3FKJA 2L7KA 3K4LA 3LSIA 4PFOA 4HEA2 4YRVA 2CV1A 3CJRB 1MMAA 2MC4A 1W36D 1MNDA 4NQWB 2IXSA 2DXIA 2HVRA 2VIXA 5HNFA 3PSFA 3AFHA 3DU5A 3OIQA 4QPQA 3LL7A 3NWSA 3OS1A 2CUJA 3A1YA 3OWTA 1V5FA 2PJRA 4BU2A 3PNYA 1Z21A 3W2AA 3PNTA 3OYGA 4PSXA 4XM3A 2HU9A 4AYBA 4U7BA 5HNHA 3LSKA 5JHFA 2CS3A 4HNUA 3OYDA 3RPUD 3VWBA 4F92B 1MMDA 1DGRM 3E0JB 4AVZA 4B44A 1D0YA 4HRIA 4XLAA 4BXFA 4Y33A 3L2VA 4E7SA 4J00A 1D1AA 2ELJA 4PJLA 3EPZA 3QYBA 1WJFA 2L5QA 2XF7A 2HPMA 4YELA 4HSRA 2O5RA 3J7AY 3K4CA 2KQRA 1E0EA 2NOJB 2AQFA 3OYAA 4XMYA 3FBIB 3K4NA 3PL8A 4KJZA 3HG9A 2VXZA 1TT0A 2K9LA 4HNTA 1T95A 4CCOA 2KDOA 2KL4A 3H5NA 3HXLA 3DTEA 2CH0A 2V7FA 1D1CA 1PYVA 2IS1A 2CFOA 2R7WA 4JOMA 4XKCA 3W3CA 2K3PA 4CCMA 3C2HA 4BE2A 1GLNA 3OIPA 4BJ5C 4XNFA 2HDWA 1PJRA 2UV1A 2VJ4A 3OYHA 2R7UA 4F93B 2R7TA 4B3XA 1TZLA 2KHMA 1HA8A 3E1SA 1P9QC 2IGMA 4BEHA 2WAQA 4ZDOA 2W82A 2LRDA 3OYEA 2V26A 3TL4X 1X1BA 4PUSA 2CW7A 4ZTFA 3FBNB 3AL0C 3DPTA 2L9NA 2X1CA 3SYTA 4YEJA 4CUGA 2OV7A 2R7RA 2LOOA 2L9SA 4C2TA 3PFYA 2LY2A 2E5NA 4D9JA 3CESA 2CV2A 4XONA 3OYCA 2XC7A 4ZTJA 3SEQA 3AL0B 2E5ZA 4E7HA 2WY8Q 4HG2A 5FRNA 3OYFA 1W36C 3BLYA 5FRMA 2VPLA 1UAAA 4BUPA 3EUKL 3OYJA 2ZSHB 3OR1C 2X1DA 5CQGA 4ANJA 3HPHA 3M1CA 2DT7B 3LSHA 3HKZA 4X0GA 3OYKA 1DQUA 4NUBA 2LBFA 4NC7A 4BQNA 1D0XA 4FETA 4RM3A 4RLFA 4DJAA 2FUG2 3IAM2 1IRXA 4IKFA 4PK4A 4OAYA 1Y6IA 1QHHD 2LY1A 3SZGA 2VLAA 2VKDA 1D1BA 2Z1DA 3KYLA 2IS2A 1V5EA 1NG6A 1FMWA 2JA2A 1LDKB 3L2QA 4AU7A 4BJ6C 2V9KA 2LG4A 3CF2A 4OAZA 2PJRB 2XSJC 1VZ0A 4N4NB 2L2OA 1LKXA 2IGOA 1DP3A 4II3A 2WAEA 1QHGA 4CCKA 1X4OA 3DEEA 3L2RA 3DKXA 3DPUA 5HLTA 3DQVC 4E6KG 3M8JA 5CKTA 2A5WA 3HUGB 2OC6A 4LITA 3RTRA 2ZXIA 4QPOA 3RQ4A 4LIVA 3MMYB 4XKWA 2KP6A 4XOPA 4P1WA 4CA0A 2VJIA 3ZQQA 2RQQA 4BJTA 1LVKA 1G59A 3DU6A 3W2WA 2V6EA 3LSGA 3C2GA 4XN3A 4ZDPA 3K4MA 1WJAA 4RM2A 3L2UA 2HZDA 2VASA 3QODA 3H9JA 3OS2A 2R7XA 4PSWA 4FASD 4RLQA 4PJNA 4DBQA 1OLTA 1X4PA 2F4IA 2VB6A 4P5OA 4PFPA 3MKZA 2DT6A 1D0ZA 3HL2A 2VQLA 3VYRB 1BOBA 4IX7A 3DLAA 1LFPA 1UELB 2R7SA 2P0WA 3W2VA 1EA3A 2M7BA 4BL0B 2XF5A 1J09A 3OL3A 2M4GA 3TMOA 4BEHB 3FDYA 5HVQC 2BW3A 2E1MB 4F91B 3OYBA 3VSLA 3ZXSA 4E7KA 2PMZA 1MMGA 3G2BA 3OYNA 4BGDA 2UWMA 1WFXA 2A6TA 4KT6A 3OL4A 4XLEA 1WJEA 1G8XA 2LYCA 3CMMA 1R6RA 1FMVA 4DOZA 4RMNA 2WADA 3K4JA 2VJ5A 4ZDLA 2LH9A 4N4OB 1Z7LA 4E7LA 3IUOA 5KHDA 2M0MA 1MNEA 4XKVA 4EATA 2VXDA 2E60A 2MFZA 4PJMA 2QKMB 3ONQA 1KONA 3HOSA 2JSPA 1SFKA 4E4HA 1WJDA 4XR6A 2RNGA 2BOLA 4LG3A 4U87A 4DBRA 1X1CA 3RSNA 4ZC3A 1Z3XA 3D5LA 3H9QA 4BQOA 3K10A 1QU3A 2Y0SA 2W1OA 2LBFB 4E7IA 2LREA 3UR3C 3K70D 4F52A 1UG0A 4G6TB 2XF6A 3S93A 2HVSA 3BG6A 3HOTA 4IZZA 3S3MA 4F55A 2K5CA 2JVGA 2DJIA 2LC2A 1X19A 3QOEA 2Z16A 2WA0A 5LFAA 2VKHA 2X85A 3MKWB 2RREA 4XKBA 5LD2C 1U0JA 4IQ4A 3SEZA 3HPGA 3RCOA 3ZCOA 3DPLC 2IGKA 2W00A 4CCNA 3CZ6A 3LSMA 2WBMA 2XDVA 3VDXA 1DGWY 4CCLA 3VYUB 3OOUA 4ITVA 3TBIA 1BR1A 2ZFUA 3EUHC 2HQAA 5CQEA 4NC8A 4CCJA 4HPQA 3H5RA 4BE1A 3U21A 4C2UA 2QKLB 1BR4A 4KITB 1YX3A 1K6YA 2Q2EB 3SDBA 2ZXHA 2CMPA 2I8DA 3VYTB 2Q1ZB 3DWLE 3PJRA 2MYSA 4NNJA 4XLHA 4BE0A 2CW8A 2VL8A 3OMYA 1X1AA 2R4GA 3L2WA 3DTIA 1YE9A 4BQQA 3HC7A 3H5AA 2AQEA 3BC8A 2HPIA 1V5GA 2ZSIB 3CP8A 3S32A 4R79A 2KZVA 2W4SA 4Y4RA 1Z3YA 4B43A 3CJQB 4XLFA 2HNHA 2WB1A 2WY7Q 1WJBA 4CSWA 3OY9A 2E1MC 4C30A 1MMNA 4PJJA 1N78A 2IS6A 2BW3B 3S8PA 2BVMA 4MLOA 2BVLA 4BS9A 4IQJA 1OR7C 4XLCA 3DKYA 1MW7A 1S9HA 2K9MA 3F9KA 2CUZA 2M3AA 2OUMA 3PSIA 4II2A 4DIQA 4CH7A 2KRCA 3ZR8X 5FROA 3LMMA 3BCBA 2VQCA 3K4BA 3A4CA 3BG7A 3V42A 2X6XA 4ZJZA 4J01A 4CZCA 3I3LA 4LIUA 5TGTA 3OYMA 3DTKA 3K70C 4D1QA 2JVHA 2KPMA 3IP4B 2CV0A 3UNGC 4F3QA 3MD2A 3QYFA 3EUAA 2KRHA 4Y3OA 2KLOA 2Z2SB 3FHNA 5KNLA 1T0FC 4OWRB 4XL9A 3K6GA 4E7JA 4XOTA 1ZELA 2GOXB 2VQHA 3K4KA 3VYSB 3S3NA 2WAFA 3OYLA 1WJCA 3VSKA 5HOOA 2HVQA 4KISA 4JQFA 2UUZA 2F6CA 1N75A 1YX5A 2GOMA 4DGWB 3D5RC 4ZYAA 3OS0A 4H4KC 3D5SC 5KCMA 3NWTA 2VJJA 4GRIA 2R7VA 3OR2C 3OYIA 2XAUA 3ZGKA 2W7NA 4XQFA 3S3OA 3ZRGA 4HSTA 2F5VA 2R7OA 1ERDA 2MD0A 4BDZA 2DCEA 3QYEA 1Y56A 3N05A 3H35A 2X1EA 2IS4A 1X1DA 4XORA 4C9YA 2IGNA 1WJ5A 2V1NA 2DOAA 4BACA 3H9GA 2X6YA 2VQGA 3KEYA 1BR2A 4E7ZA 3KX2A 1AA7A 3A2KA 2V4JC 5CPRB 3I9V2 4B48A 1JI8A 3MKYB 1NG7A 1SAUA 2MABA 3AKZA 2KMUA 3PUBA 3H0DA 2X6WA 3BCAA 2R7QA 3IAS2 3PNVA 3GBGA 4BDYA 4B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHD A;  4OAZ A;  2MC4 A;  4OAY A; 
#chains in the Genus database with same CATH topology
