2MC4A

The solution structure of the c-terminal domain of bldd from streptomyces coelicolor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
MEPPPKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAVASHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the C-terminal domain of BldD from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
molecule keywords DNA binding protein
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mc4A00
2MC4A 4OAYA 4OAZA 5KHDA
chains in the Genus database with same CATH superfamily
4II2A 2VT3A 3FM5A 4AU7A 1B8IB 4HRIA 3TGNA 5KVRA 3CJNA 1PUFB 3CJTB 4RMNA 2PJPA 3HZJA 5HDKA 3WGGA 1S7OA 4II3A 1H0MA 5ILUA 3RSNA 2HXIA 2XSDC 5E3NA 5FKNA 4KIBA 1E0EA 3JRIA 2CQ7A 5IYBJ 2DO7A 2KDOA 4KFCA 2FMLA 2GOMA 3ZMDA 1YOVB 2BHZA 2EILH 3T5XA 3VODA 5A2QZ 1P92A 4DQ2A 1S5LC 3L2CA 1JXSA 1Z1DA 2XHKA 1A04A 1R5GA 2OQRA 2ELKA 5C3EJ 1WHUA 2LY1A 1Z21A 4HQEA 2KRFA 1YITI 1F5TA 1POGA 2PJRA 1N77A 2CV2A 2VN2A 2LC2A 1BW5A 1DGRM 2DMPA 1D1CA 3JRBA 5TISC 1DP7P 3JCUC 3B6AA 1F1ZA 4Q47A 1YG2A 3QOPA 1JJ8C 3D5RC 2KLOA 2RREA 1TWHJ 2MC3A 4F52A 2RGVA 1WRJA 3IAS2 4A3EJ 2NYXA 3R0JA 3VB2A 1ENHA 1XN7A 3ESWB 2QBYA 2VBXA 2A5YB 1QVUA 1XCVA 2M7BA 4I0BA 1TWFJ 3KFWX 1XDSA 3DEWA 5GPAA 1DPRA 2GXGA 2JUGA 3IC7A 1KA8A 3JW4A 4PFOA 4Y52J 5GPCA 3F9KA 2E19A 4P9FA 4BHBA 1IN5A 5BOXA 1SMTA 1VF9A 1MNMC 1W36C 2R3SA 2VLAA 5ICCA 1F43A 4LIVA 1ULYA 2VXDA 1HC8A 2HDCA 2VC1A 3C7JA 3KP7A 1HLVA 4A93J 2WAQA 1LDKB 4KNYA 3CESA 5ICFA 3CDIA 4L0YB 1FYLA 4ENMA 1R4MB 1TQMA 2B0LA 4JOMA 3HKZA 1EF4A 3ASNH 4HLYA 2HVQA 2FUG2 4NNJA 2LD5A 2V9KA 3F8BA 2DOFA 2L2OA 4E7ZA 2LF7A 4WWCA 4LG3A 3KZYA 5BPDA 2W24A 2COMA 1UHMA 3I58A 2K3FA 3ZP5A 4HX7A 1FBSA 2QQBA 3CD6I 1BC8C 2M87A 2R7UA 3CMAI 2O8KA 1P4XA 2K9LA 3MZHA 2IGKA 3FISA 2PLYA 4FISA 3DKWA 4XOTA 3K2ZA 1ZTRA 2IGOA 4HA8A 4OIPF 3K2AA 2LREA 3JRAA 2F4OB 1W5TA 2FU4A 4Q48A 4WXHA 3T1BA 4CH7A 5EDNA 2A6HF 2P8TA 2LBFB 2G7HA 1XMAA 2CGPA 3RZOJ 1QO0D 3H5NA 2VASA 1NK2P 1WJ5A 3M9AA 1T0FC 3S3MA 3S15J 4XN3A 1R1TA 2IJLA 3IAM2 4XLFA 4K2EA 3ZCOA 1SC7A 2W00A 4L9NA 2EV6A 5LLQA 4EV0A 3M7GA 2F2EA 2Y9YA 3BR6A 1VQ8I 2GA2A 1RZ4A 2P0WA 2A3SA 3J7YJ 3OYBA 2L54A 4D1QA 1WSUA 3IH2A 4JBAA 3I59A 3DBRB 2O5RA 2NNYA 1UHWA 2KKOA 5ERIA 3SDGA 1SD6A 3ROUA 3P5JA 1Y6IA 4D7MA 2YR2A 2BEOA 3KYLA 1D1BA 4L9JA 2LP0A 2MA3A 4CCLA 1IRZA 2ID3A 1DQUA 4BU2A 3I0TA 2DI3A 5F27A 1O3SA 2HYJA 2B9SA 1X4PA 3F22A 1L0OC 3HRUA 2RAEA 1K61A 2ZO4A 2IS4A 2E35A 2F4IA 1VI0A 5GADJ 5BPIA 2BYVE 1VQNI 3FKIJ 3TOBA 4D5CA 3RPUD 5AIPA 3FK7A 4KICA 1EH7A 4XSZF 2XGEA 2LBFA 1GXQA 2PMHA 2QQ9A 2CQXA 1AHDP 3L2QA 1H9GA 1R71A 2BHYA 3DPUA 1OCOH 3K10A 1ORKA 3HYIA 4LG0A 2L7FP 2VB6A 1XSDA 1PUEE 5HS9A 2CQQA 4PK4A 2KRHA 4B48A 1XMKA 2XV4S 4LG0B 2GWRA 3S32A 1YLFA 1ZRCA 4MGRA 3BJAA 4M3FA 2G0EA 4BY1J 1B72B 5LBQA 4YFNF 3AAFA 4MTEA 3JSOA 3MMYB 5CYVA 2HQRA 4KITB 2GA1A 5L3FA 2MFZA 2HQ5A 2JRTA 3N97A 1XPXA 2ZJ2A 2DDAA 3OSFA 2DU9A 4IHSA 4PUSA 3CO6C 1QA6A 1KU9A 2CW0F 4FETA 1J5YA 5CVRA 1K79A 1A31A 1SVLA 1FC3A 4F7ZA 4CYCA 2M5WA 4CA0A 5E3MA 4HSTA 3OWTA 2COBA 2VQGA 1OCTC 1EKEA 5GP9A 5FRNA 5H2FC 3PNYA 2OJED 2N8GA 3K4JA 4HNTA 2WAEA 4XLEA 3S2DJ 1WPKA 1UCRA 2ZJPF 5FO5A 1IC8A 4XRMA 2DT6A 2J5PA 2XAQA 2VUMJ 2DODA 3CCUI 1V3FA 2PI0A 2YX4A 1IV8A 4E7HA 1ETXA 2L0KA 3V8KA 2NVTJ 2LG4A 2NS8A 3UNGC 4HF2A 1XSVA 2PQ8A 1FLIA 1OYWA 5EG0A 3HEFA 2RDPA 4A0XA 3T0YA 1Z67A 4D9JA 4BGDA 3OIPA 3Q0WA 2VBZA 4BAYA 4EEFG 5M5WJ 1PVEA 1ON1A 1MJBA 1MBFA 2Q2EA 2Z5UA 3BR2A 2ME0A 3OYAA 3CCLI 1VQ5I 2NXNB 4EGYA 5K5QA 2HDDA 2JVGA 1B6AA 3W3CA 3HRSA 4ZYHA 1SVMA 4YG2F 5FFXA 2RNGA 1R6RA 3GLLA 1A5JA 5E3LA 4A3GJ 3CQZJ 1W5SA 4E7KA 4UUVA 2M1BA 1MSFC 3B73A 3SZGA 4CCOA 3NWSA 1BA5A 3GYHX 1Y1VJ 4DGWB 4DW6A 1QQIA 1TQIA 3W6VA 2X9DA 3LA2A 3J7ZI 2XF7A 3GZ6A 1AWCA 4IHTA 5KAFC 4RLQA 5J4YA 4WF2A 2KP6A 3N4MA 2EFOA 4M6VA 4R8HA 1YRNB 2H27A 4L9TA 3VYUB 4IJAA 3A0BC 3O3KA 4OWRB 3BWGA 3V4GA 3HB9A 3CCMI 1RNLA 2UV1A 4RBOA 3OSGA 2YUSA 4N4NB 2O3FA 1FYKA 2R7WA 3G6EI 2FBKA 4PDKA 4RAGA 2MLGA 4E4HA 4XKBA 2HOSA 3EYYA 2LNBA 1ZH5A 3E6DA 2NRAC 1XDUA 2ESNA 1EH6A 1WJAA 4G7ZF 2DFEA 5IPAA 4I09A 4EQQA 1E17A 2OBPA 3GWZA 2NS0A 2TRTA 3MCZA 3JAMZ 2EIKH 2DA7A 4GDFA 4ZYAA 4Q5SF 2DA6A 2M45A 4FE4A 2AQEA 2DPDA 3CCJI 2NNNA 1VQLI 4FHTA 5B3SH 1ZG1A 1YW8A 1YFHA 3ML6A 4BQOA 5HLIA 4KMUX 2HNHA 2F5EA 4MFDA 4ENJA 2A07F 1O57A 3DCFA 2CMPA 2I10A 2VKEA 3KYDB 4LD5A 3F8MA 1AKHA 3K1NA 2K9NA 3FBNB 1R58A 3ZQ7A 4Y33A 1XTAA 3FKJA 5J8CA 1Y56A 3QYEA 2XF6A 1XGOA 2IP2A 3DWLE 3HSEA 3BPXA 1CQTA 2CSOA 2H6CA 3V7RA 1ZN2A 5F6FA 3ZN1A 4DOZA 4RGRA 2UXNA 2ID6A 3HJEA 3IRQA 3GVAA 3CJQB 4U88A 3VYRB 1UELB 2YX7A 2RQPA 3W2VA 2QEXI 1YX3A 2LH9A 1M1EB 1JJ6C 2E71A 1R1VA 3DF8A 1SAUA 3P9CA 3ZQHA 3HTSB 1BIAA 3I4NJ 4HEA2 3REOA 1XCBA 5TGTA 1O3QA 1E3OC 3CLQA 2ZJQF 3PL8A 2A61A 2EB7A 4D5FA 3JREA 3JTGA 4KDPA 3S14J 1U6GA 4V2FA 2K9SA 5B1AH 1GV5A 3EUHC 2XAFA 1RC9A 4RGSA 1K4SA 1FSEA 2HOEA 1K6OA 2P5KA 1DU0A 1X1BA 3BY6A 4O3MA 3UR3C 2P7CB 1I1GA 2FMYA 4DIQA 4QIWN 2AQFA 2KQRA 2R4GA 4MEYF 1FJLA 1LB2A 1RRJA 3BR0A 1MIJA 4Y7NJ 2R7VA 4O5VA 2H1LA 2IPQX 3NAUA 5HODA 2MH9A 2QVOA 2M4GA 3QPLA 4A3KJ 1WZ2A 2FQ3A 5HS8A 