 3BZ6 A;  3E7L A;  3TO7 A;  4MGR A;  2E34 A;  4LB6 B;  3H92 A;  2L54 A;  1K61 A;  3LSI A;  1WWX A;  2P7C B;  3HGY A;  2NNN A;  1IUY A;  1RKT A;  2Y31 A;  4B4C A;  1FIP A;  1UMQ A;  4NB5 A;  3ECH A;  1B9N A;  2DXI A;  2CQN A;  2HVR A;  2R7F A;  2VIX A;  5HNF A;  3JRC A;  1BM9 A;  3BOQ A;  4HNV A;  1F43 A;  1STZ A;  4CDG A;  2LTP A;  3AFH A;  1AU7 A;  2P5K A;  3OS1 A;  2CUJ A;  2UXN A;  3OWT A;  1NH3 A;  1V5F A;  1ZG3 A;  2H8R A;  4PCQ A;  3PNT A;  3WG9 A;  3E97 A;  2HU9 A;  4XM3 A;  5HNH A;  3K2A A;  3R0J A;  1JJ6 C;  4MEX F;  5HOD A;  5JHF A;  4HNU A;  5D4R A;  2DA7 A;  3QPH A;  2D2W A;  1ONV A;  4I02 A;  4F92 B;  5K7F A;  5F08 A;  1MMD A;  2ZFW A;  3AG1 H;  3E0J B;  4AVZ A;  1AKH A;  1DP7 P;  4DQ2 A;  3TO9 A;  3L2V A;  3VEP A;  2KIU A;  5CVR A;  2PMH A;  2VC1 A;  3QYB A;  4XBF A;  1WJF A;  2YS9 A;  2PMU A;  5J6X A;  1MBG A;  2NOJ B;  3CCV I;  5GPA A;  2AO9 A;  2K9S A;  1HQC A;  2WB1 N;  1Y39 A;  1UHM A;  1X3W B;  2JPC A;  2V6C A;  4N0B A;  2CQK A;  2LKS A;  4YII A;  2KDZ A;  4KNY A;  2R5Y A;  1T6S A;  1PYV A;  1FJL A;  2IS1 A;  2OA4 A;  3PO3 J;  3GWZ A;  1HSJ A;  2EFN A;  4JOM A;  3ABL H;  2CGP A;  2K3P A;  3KZY A;  3A02 A;  3C2H A;  1GLN A;  4YG2 F;  3C18 A;  4IHS A;  4BJ5 C;  3I59 A;  4UUS B;  4MNU A;  4XNF A;  3DF8 A;  2XRN A;  3OYH A;  4HAM A;  2VJ4 A;  3S15 J;  5EG0 B;  2F4O B;  4LMY A;  2XKO A;  4BEH A;  1J75 A;  2W82 A;  2E36 A;  2DN0 A;  4EGY A;  3OOP A;  4IOC F;  2JA7 J;  1G2H A;  1OCR H;  1X1B A;  3IRQ A;  1UHW A;  4G7O F;  2MH2 A;  3ZQF A;  2CW7 A;  4G94 A;  4U88 A;  3CUQ C;  5EEG A;  3BR2 A;  3KP4 A;  1WGX A;  4YEJ A;  4CUG A;  5E17 F;  3KET A;  3HOX J;  1QZE A;  2LY9 A;  3ROU A;  4IRI A;  4IHT A;  4RDU A;  2MBF A;  2E5N A;  1ORK A;  1Z7U A;  4XON A;  4KUM A;  2XC7 A;  2BXZ A;  3BG3 A;  2P5L C;  3AL0 B;  4UXN A;  2FX0 A;  5DDG A;  2PN6 A;  3GEZ A;  4HG2 A;  3BLY A;  2VPL A;  2BHY A;  2XAJ A;  1KZH A;  4BUP A;  5GTI C;  3HPH A;  4I76 A;  2NVY J;  1WRJ A;  1T56 A;  3CCR I;  5J8F A;  2DT7 B;  3CUQ A;  2LF8 A;  3KP2 A;  2X4H A;  1XN7 A;  2M1B A;  5HS8 A;  5FKN A;  4BQA A;  2OQG A;  5DCF A;  1IN6 A;  2KRF A;  1ZR4 A;  1IF1 A;  2B7E A;  2HTS A;  4NUB A;  3GTJ J;  2YUS A;  4PGH A;  3IAM 2;  3LA7 A;  2VLA A;  2LY1 A;  3TOB A;  4PJ0 C;  4EJW A;  3S14 J;  1B72 A;  2GIV A;  2RDP A;  2XRO A;  2DMQ A;  3FXK A;  1LDK B;  3L2Q A;  4OAZ A;  1BW5 A;  3M3Y J;  1AHD P;  1MGT A;  2DI3 A;  3K2Z A;  2IGO A;  2OU2 A;  4ENM A;  2K86 A;  3S2D J;  1W7P D;  4G6D A;  1TQP A;  2STW A;  1S7O A;  5DTD A;  4II3 A;  4ABZ A;  3FXR A;  3S1R J;  1ZRD A;  3DEE A;  3L2R A;  3DKX A;  3RZD J;  3DPU A;  1EH7 A;  2DPU A;  4E6K G;  1TNS A;  3TED A;  2IA1 A;  4LJZ F;  4LIT A;  3GVA A;  4QPO A;  3RQ4 A;  1P92 A;  4S05 A;  3MMY B;  4XOP A;  1J59 A;  1FSH A;  3FXO A;  4P1W A;  2VJI A;  4UNO A;  3ZQQ A;  4L9V A;  5FLM J;  3WU0 A;  9ANT A;  4IVN A;  1MJ9 A;  1FWZ A;  2FQ3 A;  3W2W A;  1VQP I;  5E18 F;  4ZDP A;  3SDG A;  1F4K A;  3QOD A;  2BBY A;  2VAS A;  3JAM K;  4Q4Z F;  3Q3S A;  3A01 B;  1SFO J;  1XB4 A;  3BR1 A;  4PJN A;  3DXJ F;  4EM1 A;  1Z67 A;  1X4P A;  2F4I A;  1QZZ A;  2JSC A;  2N8G A;  1RUN A;  4OIP F;  1SVL A;  4AYB N;  5C44 J;  1HC8 A;  4UUT A;  3RIR A;  2ZXJ A;  4IX7 A;  4UVC A;  3DEW A;  2PEX A;  2QUF A;  2LK2 A;  4K2E A;  2EA4 A;  2R7S A;  3ZQ7 A;  2LSO A;  2PI0 A;  3I59 B;  1EA3 A;  1ZR2 A;  1I39 A;  2XF5 A;  3COA C;  3NAR A;  1ZKG A;  1FOY A;  4A0Y A;  1TC3 C;  4BEH B;  4HW0 A;  3OYB A;  3ABT A;  2Y9Y A;  4E7K A;  2PMZ A;  1V4R A;  1FTT A;  1QVT A;  5L3C A;  2UWM A;  3P9C A;  5H6R A;  1W0U A;  3W6J B;  1R22 A;  2LYC A;  4KIB A;  1K4T A;  5HDN A;  4HX8 A;  3S17 J;  2HR3 A;  4GFB A;  2WAD A;  1MJA A;  2DOF A;  1XD7 A;  1B8I A;  1ENH A;  2VJ5 A;  4KN7 X;  2MC3 A;  4CIC A;  4E7L A;  1HDP A;  1TQI A;  4L9N A;  4UY8 I;  2P6T A;  4AD9 A;  1MZB A;  1XGN A;  2M2E A;  4XKV A;  1WI3 A;  2VXD A;  2MFZ A;  1UST A;  4PJM A;  3F72 A;  3ONQ A;  1P7J A;  5M3F J;  3B02 A;  1P4A A;  1WJD A;  4MTD A;  2DFE A;  2WAQ N;  1HKS A;  4U87 A;  2MLG A;  4LG3 A;  4DBR A;  5B5E C;  3H9Q A;  4PGG A;  1QU3 A;  3K10 A;  3R6S A;  1X1P A;  4D5F A;  2R93 J;  3W6K B;  5L3F A;  2CJJ A;  1U8R A;  4E7I A;  5AIQ A;  3CDI A;  3GX4 X;  2GM4 A;  2ID6 A;  3IH2 A;  5ICC A;  2XF6 A;  2HVS A;  5E3L A;  3BG6 A;  3S3M A;  5EEH A;  2EPF A;  2K5C A;  1X19 A;  1ZTR A;  3QOE A;  4RBO A;  2Z16 A;  5LFA A;  1UJ8 A;  5IP7 J;  3RQI A;  2RRE A;  4XKB A;  1IRF A;  5H2F C;  5LD2 C;  1U0J A;  2AHQ A;  2IAI A;  3WHC A;  2EA2 A;  1SC7 A;  2G7H A;  4A93 J;  3PFI A;  3JSP A;  3KP7 A;  2HGC A;  2LF7 A;  2VOO A;  1H9T A;  2HTJ A;  2OBP A;  2GBY A;  4ESJ A;  1C0W A;  3VDX A;  1DGW Y;  2QLZ A;  3LA3 A;  3VYU B;  3OOU A;  5D8L B;  4L0Y B;  4M3B A;  1FPQ A;  2NAZ A;  3E6M A;  1SAN A;  3QU6 A;  4A5M A;  4I0A A;  1ON1 A;  2RN7 A;  2JN6 A;  3GLL A;  5TRD A;  1POG A;  1TBX A;  2OTJ I;  2DDA A;  3RYR A;  4BE1 A;  1ZQ3 P;  3U21 A;  4C2U A;  1IDZ A;  2E7W A;  2F5E A;  3VYT B;  1R4N B;  1I1G A;  2GA1 A;  2O3F A;  2CW8 A;  2VL8 A;  3BG5 A;  3DTI A;  1GUU A;  1YE9 A;  3JRG A;  3HC7 A;  3H5A A;  1CGP A;  5IT9 K;  3CCM I;  2CYY A;  4V19 K;  2HPI A;  4HF0 A;  2LVS A;  1FT9 A;  1V5G A;  5D5U B;  4A69 C;  4R79 A;  1HDD C;  4A0X A;  3D0S A;  1ACI A;  3I56 I;  2BV6 A;  3BTJ A;  2H09 A;  3PIO F;  2VE8 A;  3F6V A;  2R5Z A;  3F0C A;  2E1M C;  3E5X A;  2DO7 A;  3SXY A;  3ZQG A;  1K4S A;  2IS6 A;  4ASN A;  5LHI