3VEPA 3O8GA 4IHYA 3R61A 3VOEA 3FXUA 3OR2C 2MGQA 1QZEA 4FE7A 1A6QA 3K9TA 3P7NA 1JE8A 4AYBN 4GGGA 3J81K 3WTSC 3F8CA 3M8EA 2WTEA 3BQYA 3CDLA 3ZMZA 5EF6A 5AIQA 5FLVA 4B1RA 1ZG5A 3RIRA 3ABUA 2WY7Q 4A0ZA 2H1KA 3OYGA 3H9GA 3TO6A 4A3LJ 1AOYA 1NTCA 3IUOA 2HEOA 3HIFA 3WODF 3IL2A 5E1XA 4RAFA 5IT9K 3QYBA 3E0JB 5E8GA 1OR7A 1UG2A 4V19K 4HAMA 1FNNA 2VONA 1YS6A 1LJ9A 3HOXJ 4AIKA 3VYTB 1YI2I 4RLFA 4ASNA 2ISYA 2H8WA 2Y75A 2IS1A 3CC2I 1FP1D 2QENA 2O03A 1U8BA 2LF8A 1EH8A 2CG4A 1EA3A 1RUOA 1UMQA 2X48A 2OQGA 2E36A 4WX9A 1VQ9I 1TNTA 2E60A 3U9GA 4AIDA 3TMOA 4PJJA 3GTPJ 1D5VA 4IX7A 2LR8A 2JPBA 3A1YA 1KU2A 3JRGA 2EPFA 3OS0A 3LL7A 4V2GA 3EDPA 3DLLF 4KIFA 3CUQC 4L18B 3GTQJ 4NBQA 1ETKA 2PMZA 2XGDA 3FF5A 2AS5F 4Y3OA 1BIBA 2XVCA 3CLOA 5J4VA 5HNFA 3SHFA 3OYKA 2AXTC 4DJAA 3OYLA 4G6TB 4I76A 1R5HA 2NVYJ 3CMMA 1USTA 3OIQA 3S2WA 5M5XJ 4BEHA 1OCRH 5HOOA 1JUSA 3QODA 5JVTA 3ZN0A 3DU6A 2VXZA 5B66C 1ZARA 1TT0A 1I50J 2QF7A 3BROA 4A5MA 1JT0A 2XF5A 1ZQ3P 2E34A 3SDBA 2O8XA 3W6JB 1WI9A 2F48A 3EETA 3KE2A 2XPUA 1VZ0A 2XDVA 3FIWA 3CCRI 4PFPA 2PN6A 2GIZA 3S93A 1FTTA 2HTJA 2P5LC 3KP2A 2IA1A 4N9HA 4B4CA 1RETA 4WK8F 1G2HA 1Z6TA 4G7HF 1JKOC 1WKMA 2EWNA 4GO1A 1APLC 4A3CJ 4CXFA 4AVZA 3CC7I 5JHFA 2JSCA 5FLXZ 3HBLA 4HZFA 2VJ5A 2XAUA 1CF7B 4LIUA 2BGCA 2Z2SB 1YE9A 4AD9A 5HDNA 1ERDA 4ESFA 2FBHA 1J2XA 1WGXA 1ZLJA 5J8FA 3GMEA 3ZMVA 3TP0A 1OYYA 3HSRA 3B6CA 2E1MC 3SZTA 2IW5A 2HZTA 3QWLA 3MKYB 4CUGA 3PIPF 3BCAA 4JX6A 4YIFA 1SD4A 2IA2A 4HDVA 1X1DA 3GZNB 4BHCA 2VPLA 2D45A 3DV8A 1VQPI 3K7AJ 5F64A 4AYBA 3G3ZA 2OA4A 1G6NA 2LRDA 1FOYA 3BZKA 3L1PA 2EZLA 4PJMA 5FLMJ 4XKCA 3GX4X 2EQRA 1ZGWA 2BY2A 1UFMA 3TDZC 4RB0A 4LMYA 5J1RA 4M6XA 4BQQA 1K4TA 2RKHA 4CCKA 1RKTA 3BR3A 1REPC 6PAXA 1IW7F 4D7NA 1BJAA 1NG6A 2DQRA 4N9IA 2GAUA 5M5YJ 3OY9A 1JUPA 5D5UB 1XSXA 3NRVA 2XROA 2CUJA 3CTAA 3DLAA 3FXRA 5EGOA 3MZYA 4RM3A 2E1CA 4CCMA 3JAMK 2NAZA 3CP8A 2IEKA 3RCOA 3LSJA 3CUQA 1EV7A 1KQ9A 4EM1A 2QKMB 1MMSA 5K5RA 2M2EA 1QBJA 3GTMJ 1JUMA 1IDZA 3HOTA 3FBIB 2WBMA 4XN0A 4KUMA 2EIJH 2X1DA 2XB0X 2JA6J 4UV9A 3Q5FA 1K78B 1WJFA 1ZR4A 1LQ1A 3MAJA 2QYOA 4I2OA 2NVUB 4DBQA 1KZHA 3GUDA 2V6CA 3ULQB 3QAHA 2M34A 3FMRA 5L3EA 3K70D 5GAHJ 1TZLA 1WJCA 3E3VA 2ZXWH 2B63J 1MKMA 3WHBA 2LK2A 2FX0A 3DPLC 1GXPA 2DTRA 2K40A 4QPOA 3DKYA 2ACJA 1RIOH 2ZMEA 1DU6A 4BBSJ 1OFCX 2CQKA 5ED4A 3CC4I 2DMUA 4J00A 2R5YA 4HV5A 2L9VA 1MMNA 3I3LA 4MIMA 3RKXA 2C6YA 1T0FA 4E7JA 4XR6A 4BJ5C 5L3GA 2ECCA 3LSHA 3QPTA 1S7EA 2EH3A 5F1RA 1LEAA 2M9HA 3F21A 4UB6C 1V4RA 1K6YA 1SD7A 5HLGA 2NS7A 3WG9A 3E6MA 1D8JA 1W1WE 3DXJF 1LVKA 2ME6A 5LGNA 1BI2A 2ZB9A 2FXAA 1HOMA 1IUYA 4MO7A 3SQNA 1JGGA 2V9PA 1LKXA 3QPSA 4N4OB 4W97A 1ETYA 1YO5C 3BDDA 2JJ7A 2ADUA 2MW8A 4IVNA 3H9JA 1PDNC 1A6IA 3H0DA 3BG5A 3ZOBA 3BR1A 3BG9A 5JLXA 2R7SA 1H89C 4IHVA 1MGTA 2CRGA 3HKZN 2JMWA 3HTUA 4AWXB 4BXXJ 5CVUA 4MHGA 2CUFA 2F5DA 2LLKA 2EK5A 1HDDC 2FA5A 2MSYA 4CSWA 1ZRDA 2HDWA 3K1PA 2L5QA 5EEAA 1R9TJ 2XRNA 2M4KA 2ELHA 4G6DA 2V7FA 1A35A 2WB1N 5JFRA 2R7OA 3GFLA 1QHGA 4HBLA 3BLYA 1GV2A 4PJNA 3ISPA 2R5ZB 4BKXA 2BW3A 1XS9A 5CKTA 5J1UA 3BP8A 5JHUA 3FXOA 1RPWA 5EEGA 3JSPA 3C3WA 1TNSA 1K78A 5BMZA 3WG7H 3BTLA 1Z77A 3CDHA 4RS8A 3DBLB 4XRSG 2GLOA 3VFZA 1JGSA 2A05A 5D4SA 4GRIA 4XBFA 1LEBA 1I27A 3C18A 1MBEA 3F8NA 1LPQA 1OLTA 2VBYA 4QLCU 2ZKZA 4F92B 1LE8B 2EFPA 4C2TA 2EV0A 4KISA 1FOXA 4S05A 1V54H 1IN4A 2NOJB 4G12A 1Y0NA 3WU2C 4EM2A 3C2HA 5F0HA 1NK3P 2O9LA 2E1NA 1WJEA 4YEJA 2LKSA 1U9OA 2CFOA 1OYIA 2A6EF 2GZWA 2KJCA 4HG2A 4RB3C 4C3JJ 1X3ZB 5B1BH 4MLOA 5B5EC 1QHHD 2MD0A 5IYCJ 1R1UA 3OYJA 2W7NA 3F72A 4AIJA 4Z2YA 3HL2A 2HZDA 2KIUA 4Y17A 2DW4A 1T08B 1XD7A 4S0HB 1V5FA 5IP6A 2L7MP 3GXOA 1W7PD 4CZZA 5EG0B 3BZCA 1H9TA 2DT5A 1AU7A 2W82A 1B59A 1JHFA 1YYVA 5F04A 4PJ0C 4HDUA 5IP9J 2OZUA 1I5ZA 3TL4X 2HVSA 2A69F 1ACIA 3VYSB 3CZ6A 1VQMI 5FKLA 4M74A 2EV5A 1V5EA 1TT5B 1D1AA 2I5UA 2KL4A 2V1DA 3M07A 5M3FJ 2UWMA 3BQZA 5JLWA 4EJTA 1TW2A 1IN7A 2HYFA 4W1UA 2ZC2A 1GVDA 1GLNA 2OF7A 1B9NA 2K9MA 2K9QA 4LLLA 2RV8A 4B3XA 1ZGAA 4DZPA 1CGPA 2Z3YA 1UB9A 3ABMH 4IRHA 4XKWA 4XONA 2AHQA 3RKWA 1U8RA 1W5CC 3JRDA 4I98B 1MDMA 3LQRA 3R60A 2QM3A 3IV5A 1LDDA 2M0CA 1BI0A 1IJWC 2QUFA 4AVPA 4BEHB 2HTSA 4BJ6C 2DN0A 2STTA 5D8KB 1RUNA 2JUCA 2DA3A 1PUFA 4OAZA 1HBXG 2LSOA 4EVIA 2DDBA 1GT0C 5FKOA 3QPHA 2MABA 3V42A 5FB2A 2V1UA 1X1PA 4I99C 3RZDJ 4FX0A 2VKVA 1NH3A 5KCMA 3PIOF 3Q0UA 3ECHA 2DYRH 1MBGA 5K7ZA 1IRGA 1ZELA 2KRCA 2WC2A 4HX4A 2BXYA 5D5XB 1HSTA 1QZZA 4GCVA 3KEQA 4ZDLA 1B1BA 2O61A 4LK1F 3MEXA 2JSPA 1X2MA 4ZZDA 2KIFA 4UV8A 3M8JA 1KQ0A 1QNTA 4CCJA 4F91B 1OISA 2L01A 3EUAA 2E7XA 3HRMA 2L4AA 2QQAA 1SVOA 3EPZA 5C44J 2KJBA 2Y0MA 2JVHA 3H36A 2WV0A 2AXLA 2QCOA 4M9XA 3Q0VA 1SEUA 2VBWA 5LEJA 2V9VA 2F5VA 3HOUJ 4OIQF 2R7QA 4XOPA 1TC3C 4MQVA 3GFJA 4AIHA 2EFQA 1IRFA 5LHGA 4M3DA 1OQYA 4F55A 4M9ZA 2DLLA 1YJNI 1ZAOA 4KYWA 1YQAA 2HGCA 4I02A 4P1WA 2XAJA 4U0YA 5D4RA 2DJIA 5E79C 2PJRB 1VQKI 2E2HJ 4HSRA 4XLPF 1MSEC 3B02A 4B43A 2DMQA 3ASOH 2P4WA 3I4MJ 1B72A 1HW2A 3L7WA 5D6FA 2CQNA 1ETVA 4IEJA 3LA3A 3E7LA 2Z33A 1JKRC 1JKQC 1DUXC 2R7TA 1ON2A 2Y0SA 5BNGA 3MD2A 2A6TA 3BT9A 3QP5A 3HOZJ 3L9FA 1S3JA 3FXJA 4Q4ZF 