A;  4XRS A;  3WU2 C;  3S8P A;  2ELH A;  3KYC B;  3CC2 I;  2FF4 A;  1T08 B;  2BVM A;  2BVL A;  2BXY A;  4CHU A;  1OR7 C;  2KIS A;  5J4V A;  5E8I A;  1QBJ A;  2OUM A;  4DYQ A;  4CYD A;  4JYK A;  1ETY A;  3LMM A;  3DBR B;  2QBY B;  5ERI A;  2XGC A;  3ZMU A;  1QPM A;  2LD5 A;  3KCC A;  2RQP A;  4KA4 A;  1RR7 A;  1U6G A;  2YU3 A;  5HLH A;  4ZYD A;  4OIN F;  4J01 A;  2OQR A;  2DYS H;  4BH9 A;  1DUX C;  1V55 H;  3KP6 A;  3ZN0 A;  4D1Q A;  1JTX A;  5KK1 A;  1PP8 F;  2K9Q A;  1Q1V A;  2HQN A;  2EK5 A;  3IP4 B;  2CQQ A;  2O7O A;  1OPC A;  2JZY A;  3CJN A;  3MD2 A;  2CO5 A;  1S7E A;  4F3Q A;  4O6J A;  3WE2 A;  4A3J J;  5DEQ A;  2KRH A;  2ZO4 A;  3E6D A;  3ZQC A;  2KLO A;  2W84 A;  4M9X A;  3JRH A;  2P5V A;  3KYD B;  3GZ6 A;  2L02 A;  3FK6 A;  2DA4 A;  3HTU A;  4OOI A;  2EH3 A;  2JTV A;  5DS9 A;  1ZEL A;  1WI9 A;  2ZME A;  3K4K A;  3D1N I;  5FKK A;  2WAF A;  1VQK I;  3VSK A;  1MBH A;  3P9I A;  3ABM H;  2HVQ A;  2DA6 A;  3FWE A;  1X2M A;  1E3O C;  1VQL I;  3BJA A;  2UUZ A;  2JUC A;  1YX5 A;  4GDF A;  2XV4 S;  3I4P A;  3M1E A;  1MIJ A;  4QIW N;  4ZYH A;  3OS0 A;  1W5T A;  4H4K C;  1KU7 A;  4NBQ A;  1XTA A;  2VJJ A;  2EIM H;  3KEO A;  4GRI A;  3OYI A;  1JGG A;  2PX9 A;  5DD8 A;  2XKP A;  2CU7 A;  5F1R A;  1VQO I;  5J8C A;  2DFH A;  1U5T C;  3RKY A;  3LQQ A;  3UKG A;  4HST A;  1O3S A;  1BC8 C;  3S1M J;  1IRZ A;  2DA5 A;  4Y52 J;  3N05 A;  3E3V A;  1S3J A;  3F8N A;  3U1K A;  4XOR A;  3GZN B;  3TP0 A;  2VBW A;  2V1N A;  5BPI A;  2DOA A;  4A3G J;  1WCM J;  3KX2 A;  5E79 C;  3QU3 A;  2COB A;  5CPR B;  3I71 A;  3MKY B;  2KMU A;  3QP6 A;  4EVI A;  3BCA A;  3PNV A;  3QQA A;  3K1P A;  1CF7 B;  4B47 A;  5J4Y A;  5K5R A;  4G9Y A;  3MQ0 A;  4OIO F;  4I98 B;  4CXF A;  1U5T A;  5IP9 J;  3GFJ A;  1MBJ A;  4XN0 A;  3MFK A;  1APL C;  3FKJ A;  4YRV A;  1VQM I;  4PFO A;  2H27 A;  2O0Y A;  1RZ4 A;  4ESB A;  3JRB A;  4NQW B;  2IXS A;  3WHB A;  2FSW A;  5C4J J;  5EZH A;  4IO9 F;  5GAD J;  2BEO A;  1IN4 A;  1I6H J;  4X6A J;  1BA5 A;  4HOB A;  2KIQ A;  3OIQ A;  4E70 A;  4AIJ A;  2FEZ A;  3A1Y A;  4UB8 C;  2VBY A;  4HX4 A;  1PVE A;  2PJR A;  2DAO A;  4BU2 A;  3BR6 A;  2L4A A;  2XAG A;  3PNY A;  3W2A A;  1FP1 D;  5DUK A;  3SFZ A;  5M5W J;  3FXM A;  1K7A A;  1LQ1 A;  3RPU D;  4XRM A;  1G3W A;  5IYC J;  2IA0 A;  2HYF A;  3JCU C;  1D0Y A;  4HRI A;  4XLA A;  2PQ8 A;  2E2I J;  3HHG A;  4Y33 A;  1UZC A;  2LP0 A;  3O2P E;  4E7S A;  4J00 A;  4OMY A;  2NNY A;  2VI6 A;  3CC4 I;  4KMU X;  2LR8 A;  1VQN I;  1X3Z B;  3GTL J;  3PQJ A;  4HSR A;  4YEL A;  5LRS A;  3K4C A;  2KQR A;  2LDU A;  4ETS A;  1R00 A;  3OYA A;  4RA2 A;  3M8F A;  3Q0W A;  5FKL A;  2VXZ A;  2GAU A;  4EEF G;  2DQR A;  2K9L A;  1T95 A;  4CCO A;  1XCV A;  4ENJ A;  4QLC U;  3QAH A;  2KL4 A;  3DCF A;  3H5N A;  2JT1 A;  3RZO J;  5IYD J;  2IW5 A;  2FBK A;  2CH0 A;  1HST A;  1TQM A;  1YOV B;  2PBI A;  1VQ4 I;  3MZY A;  1HXD A;  5D8K B;  3TO6 A;  3E5Q A;  3RKQ A;  2E19 A;  3GZ5 A;  2ZME B;  3HOV J;  3FXL A;  2VON A;  3I58 A;  4FX4 A;  2GXG A;  2M8G X;  3K1M A;  3OIP A;  1S72 I;  2HDW A;  1PJR A;  2UV1 A;  3AG3 H;  2L7M P;  4XRS G;  4B3X A;  2KHM A;  1R58 A;  1RES A;  3L7W A;  1LJ9 A;  3S2H J;  3TL4 X;  2MD5 A;  3O3K A;  1A36 A;  5D5V B;  2HOT A;  2XUB A;  3FBN B;  3AL0 C;  4N9H A;  2XB0 X;  3JRE A;  1SFU A;  2OV7 A;  4KIF A;  3RDI A;  4C2T A;  4RB3 C;  2YX7 A;  2EFQ A;  1FY7 A;  1TT5 B;  4D9J A;  4FCY A;  3U9G A;  2E1C A;  5LEK A;  3IKV A;  4Z6Y A;  1YRN A;  1A04 A;  4WCG A;  2E5Z A;  4M71 A;  1IXS B;  5K5Q A;  3G3Z A;  1W36 C;  3OSF A;  1B59 A;  3MZH A;  3T5X A;  1K79 A;  1UAA A;  3OYJ A;  4RS8 A;  2QM3 A;  1IGN A;  1ZN2 A;  2QQB A;  2OPT A;  2YPR A;  3PIP F;  1Z9C A;  3M1C A;  1R36 A;  4L18 B;  3HM5 A;  1ZGJ A;  2W24 A;  3ASN H;  2RVC A;  1QZY A;  2KIM A;  3LSH A;  3P5J A;  2R0Q C;  2DLL A;  3S16 J;  4FHT A;  3T1B A;  4OMZ A;  4MQ9 F;  4QTR A;  1SD5 A;  4RM3 A;  4RLF A;  2FUG 2;  1XCB A;  4OAY A;  1GVJ A;  1D1B A;  2HQ5 A;  2NVX J;  1W7P B;  3GFI A;  4RAZ A;  1MH3 A;  2WV0 A;  2W57 A;  3NEU A;  1VFC A;  4LG0 B;  1CQT A;  1BC7 C;  2V9K A;  3CF2 A;  2PJR B;  5DV5 A;  1VZ0 A;  4JP0 A;  3EQL F;  1LKX A;  2IT0 A;  4R8H A;  2Y48 A;  1DP3 A;  1BBY A;  1XSD A;  1T2K A;  3J81 Z;  1T33 A;  2ZJQ F;  3M9A A;  4CCK A;  1XX5 A;  2A07 F;  4OU0 A;  2YSR A;  3GTK J;  4Q47 A;  5TJJ A;  5HLT A;  3GME A;  1KQ8 A;  2EJR A;  2VBX A;  3BG9 A;  5CKT A;  5F27 A;  4B1R A;  2OZU A;  2A5W A;  3ZMV A;  2OC6 A;  3F21 A;  2K9N A;  5E1Z B;  4HLX A;  3GYH X;  1OCP A;  3WTS C;  2YX4 A;  5HS7 A;  4MFD A;  1LVK A;  2OAZ A;  1FYM A;  1R49 A;  1G3S A;  5E1X A;  2XIG A;  3HYI A;  1WJA A;  1YIT I;  3TP3 A;  2QVO A;  2HZD A;  4XK4 A;  2ICW G;  3WTU C;  4Y7N J;  4PSW A;  2R7Z J;  4DBQ A;  3B73 A;  3HSR A;  2VC0 A;  1ZG1 A;  4P5O A;  2LNB A;  2QWW A;  4G12 A;  1RPW A;  4A3I J;  3I54 A;  1W0T A;  3A01 A;  4B3A A;  1YHQ I;  5LEJ A;  