2P7VB 3CP2A 4EJVA 1K83J 2ZJRF 2CO5A 3QRFF 3C1DA 3GFMA 3BOQA 1X3UA 4B8XA 1G59A 2F5CA 2HR3A 4M6YA 1TTYA 1MMAA 1JT6A 3RPUA 3KP4A 1AA7A 3ZRGA 1IUFA 3K69A 3PO3J 1QRYA 4XL9A 1HQCA 5J40A 2X0LA 3I53A 3EUHA 2QZ8A 3AL0B 5H6QA 1LFUP 1AKHB 3N05A 4LLNA 4ANJA 1O4XA 2Z99A 3RKQA 1MJAA 3S1NJ 5FROA 2B7EA 3J80Z 2CWEA 2FNAA 4PCQA 4X6AJ 4M71A 4YRVA 2HKXA 5FKKA 3T8TA 3DEEA 4BACA 3H92A 2L02A 5DEQA 4LJZF 3DTEA 2H94A 4A69C 3LQQA 3CCSI 4UXNA 1OCCH 1ETQA 4X0GA 2K86A 4YIIA 4G94A 3RQ4A 2Y69H 3WHCA 4DYCA 1ZR2A 3S1QJ 2P6TA 4WXCA 4KT6A 2E7WA 1T2KA 1E3PA 5K5OA 2XUBA 4LK0F 4F3QA 3HDDA 3FWEA 3A0HC 1TWAJ 2GXBA 2EJRA 2R7ZJ 2KDZA 2X6OA 3DEUA 3LSGA 1BJZA 1IZ1A 5IOZA 1MBHA 2W4SA 5D5WB 1TLHB 5CQEA 4ZC3A 4MFEA 3MWMA 3O2PE 2EBIA 3P9IA 2WA0A 2XPVA 1MDMB 4LFUA 5EJCA 1FSHA 5EZHA 2K5CA 3HXLA 3IWZA 3WTYC 3M1EA 3JRCA 2R7XA 1SFKA 2V6EA 3M8FA 1P9QC 4YELA 5KK1A 2JTVA 3KLOA 4AUXA 4IHWA 2HU9A 4FT8A 3G73A 5LFAA 3CCYA 1WJDA 2L9RA 4CICA 5LGUA 3AL0C 1OR7C 2CH0A 4UY8I 2WWYA 5ICEA 4UVBA 3I9V2 3KPHA 3LSIA 4L9VA 1FZPB 2HFHA 1SD5A 4H0EA 4IQJA 1IO2A 2WAQN 2MG4A 5K7HA 5TRDA 4LB5A 2D1HA 3FXKA 1D8KA 1MMGA 4RDUA 3SJMA 2JPCA 2ZMEB 4JQFA 3K70C 3OYCA 1F4KA 2Q0OA 2M8EA 2BE5F 2DA4A 5HLTA 3BCBA 1IN6A 4NC6A 1D0ZA 4ESJA 2UZKA 2IGMA 2X6YA 3I56I 2YS9A 1QVTA 3FXQA 3BTIA 4ABZA 2IT0A 1B9MA 4BBRJ 4P9UA 4CO8A 4UUSA 2ISZA 2Y30A 3DPTA 1HA8A 2K85A 2JZYA 4HQMA 1QZYA 4LGWA 4LB6B 3G1LA 3K4BA 3BG3A 3NWTA 4J01A 3RPQA 3QYFA 3F6OA 1S72I 1BR2A 1D0YA 1X4OA 3KZZA 4A2UA 2HXOA 4NC8A 5KHDA 2D1VA 3ABLH 5FGMA 4OINF 5KAIC 1B8IA 3KX2A 1I3QJ 1E3HA 3CUQB 4RA2A 4LOCA 5CJ9A 1TP4A 2QSGX 2CV1A 3K4MA 3GTKJ 4HV6A 1X2NA 4JP0A 3F3XA 2W84A 1X1CA 4OMZA 1J59A 4Y15A 5E20A 4H4KC 2PMZN 1PJRA 2QGUA 5DYMA 2CUEA 4FASD 2K3PA 1FIAA 3TO9A 4D0PA 4GYGA 2YPRA 2DYSH 1Z7UA 1OCZH 3FHNA 5DD4A 4HPQA 5CVJA 2CJJA 3DP7A 3G1OA 1SANA 4I0AA 1WWXA 4PJLA 3ZQCA 4B44A 1W4MA 4FTHA 2L9SA 2MBFA 5LHIA 5E8IA 4MNUA 2VODA 2VOOA 1HSJA 2YSRA 3ZMUA 1WCMJ 3R0AA 3H3ZA 3A01A 4XLNF 3ZMTA 2R7FA 1KYZA 3QOEA 3HC7A 3HUGB 4B09A 1T56A 1T98A 2VC0A 5KNLA 2OTJI 3OYMA 2CUZA 2DK5A 2M30A 4XRFA 4G9YA 1G3WA 1LE8A 3VPRA 2DQLA 2M7AA 3BTCA 4KN4X 2GXAA 3IH4A 2IRFG 3LMMA 1FPQA 1XG1A 3SEQA 3M3YJ 1IXSB 1IF1A 1FY7A 1SFXA 3KLNA 1FIPA 3BG6A 2V1NA 3OOUA 4CCNA 5LEKA 2BVLA 4HNUA 3I55I 4X1EA 1Z3YA 1U9NA 1MBKA 2VQCA 1SAXA 2DJNA 4B3AA 2GM4A 3LAPA 2EZHA 3F6VA 1J09A 3D0SA 1P6RA 3H5RA 1MH4A 5EGOB 2K4JA 4DBRA 1MJ9A 3CCQI 3ERED 1LVAA 2E2JJ 3MQ0A 1WH5A 2LDUA 3FHZA 3W2WA 4M73A 1MNDA 1RESA 2ZXJA 4Z6YA 5DS9A 3MFKA 3ZQFA 1XGSA 1BOAA 3D5SC 3HPHA 1MW7A 2YU9J 1XX5A 5ILVA 3GBGA 1TQPA 3BZ6A 2XKPA 2STWA 1R36A 5EEHA 3JRFA 4A3FJ 3DQVC 2DFFA 1I1SA 4ENNA 3D1NI 5J3LA 3U1DA 3GEZA 4Y4RA 3L09A 5FD5A 3PO2J 1LFPA 2NOGA 2VJ4A 4XSXF 1G4DA 3I5UA 5HS7A 4YIRX 5DTDA 5F1JA 1KGSA 2ZNZA 4IOCF 3AFHA 1IG7A 4PGHA 3FK6A 2JA8J 4AC0A 3FDYA 3G4SI 3SZPA 4U7DA 2EZIA 4HW0A 4OAYA 1T8IA 2E5NA 3TQNA 3E6BA 4ZJZA 1WI3A 2WY8Q 1Y1WJ 3A4CA 3FZVA 1GDTA 2FOKA 2ZMEC 4L5JA 2OCEA 3A03A 1NG7A 3A01B 1RKWA 2DCEA 3HOYJ 5DCMB 2L3DA 1K7AA 5M3MJ 2HWVA 2Q2EB 1IDYA 9ANTA 1W36D 4HF1A 4ZH4F 5J1YA 4HOBA 5FRMA 3E97A 4M9SA 2VJJA 4GYIA 2UUZA 1Y8QB 5DM6F 2DOEA 1R7JA 3K0LA 3H5AA 3RTRA 3E1SA 2EIMH 1FTZA 3E6CC 3HGYA 2R7DA 3C2BA 2M3AA 1O3TA 4KN7X 4M3EA 4BQAA 1Z7LA 1HKQA 5IOYA 2DFHA 3RQIA 3BG7A 1GHCA 1R22A 1ETWA 3CCVI 2K27A 1VTNC 1F36A 5EZGA 3MKLA 3OS2A 4EJUA 3OV8A 2JQ7A 4JX5A 4XLHA 3RI4A 3PFIA 1R4NB 1MZBA 2DOAA 3A2KA 1TWGJ 4XQFA 4XORA 4BDYA 1QPIA 5IT3A 3CF5F 2LVSA 5DD8A 3K1MA 1KQ8A 2IS2A 2R7RA 4ZYDA 2MC4A 2ZFUA 5FKMA 1T6SA 2NVXJ 4JX4A 3SEZA 2FF4A 3U21A 3FXMA 3AG1H 2HPMA 3HOSA 2Y2ZA 1QGPA 4L5IA 4C9YA 2HYGD 2XC7A 2HKOA 1IRXA 3WE3A 1BI3A 3TW7A 2ICWG 4KA4A 3HOVJ 1Z05A 4KT5C 3GTJJ 3H1CA 3KIOA 3KETA 4B47A 1STZA 4EM0B 4EMSA 3PUBA 1ONVA 1ODDA 2LFBA 3NQOA 3WGHA 2QA4I 2RNJA 2VQLA 1P2FA 3IP4B 3WTVC 3UKGA 2OCCH 5L3BA 3W2AA 2VOPA 3H35A 1FMVA 1ZG3A 2IAIA 4IKFA 4C2MJ 2ZCWA 1YW7A 2DAOA 2PMUA 3GTOJ 4C3HJ 4M3BA 2DPUA 3O6BB 1H8AC 3ZPLA 4BNCA 1YJ9I 3H3VK 4XLCA 3L2WA 3E5QA 1UAAA 3ZQGA 2VPRA 5FFZA 1UG0A 2MLKA 4IF4A 2ZXHA 2PEXA 1J7KA 2KT0A 3MKZA 1ZYRF 1JKPC 4E7SA 1HF0A 1BBYA 1YX5A 4QPQA 3TBIA 3ONQA 2E1MB 4P5OA 1I6XA 4E6KG 2WAFA 2QQ8A 2KFDA 4LLGF 4A12A 3S3NA 2XIGA 2GBYA 3MVPA 3WTZA 3OYDA 2FD5A 1Y39A 3PQJA 2EFWA 5DV5A 2PFBA 1PP7U 4UB8C 1YHQI 4XLAA 4NB5A 2FQ4A 3OYNA 1I6HJ 2Y48A 2ZSHB 1IXCA 2ETHA 2DBBA 3PQKA 4JK1X 4ZZLA 1Q1HA 2X51A 2CS3A 2WADA 5D8LB 5GAGJ 2R92J 2OZ6A 3RDIA 3QP6A 2M0MA 2W25A 3TW6A 3WTXC 4CYCB 2X1CA 1N75A 3OMYA 1BOBA 5BQTA 3IKTA 4RAYA 2HPIA 4BE0A 1F9NA 3BJ6A 1WVRA 2VE9A 1Z3XA 4CDGA 1BW6A 3U2RA 1KYWA 4GFBA 2M8GX 4ESBA 4XRSA 2Q1ZB 3KP5A 4L5EA 4U0WA 2EFNA 3LSPA 2HVRA 2PG4A 2V1XA 1WFXA 3L2VA 4N0BA 3KZIC 1R5ID 4EGZA 3IWFA 1S7AA 1R23A 3DFGA 1P4WA 3S16J 3ELKA 4JYKA 2DT7B 2GOXB 3ZXSA 1FT9A 2DMTA 3OYEA 2VKHA 4XMYA 3LSMA 2F4MB 2X6WA 3S17J 3CCEI 4EJOA 4CZCA 1BR4A 5J47A 2YU3A 3O8HA 1IGNA 4AM3A 4PSXA 1U5TA 1HW1A 4UUSB 4UNOA 2OUMA 3ZR8X 1X58A 3ZGKA 3OOPA 5FD6A 1VQ6I 1G8XA 2I8DA 1UJ8A 4U87A 4UUTA 5JR3A 3OYFA 3BC8A 2BXZA 3I64A 1ZK8A 2XB5A 3KCCA 3LSTA 4PGGA 5F0CA 1CF7A 3M1CA 1TW3A 3RJPA 4RB2C 4RB1A 1A36A 2JWTA 