1R71 A;  4FTH A;  5KVR A;  3I5U A;  1J09 A;  2A6E F;  1I6X A;  2DBB A;  4XIC A;  3TMO A;  2FOK A;  4DW6 A;  2QQ8 A;  2BW3 A;  4F91 B;  3VSL A;  2L4M A;  1KQ0 A;  4MIM A;  4L5J A;  3ZXS A;  2MSY A;  1MMS A;  1MMG A;  1I50 J;  3G2B A;  3OYN A;  4BGD A;  1WFX A;  3OL4 A;  1K6O A;  2XGX A;  1WJE A;  2CG4 A;  3CMM A;  5H20 A;  1U78 A;  1QRY A;  4P96 A;  1MDM B;  1GV5 A;  1QO0 D;  4KN4 X;  4HV5 A;  4QSH A;  4ZDL A;  4DYC A;  3VFZ A;  2E7X A;  3V8J A;  2PG4 A;  3RI4 A;  5KHD A;  1YRN B;  2A3S A;  4RB2 C;  3P9K A;  4EJU A;  3DBL B;  1I3A A;  2QKM B;  4GGG A;  3JRD A;  4FT8 A;  2JSP A;  4RAG A;  4I2O A;  5ICE A;  1W5S A;  3R4K A;  3PQK A;  4WK8 F;  3GO5 A;  3IWF A;  2Q0O A;  2BOL A;  2GXB A;  1X1C A;  5TIS C;  4ZC3 A;  3D5L A;  3H0G J;  2XPW A;  3IV5 A;  1DDN A;  2Y0S A;  2EV0 A;  1UG0 A;  4RGU A;  4G6T B;  1MNM C;  2Y69 H;  5ILU A;  1JUM A;  3HOT A;  1Z1D A;  4D7N A;  4M73 A;  4F55 A;  4EJO A;  3HBL A;  3GTM J;  2E35 A;  1LVA A;  2JVG A;  1XDU A;  2WA0 A;  3BT9 A;  1UB9 A;  3CTA A;  1T0F A;  4IQ4 A;  3SEZ A;  2EWN A;  3HPG A;  5EGO B;  1FYK A;  3KLO A;  2V1U A;  3E5U A;  3CDL A;  1JUP A;  4XID A;  1JHH A;  1SFX A;  4YFK F;  1ZRF A;  2FBH A;  5K7H A;  1XGM A;  5F0C A;  2H6B A;  3CZ6 A;  5FD5 A;  4UUV A;  1JUS A;  2L0K A;  2WBM A;  3BZK A;  4M9Z A;  3ZOB A;  5JFR A;  3H3Z A;  3BJ6 A;  1VTN C;  2NS8 A;  5HDK A;  1IUF A;  3HKZ N;  2DA2 A;  4ITV A;  1UFM A;  3L1P A;  4OIQ F;  1BR1 A;  3BY6 A;  2HQA A;  3VPR A;  4JK1 X;  1J0R A;  3MN2 A;  5EZG A;  3CLQ A;  5E8G A;  3S1Q J;  1FOX A;  1BJA A;  1E3H A;  3H5R A;  4A3E J;  1S7A A;  2CW0 F;  1P7I A;  2DK8 A;  4KIT B;  1ZAR A;  3SDB A;  1K6Y A;  2Q2E B;  5J1Y A;  3WTT C;  3CMY A;  1XGO A;  2Q1Z B;  3PJR A;  3QRF F;  2MYS A;  4XLH A;  4BE0 A;  1ITY A;  4I01 A;  2R4G A;  4BQQ A;  4I09 A;  1XMA A;  2AQE A;  3BC8 A;  2ETH A;  4NDL A;  3HOY J;  3V7R A;  3J7Z I;  2KFD A;  4AIH A;  3G1M A;  4Y4R A;  4B43 A;  1A6Q A;  3CCU I;  4XLF A;  3O6B B;  1SMY F;  5CVJ A;  1D8K A;  2BE5 F;  2ECB A;  1U2W A;  2WB1 A;  2WY7 Q;  4CSW A;  5C3E J;  3TOA A;  3OY9 A;  1EV7 A;  1IN7 A;  4PJJ A;  1KYZ A;  1N78 A;  2NVQ J;  1ZYR F;  2K4J A;  2BY2 A;  2BW3 B;  4GXO A;  1MBE A;  2HXI A;  5HLI A;  1FBS A;  1W4M A;  1LEB A;  4BHC A;  4M6X A;  4AID A;  3I0T A;  1ZH5 A;  2HOA A;  2K9M A;  1FP2 A;  5ICG A;  3C7J A;  1A35 A;  2KRC A;  2QGU A;  4A0Z A;  2Y9Z A;  4KDP A;  3BCB A;  3K4B A;  2XPV A;  1U8B A;  3L9F A;  3LSP A;  3BG7 A;  3F6O A;  1VQ9 I;  2J5P A;  3FXJ A;  4UV8 A;  2QSH X;  2F2E A;  3BRO A;  3Q0V A;  4A3D J;  5F64 A;  1RC9 A;  3J80 Z;  5M3M J;  1I3Q J;  1WPK A;  4FE4 A;  5IT3 A;  2V79 A;  5EF6 A;  4CZC A;  5TGT A;  3OYM A;  3KZI C;  2NVU B;  3JR9 A;  2FNP A;  1X2N A;  3MWM A;  3DTK A;  3K70 C;  2MH9 A;  2O9L A;  2QBY A;  1FBU A;  3Q9S A;  2QQ9 A;  3UNG C;  3I4N J;  2TRT A;  2DFF A;  3G4S I;  4LLN A;  3QYF A;  1WQ2 A;  2B0L A;  2L3D A;  1YLF A;  3FHN A;  3ML6 A;  1BI0 A;  3K6G A;  5L3E A;  1ETX A;  2GOX B;  3J7Y J;  3VYS B;  1O3Q A;  4ON0 A;  1WJC A;  2DA3 A;  3CUO A;  5EYR A;  4JQF A;  2O03 A;  4MO7 A;  4LLL A;  1D3Y A;  5EJC A;  4ZYA A;  5D5X B;  1D5V A;  4A3B J;  3D5S C;  5KCM A;  1JKQ C;  3GUD A;  3NWT A;  2BHZ A;  1YJ9 I;  2XPU A;  2A69 F;  4A3M J;  1Z0X A;  2CQX A;  2FRH A;  2EV6 A;  3GTP J;  4M74 A;  3S3O A;  4C2M J;  2NOG A;  2OD5 A;  3K0L A;  2IA2 A;  2MD0 A;  2XAQ A;  4BDZ A;  1Y1W J;  3CO7 C;  4IHX A;  3CD6 I;  1U3E M;  2D1V A;  2P4W A;  2LFB A;  1FC3 A;  2X1E A;  1XMK A;  2ZXW H;  1X1D A;  5F0H A;  2IEK A;  2IGN A;  5LBQ A;  5LGU A;  1WJ5 A;  3TW6 A;  3H9G A;  2X6Y A;  2VQG A;  3DV8 A;  4BAC A;  3F22 A;  3DP7 A;  1AA7 A;  2ZNZ A;  3V8L A;  2D45 A;  3O8H A;  1YI2 I;  3A2K A;  1JI8 A;  3AKZ A;  1LDD A;  1TNT A;  3IAS 2;  3WOD F;  3KEQ A;  5LGN A;  2I5U A;  5DUI A;  3CCQ I;  1N77 A;  1JE8 A;  2M4K A;  1VQ5 I;  2X51 A;  1LFU P;  4ENK A;  1TW2 A;  2JUG A;  3CP2 A;  3HEF A;  3LFU A;  3RKX A;  3K4L A;  4HEA 2;  2CV1 A;  3Q0U A;  2BY0 A;  2VUM J;  2BY1 A;  1CF7 A;  3FM3 A;  4V2F A;  1W36 D;  2DMN A;  1MND A;  3TGN A;  5HDG A;  2VE9 A;  4LGW A;  4KMF A;  4IHY A;  4WXH A;  3PSF A;  1YW8 A;  1HW1 A;  3DU5 A;  4QPQ A;  3BDD A;  3ZPL A;  2EIN H;  1WZ2 A;  4JX6 A;  3SZP A;  1DPR A;  4MEY F;  4NQW A;  5K5O A;  2XRL A;  1LEA A;  5D6E A;  1BJZ A;  1KU2 A;  4PSX A;  3OYG A;  4AYB A;  4U7B A;  5A2Q Z;  3LSK A;  1IZ1 A;  1WHU A;  2NXN B;  1FLI A;  2CS3 A;  1BIA A;  5F6F A;  3QPL A;  1JT0 A;  4IRG A;  1MD0 A;  4MFE A;  1YJN I;  1DGR M;  3CO6 C;  4B44 A;  2G0E A;  2ZJR F;  1OYW A;  1SFE A;  4A12 A;  5GAG J;  2FNA A;  4HZF A;  4BXF A;  1TWA J;  4RAF A;  2O8K A;  2ELJ A;  3KFW X;  3T8R A;  3EPZ A;  2DOE A;  2L5Q A;  2Z5U A;  3GXO A;  4I99 C;  1MH4 A;  2HPM A;  3J7A Y;  1W1W E;  2STT A;  1E0E A;  2X9D A;  2F5F A;  1IN5 A;  2AQF A;  2A5Y B;  2ZME C;  3OIO A;  4XMY A;  3FBI B;  3WU1 B;  3BQY A;  2DYR H;  4G7Z