3G1MA 2J5OA 3WTTC 3L2UA 1TL8A 2AO9A 2OPTA 2A68F 3WGIA 3HGGA 2Y0SN 1JHHA 4CHUA 2OAZA 2DA2A 3KEOA 1DDNA 3S1RJ 3I59B 2ZSIB 5ICGA 1T33A 5GAEJ 3K4LA 1V5GA 2QSFX 2X1EA 3GLXA 4I6ZA 3AG2H 2DMNA 5FJ8J 3JRHA 4BYYA 1MMDA 4UHTA 4A0YA 4YFKF 2KZVA 3DTIA 1P7IA 2MD5A 5DM7F 5CLSA 1Z6RA 4PZJA 4IHXA 1VQ7I 5K1YA 3AKZA 1GUUA 5J6XA 1HKTA 3K4NA 1D3YA 4WXDA 2X6XA 3MZ8A 4BY7J 3GO5A 5DDGA 3MN2A 4ENKA 2LKXA 4IO9F 2F5FA 3R4KA 5K7FA 3OYIA 1FBQA 3W6KB 3WE2A 4DNCA 2DTZA 4HNVA 4G7OF 4RGXA 1WJBA 3KEYA 4OOIA 4C3IJ 3DBHB 1FP2A 3ZQQA 1T38A 3WU0A 2QLZA 1R49A 4A3BJ 4NDLA 4R79A 4RM2A 1E2XA 3ECOA 1FOWA 1G3YA 3HM5A 2ZNYA 5H6RA 2XAGA 3U1KA 4U7BA 1X3WB 2MYSA 2DA1A 1ZLKA 2JK3A 4ZYEA 4IXAA 4BL0B 5GTIC 3PSFA 1YIJI 1EJ9A 2BY3A 2BVMA 2ZXIA 2K4BA 3I4PA 2MH2A 1JI8A 1XMXA 2PBIA 4L0ZB 1FEXA 4BS9A 3HPGA 2FJ1A 3H0GJ 1ZRFA 5HLHA 4ETSA 3ABTA 2VE8A 5HNHA 2P81A 1BL0A 4BE1A 2XGXA 3TKYA 2QKLB 4E7LA 1VQOI 3EYIA 1P4AA 5D5VB 3SFIA 3IRRA 5LRSA 3BR5A 4NQWA 4A5NA 3G2BA 1NHAA 2W48A 4EJWA 1MBJA 4FCYA 4IRGA 2UXXA 4NQWB 2Y31A 5E1WA 2XKOA 4G6QA 2JRMA 3L2RA 3V7CA 3HG9A 1W7PB 2FE3A 2JA7J 1OMIA 2L7KA 4OIOF 2X4HA 1YTYA 1FOKA 2TDXA 1JTYA 1T39A 1JTXA 5CVIA 2VIXA 2IVMA 1LUJB 5CVVA 3Q3SA 2CV0A 2WV1A 1ZKGA 4XICA 1SFUA 2RN7A 2V26A 2R0QC 1V55H 1OPCA 3SFZA 1W0TA 3F0CA 2LOOA 3X2QH 4IL6C 1L3LA 1Y8RB 2CW8A 2FEZA 4Y13A 1VNDA 3FM3A 1Z0XA 3H9QA 4UVCA 3V8LA 3E5XA 3C2GA 1B4AA 3DU5A 4ITVA 3PJRA 2R93J 1IAWA 3PNTA 3K6GA 1O7FA 2V79A 4DZJA 3GF2A 1N78A 1YS7A 3RKYA 4CGZA 4QSHA 4U0VA 2H6BA 4ON0A 2HQNA 2DK8A 4G8XA 5E3OA 2O6GE 2G9WA 3OR1C 1S9HA 4KIGA 4BH9A 2FNPA 3IHUA 2ELJA 1YW9A 3I71A 4ZTFA 5HDGA 1S6LA 1UHSA 4XNFA 1KONA 2E1OA 2HI3A 3T8RA 4BUPA 4IOAF 2EINH 2F6CA 3TO7A 3CO7C 3DTKA 4NHJA 3ZQLA 1DGWY 1XB4A 4BXFA 3GFIA 1Z91A 4NUBA 2BY0A 1VQ4I 5E17F 4C2UA 1USSA 1H88C 4ZYGA 3MKWB 1KU3A 1T95A 5A2QK 2OD5A 1BN5A 2E2IJ 1HXDA 2RQQA 3HHGA 2IGNA 3NEUA 3K4CA 5ILSA 3I54A 1W0UA 1FMWA 1XGMA 1TWCJ 2OC6A 5GTHC 4OU0A 3HOWJ 2Q8KA 3S3OA 2IXSA 1D0XA 5JVGF 3RYPA 1ZHFA 3BTJA 3KP6A 1HCRA 2TCTA 1G3SA 2R5YB 5E18F 4OMYA 1UZCA 2BZTA 1DPUA 2BBYA 3NARA 1W7PA 2E5ZA 3J7AO 5HVQC 1P7JA 5AONA 1LFBA 3TEDA 1TBXA 2RC4A 3Q9SA 3GZ5A 1BC7C 2LTPA 5LD2C 1FBUA 1HW5A 2HQAA 5IY5H 3R6SA 2GQQA 3V7SA 4A3IJ 4UVAA 2W85A 1RI7A 3F23A 3A02A 1IN8A 3DKXA 2XASA 2RVCA 3GW2A 1O3RA 3M4OJ 2QSHX 5EYRA 2W1OA 5CPRB 3PUFA 3PNVA 3ABKH 3EUKL 4I01A 1OKRA 3D5LA 2VI6A 4NC7A 4XKVA 2XPWA 3WTUC 1MH3A 2O0YA 2P5VA 3J80K 4R1HA 1DP3A 2KISA 4HYEA 4IZZA 2H09A 1PYVA 2CU7A 1I3AA 2LMDA 3QU6A 3CMEI 2DXIA 3P9KA 3LAJA 4PSWA 2FSWA 3PSIA 1XGNA 2VL8A 3ZQIA 