F;  1J5Y A;  4ENN A;  3K4N A;  3LST A;  3WGH A;  1YQA A;  2PLY A;  4A6D A;  1RET A;  2DU9 A;  2CSO A;  3FMR A;  4HNT A;  4KFC A;  2PJP A;  3CC7 I;  1HKT A;  1JT6 A;  2KDO A;  4CGZ A;  1SD4 A;  1KU3 A;  1D1C A;  4LFU A;  2QSG X;  1Z77 A;  2CFO A;  5FKO A;  1A5J A;  4RGR A;  1LPQ A;  1XS9 A;  4XKC A;  3R60 A;  4M6Y A;  4N9I A;  1ZGA A;  3W3C A;  4AIK A;  4CCM A;  1REP C;  5CVU A;  1RUO A;  4A3L J;  4MQV A;  2GQQ A;  2HZT A;  2R7U A;  2R7T A;  1TZL A;  1HA8 A;  1GV2 A;  3E1S A;  1MJB A;  2IGM A;  2WAQ A;  1EKE A;  4ZDO A;  4EV0 A;  3I4M J;  3QOP A;  2LMD A;  2OJE D;  2V26 A;  1JTY A;  2W48 A;  5H6Q A;  3PUF A;  1IW7 F;  3CCY A;  4PUS A;  4CZZ A;  4L0Z B;  1ODD A;  5BOX A;  3MEX A;  3N97 A;  3IKT A;  3DPT A;  2L9N A;  2X1C A;  3SYT A;  5AON A;  2CFX A;  2LOO A;  2R7R A;  1KA8 A;  3JTH A;  4U7D A;  3B6C A;  1E2X A;  2L9S A;  3ABK H;  3ELK A;  1SD7 A;  3PFY A;  1JXS A;  4L5E A;  1VQ6 I;  2LY2 A;  2IP2 A;  5JHU A;  1I1S A;  1P2F A;  3CES A;  2CV2 A;  2F48 A;  3FX3 A;  3FKI J;  3OYC A;  5HS9 A;  2VT3 A;  1PUF B;  4ZTJ A;  3SEQ A;  2JPB A;  2ZJP F;  2OCE A;  2E1O A;  3ULQ B;  2VOD A;  4E7H A;  3J80 K;  1YIO A;  3LWF A;  5FRN A;  3ZQI A;  4D7M A;  1MBK A;  5L3G A;  5LGT A;  3GW2 A;  2ZBK A;  3G73 A;  4CYC A;  5EEA A;  1K83 J;  5CYV A;  4MHG A;  3SQN A;  1J9I A;  2VKE A;  2LBF A;  4GO1 A;  4HA8 A;  2EZK A;  2J5O A;  2V9P A;  3BPV A;  1HCR A;  4IHV A;  4PZJ A;  5E1W A;  1R4M B;  1Y6I A;  2QYO A;  3SZG A;  5IY5 H;  2VKD A;  2P81 A;  2V9V A;  2Z1D A;  2ECC A;  1V5E A;  5LLQ A;  3WTY C;  3CQZ J;  3TDZ C;  1R5H A;  1OKR A;  3OSG A;  4AU7 A;  1OCC H;  4BJ6 C;  2KT0 A;  2GIZ A;  4EGZ A;  2GWR A;  2ZNY A;  3U1D A;  2EZH A;  4N4N B;  2L2O A;  4BNC A;  5ILV A;  3CF5 F;  5JI6 A;  1ZLJ A;  1EH6 A;  1MSE C;  1W7P A;  3HRU A;  3KE2 A;  3HB9 A;  5GP9 A;  3DFG A;  4D0P A;  2K3F A;  2WAE A;  2HI3 A;  4LG0 A;  1QHG A;  5CVI A;  2XAS A;  3F3X A;  2HOS A;  2MGQ A;  2CWE A;  5JVT A;  1QA6 A;  4WXC A;  4IRH A;  4B09 A;  2CUE A;  1KYW A;  1OQY A;  1YW9 A;  3DQV C;  3M8J A;  1P4W A;  2IBD A;  3HUG B;  3RTR A;  5F04 A;  4OIR F;  3V7S A;  4C3H J;  2WWY A;  1ZRE A;  5DCM A;  4RB0 A;  2KP6 A;  1O7F A;  3CJT B;  3X2Q H;  4BJT A;  1G59 A;  2RGV A;  1V3F A;  3O8G A;  3IHU A;  2L01 A;  4HYE A;  4XN3 A;  2HDC A;  2EBI A;  3ECO A;  3K4M A;  2O6G E;  4XRF A;  5BMZ A;  4RB1 A;  1ETW A;  3H9J A;  4RLQ A;  5FLX Z;  2DOD A;  2TDX A;  3EUH A;  1JGS A;  1IO2 A;  2VB6 A;  1TWG J;  4PFP A;  3T8T A;  1F5T A;  3MKZ A;  1D0Z A;  3HL2 A;  3LSJ A;  2M9H A;  2VQL A;  3VYR B;  5B3S H;  2D5V A;  3G71 I;  1X3U A;  1F1Z A;  3DLA A;  3FMS A;  3ZMT A;  5GAH J;  2ID3 A;  1UEL B;  2DA1 A;  4V2G A;  2P0W A;  3ERM A;  4KIG A;  2M7B A;  1L0O C;  4BL0 B;  2UZK A;  2Y0M A;  3E6B A;  1ZGW A;  1RIO H;  3BR5 A;  2M4G A;  5D4S A;  4M9S A;  3BP8 A;  2E1M B;  1DU0 A;  2JA5 J;  3FM5 A;  1ON2 A;  4XLE A;  3P7N A;  3FF5 A;  1L3L A;  1BI3 A;  4IPA A;  5A2Q K;  4Y17 A;  1FMV A;  3F8F A;  4RMN A;  4DOZ A;  4EMS A;  3ASO H;  3K4J A;  5BNG A;  1MBF A;  3CME I;  3HTS B;  1Z7L A;  2KKO A;  3GFM A;  1HW5 A;  5FGM A;  1BI2 A;  3KP5 A;  2M0M A;  4IJA A;  4G7H F;  2O61 A;  2E60 A;  1MDM A;  1ZAO A;  2W25 A;  2XB5 A;  3LSR A;  1QQI A;  2DTR A;  3FIS A;  5E3O A;  3LAJ A;  4O3M A;  3HOS A;  1ZRC A;  2IPQ X;  4IF4 A;  4HX7 A;  4IOA F;  1SFK A;  4E4H A;  4CYC B;  5L3D A;  4A3F J;  2NVT J;  4AM3 A;  4JBA A;  4XR6 A;  2RNG A;  3RSN A;  3KZZ A;  3TDU C;  4A5N A;  3MAJ A;  4R1H A;  2LLK A;  4IXA A;  2LBF B;  3K70 D;  3UR3 C;  4F52 A;  4BXX J;  1LNW A;  2EQR A;  3S93 A;  1QNT A;  1OFC X;  1R9T J;  2JQ7 A;  4IZZ A;  1IXR C;  4HBL A;  2DJI A;  5J47 A;  4UV9 A;  2VKH A;  2X85 A;  3MKW B;  2JA6 J;  3FMQ A;  3MCZ A;  3LNQ A;  5IOY A;  3RCO A;  3CDH A;  3ZCO A;  3QP5 A;  2B9S A;  3WTW C;  2JWT A;  1XG1 A;  2DMP A;  3DPL C;  4U0W A;  2W00 A;  4RGX A;  4CCN A;  4C3I J;  3FZV A;  3LSM A;  1B1B A;  3OV8 A;  1TTY A;  2XDV A;  4P9F A;  2MG4 A;  5EGO A;  3BQZ A;  4GYI A;  4WX9 A;  4CCL A;  3RJP A;  4AVP A;  3QWL A;  3KIO A;  1YW7 A;  3B6A A;  1BI1 A;  3TBI A;  1OCT C;  2ZFU A;  3Q9V A;  3J7A O;  1SAX A;  3RYP A;  5DCM B;  4A2U A;  4LLG F;  1R1V A;  2HYG D;  4NC8 A;  2QZ8 A;  4O5V A;  3FXU A;  5CJ9 A;  2VT2 A;  1MSF C;  4Q48 A;  2QKL B;  2OZ6 A;  1YX3 A;  5ED4 A;  2ZXH A;  3SHF A;  3DWL E;  1KGS A;  3JTG A;  1M1E B;  4NNJ A;  1G3T A;  3OMY A;  4BKX A;  1ETO A;  1U9N A;  2EB7 A;  4DZJ A;  3GTO J;  1SVM A;  1TW3 A;  5FD6 A;  3Q5F A;  2CQ7 A;  3ABU A;  2Q2E A;  2ZSI B;  3S32 A;  1B6A A;  2KZV A;  2C6Y A;  2ISY A;  2W85 A;  1Z3Y A;  1VQ8 I;  2DK5 A;  1P6R A;  2JRT A;  4UVA A;  6PAX A;  1TWF J;  3LQR A;  1TL8 A;  2AS5 F;  2H94 A;  1QPI A;  2HNH A;  2R92 J;  2UXX A;  1WJB A;  5JVG F;  3W6V A;  1MMN A;  1BN5 A;  1QGP A;  3V8K A;  2FD5 A;  2ADU A;  3MVP A;  1JKR C;  4A3C J;  1BOA A;  2Q8K A;  4MLO A;  4HQM A;  4L5I A;  1YO5 C;  3S1N J;  4IQJ A;  1FX7 A;  3GLX A;  5LRR A;  4HLY A;  2FU4 A;  2FBI A;  3IH3 A;  2DFI A;  1FSE A;  1JHF A;  1Z6R A;  1S9H A;  2M3A A;  3PSI A;  4RAY A;  1FBQ A;  4II2 A;  3L00 A;  2COM A;  3PM1 A;  1T39 A;  1LFB A;  3A4C A;  5KAI C;  4U0V A;  2WC2 A;  2K27 A;  2Y75 A;  5FB2 A;  4UB6 C;  4ZJZ A;  1Z91 A;  1Z6T A;  2P8T A;  5DD4 A;  4U0Y A;  1IDY A;  5F1J A;  4WWC A;  2Z9O A;  1KQ9 A;  3EET A;  5K1Y A;  2JVH A;  5F0F A;  2CV0 A;  1ETQ A;  4YFX F;  1OIS A;  3DKW A;  2Z3Y A;  1WKM A;  2TCT A;  4Y3O A;  2XGD A;  4L9T A;  2JJ7 A;  3K9T A;  1T0F C;  2H6C A;  4XL9 A;  2ZJ2 A;  3WG7 H;  2PMZ N;  4E7J A;  4XOT A;  5FLX K;  2AXT C;  2CRG A;  3S3N A;  3RKW A;  2RAE A;  3OYL A;  4KIS A;  1R5I D;  4IHW A;  1N75 A;  2M5W A;  2H1K A;  2Y30 A;  3A0H C;  2JK3 A;  2HXO A;  3GFL A;  3D5R C;  2PFB A;  2X6O A;  1Y8Q B;  4DGW B;  4B8X A;  4EM2 A;  2M30 A;  2GZW A;  1WH7 A;  5BS6 A;  2R7V A;  5KAF C;  2XAU A;  2M8E A;  3HGG A;  2GLO A;  3ZGK A;  2W7N A;  1HBX G;  4YIF A;  2NS7 A;  2XAF A;  1H0M A;  3A03 A;  3L09 A;  2F5V A;  2R7O A;  3IWZ A;  1Y56 A;  4ZYE A;  3KP3 A;  1O3R A;  3M4O J;  3H35 A;  5BPD A;  1LE8 A;  2V1D A;  1Q1H A;  1TWH J;  5IPA A;  3LAP A;  4HQE A;  4JX4 A;  4BXU A;  5IT9 Z;  3EYI A;  4E7Z A;  1BR2 A;  1WVR A;  1BIB A;  4AC0 A;  4KYW A;  3HRM A;  4AUX A;  5FJ8 J;  1F9N A;  2V4J C;  1FYL A;  3I9V 2;  2XGE A;  4B48 A;  1NG7 A;  5C4X J;  3PUB A;  1EJ9 A;  4NC6 A;  4BDY A;  3FK7 A;  4ZYG A;  2M7A A;  5DYM A;  2A6H F;  2H8W A;  3HOZ J;  1R23 A;  2K4B A;  3BJO A;  1AOY A;  2K85 A;  2BY3 A;  2L7K A;  3K69 A;  1ZK8 A;  2DPD A;  1O3T A;  3CJR B;  5E3M A;  4LB5 A;  2H1L A;  3AG2 H;  1W5C C;  1I27 A;  1MMA A;  5CLS A;  2VOP A;  2MC4 A;  5FKM A;  3CMA I;  3NQO A;  2L7F P;  1LDJ A;  3BTC A;  1IJW C;  1S8N A;  3C1D A;  3BZC A;  3H3U A;  2KJB A;  5BQT A;  5M5X J;  4BBS J;  1TWC J;  2IJL A;  3LL7 A;  3NWS A;  1D5Y A;  2M34 A;  3QPT A;  3V7C A;  4XSX F;  1AKH B;  1FTZ A;  1G4D A;  1Z21 A;  4KT5 C;  3ZN1 A;  5IOZ A;  5FO5 A;  4BAY A;  4BBR J;  3RPU A;  3OYD A;  1HKQ A;  3BTI A;  3VWB A;  3LA2 A;  3HDD A;  4G6Q A;  3RPQ A;  1E3P A;  2QF7 A;  2DTZ A;  3F8C A;  5K7Z A;  1YFH A;  4UVB A;  1OYI A;  3R0A A;  1D1A A;  4PJL A;  4FQG A;  1GVD A;  1VND A;  2XF7 A;  2O5R A;  4BHP A;  2QQA A;  3HOU J;  1ZLK A;  1FIA A;  4GYG A;  3J81 K;  4AWX B;  1RNL A;  2R5Y B;  3PL8 A;  4KJZ A;  3HG9 A;  1OMI A;  2KZG A;  1GDT A;  1TT0 A;  5IYB J;  1K78 A;  2RC4 A;  1VI0 A;  5GAE J;  1BW6 A;  1XSX A;  4WF2 A;  3GCM A;  1FNN A;  3TKY A;  3HXL A;  1UHS A;  3DTE A;  1KU9 A;  2V7F A;  3IC7 A;  2ME6 A;  4P55 A;  2F5C A;  1Y0N A;  2I10 A;  1OJL A;  1B9M A;  2EIK H;  2R7W A;  3M7G A;  4FE7 A;  2OCC H;  4KIC A;  1RR8 C;  2MLK A;  1HLV A;  2E2H J;  3N4M A;  5FLV A;  4BE2 A;  3BTL A;  3ERE D;  1ULY A;  2EFP A;  4M6V A;  4F93 B;  2K40 A;  2L9V A;  3ZQH A;  4DZP A;  1P9Q C;  2LRD A;  3OYE A;  4ZH4 F;  1MKM A;  2QSF X;  2HOE A;  3AG4 H;  3VOE A;  3FHZ A;  3EYY A;  1WH5 A;  4ZTF A;  1OCO H;  2QA4 I;  5AIP A;  1ETK A;  1OCZ H;  2B63 J;  3PO2 J;  5DM7 F;  2JRM A;  1LE8 B;  3BR0 A;  2ZC2 A;  1Y8R B;  1F36 A;  3QPS A;  4ZZL A;  4YIR X;  3TQN A;  3FIW A;  2FOW A;  1BL0 A;  3CCL I;  3I64 A;  4W97 A;  3C2B A;  4UHT A;  2ZCW A;  2VBZ A;  3CUQ B;  4S0H B;  3WTZ A;  2WY8 Q;  2M87 A;  4X1E A;  1P4X A;  3OYF A;  3E6C C;  5FRM A;  2LKX A;  3HIF A;  3EUK L;  2ZSH B;  3OR1 C;  2X1D A;  2XHK A;  5CQG A;  4ANJ A;  1PUF A;  4HF1 A;  1YS6 A;  1ZHF A;  4M3G A;  2BYV E;  5FFX A;  3HKZ A;  4X0G A;  3OYK A;  1DQU A;  2VPR A;  1NK3 P;  1B72 B;  3DEU A;  4NC7 A;  4M72 A;  1LB2 A;  4Y15 A;  1D0X A;  4BQN A;  2A61 A;  4FET A;  2EFO A;  1ZG5 A;  1RRJ A;  4DJA A;  1XMX A;  2RNJ A;  5J1U A;  1IRX A;  4IKF A;  1DU6 A;  1IAW A;  4PK4 A;  1QHH D;  1R1T A;  1S6L A;  1GXQ A;  2NRA C;  2HQR A;  3KYL A;  2IS2 A;  1R1U A;  1TLH B;  3H3V K;  1NG6 A;  3I55 I;  1WSU A;  1FMW A;  2KJC A;  2JA2 A;  2HFH A;  2QEX I;  2LG4 A;  5FFZ A;  2XSJ C;  2E2J J;  5JR3 A;  2FML A;  1GHC A;  1YS7 A;  4EM0 B;  2OF7 A;  2VN2 A;  1N25 A;  3NRV A;  1O4X A;  5L3B A;  1X4O A;  2WV1 A;  4G8X A;  3C3W A;  1YTY A;  1FOK A;  4MTE A;  1J2X A;  3DBH B;  2DJN A;  2ME0 A;  3WTX C;  4I7H A;  3REO A;  2ZXI A;  2XVC A;  2A05 A;  4LIV A;  2EZL A;  3SFI A;  1R5G A;  2ESN A;  3MZ8 A;  4XKW A;  1PUE E;  4CA0 A;  5E3N A;  2L7Z A;  2RQQ A;  2DT5 A;  4DNC A;  4Z2Y A;  2G9W A;  2M45 A;  3DU6 A;  3HUG A;  2V6E A;  1S29 A;  3C2G A;  3LSG A;  3HSE A;  3IRR A;  1OYY A;  4RM2 A;  3VB2 A;  5HLG A;  3L2U A;  5E20 A;  1K78 B;  3ZMS A;  3M07 A;  2R7X A;  3OS2 A;  4FAS D;  1HW2 A;  2F4M B;  2VKV A;  4LOC A;  3TW7 A;  5CVV A;  1I5Z A;  1OLT A;  4D5C A;  3IL2 A;  3MKL A;  1PP7 U;  1E17 A;  2DT6 A;  2NYX A;  1BOB A;  4C3J J;  1LFP A;  4DYR A;  2HDD A;  3W2V A;  1TP4 A;  2DMU A;  2Z33 A;  3HOW J;  4Q5S F;  1IV8 A;  3OL3 A;  4HDU A;  1IRG A;  2LKP A;  2GXA A;  2Y2Z A;  2FQ4 A;  3FDY A;  5HVQ C;  1YG2 A;  3WGG A;  2XAH A;  2RKH A;  2R7D A;  3I53 A;  3SZT A;  1B8I B;  4ZZD A;  3JSO A;  3JW4 A;  2K02 A;  1SD6 A;  1H88 C;  1A6I A;  2A6T A;  4KT6 A;  5ILS A;  4EJT A;  4EJV A;  3GF2 A;  2EIJ H;  1G8X A;  1R6R A;  3BPX A;  1NK2 P;  2ZKZ A;  3H1C A;  1SEU A;  1VQ7 I;  3R61 A;  3F23 A;  2P7V B;  3WTV C;  2ELK A;  1NTC A;  2LH9 A;  4N4O B;  1HF0 A;  3DLL F;  1XC5 A;  1Z05 A;  2DMT A;  2HKX A;  1YJW I;  4TV7 A;  1OR7 A;  1X58 A;  2ZB9 A;  5GTH C;  3IUO A;  2R3S A;  1MNE A;  4A3K J;  4EAT A;  5D5W B;  4WXD A;  1NHA A;  3HHH A;  3WE3 A;  4I6Z A;  2O8X A;  2YR2 A;  5M5Y J;  1KON A;  2DDB A;  5JLW A;  1FEX A;  1AWC A;  3K7A J;  1EF4 A;  4GCV A;  2MA3 A;  1GXP A;  1U9O A;  1FZP B;  2EIL H;  3K1N A;  5IP6 A;  1Z3X A;  4BQO A;  1Y1V J;  1DPU A;  1D8J A;  2W1O A;  2LRE A;  3HZJ A;  1T8I A;  5LHH A;  3ZQL A;  1Y0U A;  4NHJ A;  1PDN C;  2F5D A;  4HF2 A;  3KPH A;  4I0B A;  2LC2 A;  3G1O A;  3VOD A;  4FIS A;  2BZT A;  2E1N A;  4BY7 J;  2V1X A;  3NAU A;  4M3E A;  4M3D A;  4LK1 F;  2OTL I;  1SMT A;  3G6E I;  1IXC A;  2X0L A;  2GA2 A;  4YFN F;  1T98 A;  1RKW A;  2IGK A;  1S5L C;  1FOW A;  2L9R A;  3U2R A;  2HYJ A;  2EZI A;  3F8B A;  4L9J A;  3S2W A;  4XSZ F;  4W1U A;  2FMY A;  2HKO A;  3EUH C;  2K7L A;  3KLN A;  5CQE A;  3LOC A;  4BYY A;  3ISP A;  5EDN A;  1ETV A;  4CCJ A;  1G3Y A;  3ZMD A;  4HPQ A;  4LK0 F;  3HRT A;  1A31 A;  3AAF A;  1YYV A;  2RV8 A;  5B1A H;  1BR4 A;  1QVU A;  5GPC A;  2XSD C;  2CMP A;  2I8D A;  3CCE I;  3GTG J;  4QWQ A;  3G1L A;  2CUF A;  1X1A A;  3L2W A;  4H0E A;  3CLO A;  3ZMZ A;  1JJ8 C;  2R5Z B;  2P6S A;  5J3L A;  2WTE A;  5DM6 F;  1H9G A;  4JX5 A;  1H8A C;  4LD5 A;  3T0Y A;  1XDS A;  3BWG A;  4BY1 J;  3CP8 A;  1V54 H;  3JRF A;  4FX0 A;  1XGS A;  2QCO A;  2W4S A;  3M8E A;  4HV6 A;  4HDV A;  3CJQ B;  3LFK A;  2D1H A;  3GTQ J;  4F7Z A;  3BR3 A;  3EDP A;  4A6E A;  4C30 A;  4M3F A;  2A68 F;  3ZP5 A;  4XLN F;  2ISZ A;  1YIJ I;  2IVM A;  3FXQ A;  1JKP C;  2MW8 A;  4IL6 C;  2DQL A;  4CO8 A;  5J1R A;  4BS9 A;  4Y13 A;  4XLC A;  3DKY A;  2JA8 J;  1B4A A;  1MW7 A;  3SJM A;  1IN8 A;  3CCJ I;  2FXA A;  3F9K A;  2EV5 A;  1IV6 A;  2CUZ A;  1T38 A;  2FE3 A;  4ESF A;  4DIQ A;  4PDK A;  4CH7 A;  3ZR8 X;  5FRO A;  2VQC A;  1XSV A;  1VF9 A;  1XPX A;  1EH8 A;  2YU9 J;  2FA5 A;  5ICF A;  3WGI A;  3CCS I;  2G7U A;  3V42 A;  2X6X A;  1GT0 C;  1IC8 A;  3I3L A;  4LIU A;  5B66 C;  3HSF A;  1LUJ B;  2JMW A;  1UCR A;  2HEO A;  5J40 A;  2M0C A;  2EFW A;  2KPM A;  3JRI A;  1H89 C;  1G6N A;  4J19 A;  1JKO C;  3EUA A;  4IEJ A;  1RI7 A;  2X48 A;  2Z2S B;  3JRA A;  5KNL A;  3F8M A;  4OWR B;  1UG2 A;  2FJ1 A;  5JLX A;  2VQH A;  4RGS A;  2DW4 A;  4XLP F;  2KIF A;  2HWV A;  5HOO A;  5D6F A;  4UUS A;  3L2C A;  1O57 A;  2F6C A;  1USS A;  5EG0 A;  2GOM A;  2BGC A;  4P9U A;  4EQQ A;  2NS0 A;  2IRF G;  3IH4 A;  1O7L A;  3H36 A;  2Z99 A;  3A0B C;  3OR2 C;  2E71 A;  1HOM A;  1SVO A;  4XQF A;  1IG7 A;  3HJE A;  3ZRG A;  5B1B H;  2HS5 A;  1ERD A;  4S04 A;  2ESH A;  2DCE A;  3QYE A;  3HRS A;  2IS4 A;  4C9Y A;  2ACJ A;  1J7K A;  1R7J A;  3ESW B;  3KEY A;  3V4G A;  2QEN A;  2Y0S N;  4BHB A;  1U5T B;  1SAU A;  2AXL A;  2MAB A;  3JAM Z;  3H0D A;  2X6W A;  5LHG A;  2R7Q A;  3GBG A; 
#chains in the Genus database with same CATH homology
 2M7A A;  1N77 A;  2M4K A;  2X51 A;  2JUG A;  3CP2 A;  3LFU A;  4XN0 A;  3FKJ A;  2L7K A;  3K4L A;  3LSI A;  4PFO A;  4HEA 2;  4YRV A;  2CV1 A;  3CJR B;  1MMA A;  2MC4 A;  1W36 D;  1MND A;  4NQW B;  2IXS A;  2DXI A;  2HVR A;  2VIX A;  5HNF A;  3PSF A;  3AFH A;  3DU5 A;  3OIQ A;  4QPQ A;  3LL7 A;  3NWS A;  3OS1 A;  2CUJ A;  3A1Y A;  3OWT A;  1V5F A;  2PJR A;  4BU2 A;  3PNY A;  1Z21 A;  3W2A A;  3PNT A;  3OYG A;  4PSX A;  4XM3 A;  2HU9 A;  4AYB A;  4U7B A;  5HNH A;  3LSK A;  5JHF A;  2CS3 A;  4HNU A;  3OYD A;  3RPU D;  3VWB A;  4F92 B;  1MMD A;  1DGR M;  3E0J B;  4AVZ A;  4B44 A;  1D0Y A;  4HRI A;  4XLA A;  4BXF A;  4Y33 A;  3L2V A;  4E7S A;  4J00 A;  1D1A A;  2ELJ A;  4PJL A;  3EPZ A;  3QYB A;  1WJF A;  2L5Q A;  2XF7 A;  2HPM A;  4YEL A;  4HSR A;  2O5R A;  3J7A Y;  3K4C A;  2KQR A;  1E0E A;  2NOJ B;  2AQF A;  3OYA A;  4XMY A;  3FBI B;  3K4N A;  3PL8 A;  4KJZ A;  3HG9 A;  2VXZ A;  1TT0 A;  2K9L A;  4HNT A;  1T95 A;  4CCO A;  2KDO A;  2KL4 A;  3H5N A;  3HXL A;  3DTE A;  2CH0 A;  2V7F A;  1D1C A;  1PYV A;  2IS1 A;  2CFO A;  2R7W A;  4JOM A;  4XKC A;  3W3C A;  2K3P A;  4CCM A;  3C2H A;  4BE2 A;  1GLN A;  3OIP A;  4BJ5 C;  4XNF A;  2HDW A;  1PJR A;  2UV1 A;  2VJ4 A;  3OYH A;  2R7U A;  4F93 B;  2R7T A;  4B3X A;  1TZL A;  2KHM A;  1HA8 A;  3E1S A;  1P9Q C;  2IGM A;  4BEH A;  2WAQ A;  4ZDO A;  2W82 A;  2LRD A;  3OYE A;  2V26 A;  3TL4 X;  1X1B A;  4PUS A;  2CW7 A;  4ZTF A;  3FBN B;  3AL0 C;  3DPT A;  2L9N A;  2X1C A;  3SYT A;  4YEJ A;  4CUG A;  2OV7 A;  2R7R A;  2LOO A;  2L9S A;  4C2T A;  3PFY A;  2LY2 A;  2E5N A;  4D9J A;  3CES A;  2CV2 A;  4XON A;  3OYC A;  2XC7 A;  4ZTJ A;  3SEQ A;  3AL0 B;  2E5Z A;  4E7H A;  2WY8 Q;  4HG2 A;  5FRN A;  3OYF A;  1W36 C;  3BLY A;  5FRM A;  2VPL A;  1UAA A;  4BUP A;  3EUK L;  3OYJ A;  2ZSH B;  3OR1 C;  2X1D A;  5CQG A;  4ANJ A;  3HPH A;  3M1C A;  2DT7 B;  3LSH A;  3HKZ A;  4X0G A;  3OYK A;  1DQU A;  4NUB A;  2LBF A;  4NC7 A;  4BQN A;  1D0X A;  4FET A;  4RM3 A;  4RLF A;  4DJA A;  2FUG 2;  3IAM 2;  1IRX A;  4IKF A;  4PK4 A;  4OAY A;  1Y6I A;  1QHH D;  2LY1 A;  3SZG A;  2VLA A;  2VKD A;  1D1B A;  2Z1D A;  3KYL A;  2IS2 A;  1V5E A;  1NG6 A;  1FMW A;  2JA2 A;  1LDK B;  3L2Q A;  4AU7 A;  4BJ6 C;  2V9K A;  2LG4 A;  3CF2 A;  4OAZ A;  2PJR B;  2XSJ C;  1VZ0 A;  4N4N B;  2L2O A;  1LKX A;  2IGO A;  1DP3 A;  4II3 A;  2WAE A;  1QHG A;  4CCK A;  1X4O A;  3DEE A;  3L2R A;  3DKX A;  3DPU A;  5HLT A;  3DQV C;  4E6K G;  3M8J A;  5CKT A;  2A5W A;  3HUG B;  2OC6 A;  4LIT A;  3RTR A;  2ZXI A;  4QPO A;  3RQ4 A;  4LIV A;  3MMY B;  4XKW A;  2KP6 A;  4XOP A;  4P1W A;  4CA0 A;  2VJI A;  3ZQQ A;  2RQQ A;  4BJT A;  1LVK A;  1G59 A;  3DU6 A;  3W2W A;  2V6E A;  3LSG A;  3C2G A;  4XN3 A;  4ZDP A;  3K4M A;  1WJA A;  4RM2 A;  3L2U A;  2HZD A;  2VAS A;  3QOD A;  3H9J A;  3OS2 A;  2R7X A;  4PSW A;  4FAS D;  4RLQ A;  4PJN A;  4DBQ A;  1OLT A;  1X4P A;  2F4I A;  2VB6 A;  4P5O A;  4PFP A;  3MKZ A;  2DT6 A;  1D0Z A;  3HL2 A;  2VQL A;  3VYR B;  1BOB A;  4IX7 A;  3DLA A;  1LFP A;  1UEL B;  2R7S A;  2P0W A;  3W2V A;  1EA3 A;  2M7B A;  4BL0 B;  2XF5 A;  1J09 A;  3OL3 A;  2M4G A;  3TMO A;  4BEH B;  3FDY A;  5HVQ C;  2BW3 A;  2E1M B;  4F91 B;  3OYB A;  3VSL A;  3ZXS A;  4E7K A;  2PMZ A;  1MMG A;  3G2B A;  3OYN A;  4BGD A;  2UWM A;  1WFX A;  2A6T A;  4KT6 A;  3OL4 A;  4XLE A;  1WJE A;  1G8X A;  2LYC A;  3CMM A;  1R6R A;  1FMV A;  4DOZ A;  4RMN A;  2WAD A;  3K4J A;  2VJ5 A;  4ZDL A;  2LH9 A;  4N4O B;  1Z7L A;  4E7L A;  3IUO A;  5KHD A;  2M0M A;  1MNE A;  4XKV A;  4EAT A;  2VXD A;  2E60 A;  2MFZ A;  4PJM A;  2QKM B;  3ONQ A;  1KON A;  3HOS A;  2JSP A;  1SFK A;  4E4H A;  1WJD A;  4XR6 A;  2RNG A;  2BOL A;  4LG3 A;  4U87 A;  4DBR A;  1X1C A;  3RSN A;  4ZC3 A;  1Z3X A;  3D5L A;  3H9Q A;  4BQO A;  3K10 A;  1QU3 A;  2Y0S A;  2W1O A;  2LBF B;  4E7I A;  2LRE A;  3UR3 C;  3K70 D;  4F52 A;  1UG0 A;  4G6T B;  2XF6 A;  3S93 A;  2HVS A;  3BG6 A;  3HOT A;  4IZZ A;  3S3M A;  4F55 A;  2K5C A;  2JVG A;  2DJI A;  2LC2 A;  1X19 A;  3QOE A;  2Z16 A;  2WA0 A;  5LFA A;  2VKH A;  2X85 A;  3MKW B;  2RRE A;  4XKB A;  5LD2 C;  1U0J A;  4IQ4 A;  3SEZ A;  3HPG A;  3RCO A;  3ZCO A;  3DPL C;  2IGK A;  2W00 A;  4CCN A;  3CZ6 A;  3LSM A;  2WBM A;  2XDV A;  3VDX A;  1DGW Y;  4CCL A;  3VYU B;  3OOU A;  4ITV A;  3TBI A;  1BR1 A;  2ZFU A;  3EUH C;  2HQA A;  5CQE A;  4NC8 A;  4CCJ A;  4HPQ A;  3H5R A;  4BE1 A;  3U21 A;  4C2U A;  2QKL B;  1BR4 A;  4KIT B;  1YX3 A;  1K6Y A;  2Q2E B;  3SDB A;  2ZXH A;  2CMP A;  2I8D A;  3VYT B;  2Q1Z B;  3DWL E;  3PJR A;  2MYS A;  4NNJ A;  4XLH A;  4BE0 A;  2CW8 A;  2VL8 A;  3OMY A;  1X1A A;  2R4G A;  3L2W A;  3DTI A;  1YE9 A;  4BQQ A;  3HC7 A;  3H5A A;  2AQE A;  3BC8 A;  2HPI A;  1V5G A;  2ZSI B;  3CP8 A;  3S32 A;  4R79 A;  2KZV A;  2W4S A;  4Y4R A;  1Z3Y A;  4B43 A;  3CJQ B;  4XLF A;  2HNH A;  2WB1 A;  2WY7 Q;  1WJB A;  4CSW A;  3OY9 A;  2E1M C;  4C30 A;  1MMN A;  4PJJ A;  1N78 A;  2IS6 A;  2BW3 B;  3S8P A;  2BVM A;  4MLO A;  2BVL A;  4BS9 A;  4IQJ A;  1OR7 C;  4XLC A;  3DKY A;  1MW7 A;  1S9H A;  2K9M A;  3F9K A;  2CUZ A;  2M3A A;  2OUM A;  3PSI A;  4II2 A;  4DIQ A;  4CH7 A;  2KRC A;  3ZR8 X;  5FRO A;  3LMM A;  3BCB A;  2VQC A;  3K4B A;  3A4C A;  3BG7 A;  3V42 A;  2X6X A;  4ZJZ A;  4J01 A;  4CZC A;  3I3L A;  4LIU A;  5TGT A;  3OYM A;  3DTK A;  3K70 C;  4D1Q A;  2JVH A;  2KPM A;  3IP4 B;  2CV0 A;  3UNG C;  4F3Q A;  3MD2 A;  3QYF A;  3EUA A;  2KRH A;  4Y3O A;  2KLO A;  2Z2S B;  3FHN A;  5KNL A;  1T0F C;  4OWR B;  4XL9 A;  3K6G A;  4E7J A;  4XOT A;  1ZEL A;  2GOX B;  2VQH A;  3K4K A;  3VYS B;  3S3N A;  2WAF A;  3OYL A;  1WJC A;  3VSK A;  5HOO A;  2HVQ A;  4KIS A;  4JQF A;  2UUZ A;  2F6C A;  1N75 A;  1YX5 A;  2GOM A;  4DGW B;  3D5R C;  4ZYA A;  3OS0 A;  4H4K C;  3D5S C;  5KCM A;  3NWT A;  2VJJ A;  4GRI A;  2R7V A;  3OR2 C;  3OYI A;  2XAU A;  3ZGK A;  2W7N A;  4XQF A;  3S3O A;  3ZRG A;  4HST A;  2F5V A;  2R7O A;  1ERD A;  2MD0 A;  4BDZ A;  2DCE A;  3QYE A;  1Y56 A;  3N05 A;  3H35 A;  2X1E A;  2IS4 A;  1X1D A;  4XOR A;  4C9Y A;  2IGN A;  1WJ5 A;  2V1N A;  2DOA A;  4BAC A;  3H9G A;  2X6Y A;  2VQG A;  3KEY A;  1BR2 A;  4E7Z A;  3KX2 A;  1AA7 A;  3A2K A;  2V4J C;  5CPR B;  3I9V 2;  4B48 A;  1JI8 A;  3MKY B;  1NG7 A;  1SAU A;  2MAB A;  3AKZ A;  2KMU A;  3PUB A;  3H0D A;  2X6W A;  3BCA A;  2R7Q A;  3IAS 2;  3PNV A;  3GBG A;  4BDY A;  4B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...