3HUGA 1HKSA 2FOWA 1ZREA 4FX4A 2H8RA 2Z16A 4QWQA 2OV7A 3BJOA 3LSRA 3J81Z 5D6EA 4J19A 3SYTA 2VKDA 4LITA 4EATA 1YIOA 1VFCA 1GVJA 3LSKA 4M3GA 4MEXF 5IYDJ 4ZTJA 1BI1A 1J0RA 1FWZA 2KZGA 2W57A 3FXLA 3KYCB 5CQGA 2LY2A 4HX8A 4A6DA 3TOAA 3L00A 4XIDA 3VWBA 2EA4A 4I7HA 1IXRC 3LOCA 3IKVA 2R5ZA 3BPVA 3AG3H 1U5TC 5FLXK 3V8JA 2JA2A 2XRLA 2IBDA 1FYMA 1WQ2A 2D5VA 5E1ZB 4QTRA 3RYRA 3PFYA 4YFXF 4RGUA 1MNEA 2JA5J 2JN6A 3FMQA 2JT1A 1ITYA 5DCFA 3HHHA 4HF0A 4BHPA 4DYQA 1QU3A 3H3UA 2LY9A 2K7LA 2BY1A 2OU2A 2BV6A 3J7AY 1G3TA 2CYYA 2L4MA 2DA5A 3LNQA 3CJRB 1ETOA 2G7UA 2QBYB 4S04A 3OS1A 3VDXA 5IT9Z 5H20A 2HOTA 2XSJC 4XM3A 3OIOA 2L9NA 5IP7J 3LA7A 4IQ4A 3WTWC 1FX7A 1X1AA 2ESHA 1OCPA 4CYDA 5C4JJ 5L3CA 2XGCA 1U78A 4A6EA 2HOAA 3SXYA 2V4JC 2VJIA 3QQAA 3VSKA 4E70A 1S29A 3CMYA 3GTLJ 1ZGJA 4O6JA 2D2WA 1MD0A 2P6SA 1KU7A 5L3DA 5TJJA 2A5WA 3QU3A 4ZDPA 3LFUA 2ZFWA 3CUOA 4WCGA 1D5YA 1OJLA 3ZMSA 2KIQA 4IPAA 1Z9CA 4BJTA 3LWFA 3Q9VA 1Q1VA 3FMSA 2XAHA 2BW3B 3CF2A 3KP3A 4F93B 1U5TB 4BQNA 2IA0A 3HRTA 5DUKA 4A3MJ 3ERMA 2OTLI 1QPMA 2KHMA 3AG4H 1C0WA 4KMFA 1BM9A 2LKPA 4E7IA 4BE2A 5C4XJ 2O7OA 1PP8F 3HSFA 4HLXA 3WU1B 4M72A 3S1MJ 1O7LA 1SFOJ 1LDJA 4P96A 1X19A 1BR1A 3FX3A 3F8FA 2FRHA 1IV6A 4MTDA 5F0FA 3EQLF 2ZBKA 1HDPA 5F08A 5BS6A 2Z1DA 2ECBA 2QWWA 2CW7A 5LRRA 2EA2A 1YJWI 3K4KA 4OIRF 2EZKA 1U3EM 2DFIA 1I39A 5LGTA 2KIMA 2CFXA 3OL3A 5JI6A 1J9IA 1SFEA 4ZDOA 4XK4A 3E5UA 3S2HJ 2KMUA 3TDUC 2Y9ZA 1U2WA 2KPMA 3GCMA 4MQ9F 3JTHA 1XC5A 3IH3A 4A3DJ 4C30A 2IS6A 4IRIA 2WB1A 2NVQJ 1RR7A 3TP3A 3GTGJ 2LYCA 1WH7A 2GIVA 2X85A 3OL4A 4FQGA 4TV7A 2PX9A 1U0JA 2VT2A 1SMYF 3PM1A 4RAZA 1N25A 1Y0UA 3G71I 3VSLA 4BXUA 4KJZA 3OYHA 3LFKA 5DUIA 1S8NA 2Z9OA 1YRNA 2L7ZA 5DCMA 4GXOA 2VQHA 3S8PA 1J75A 4A3JJ 2FBIA 5LHHA 4DYRA 1LNWA 1RR8C 4P55A 2K02A 3COAC 4BDZA 2BOLA 1R00A 2HS5A 3JR9A
chains in the Genus database with same CATH topology
4II2A 1WFXA 3L2VA 4AU7A 4HRIA 4RMNA 2WY7Q 4II3A 2R7TA 2DT7B 2GOXB 3ZXSA 3OYEA 2VKHA 2Y0SA 3RSNA 3OYGA 3MD2A 2A6TA 4XMYA 3LSMA 3H9GA 2X6WA 3IUOA 4CZCA 1BR4A 3CP2A 3QYBA 3E0JB 1E0EA 4PSXA 2OUMA 3ZR8X 1G59A 2KDOA 3VYTB 2GOMA 3ZGKA 1MMAA 1G8XA 2I8DA 4U87A 3OYFA 1AA7A 3BC8A 3ZRGA 4RLFA 2IS1A 4XL9A 2LY1A 1Z21A 3M1CA 3AL0B 1EA3A 3N05A 4ANJA 2PJRA 1N77A 3L2UA 2CV2A 2E60A 2LC2A 3TMOA 5FROA 1DGRM 4PJJA 1D1CA 4IX7A 3A1YA 4YRVA 3OS0A 3LL7A 3DEEA 4BACA 2ZSIB 2KLOA 3D5RC 3DTEA 2RREA 2PMZA 3K4LA 4X0GA 4Y3OA 4F52A 1V5GA 3RQ4A 2X1EA 5HNFA 3IAS2 3OYKA 4KT6A 4DJAA 3OYLA 4G6TB 4F3QA 2M7BA 1MMDA 3CMMA 2KZVA 3DTIA 3OIQA 2JUGA 3LSGA 4BEHA 2W4SA 3AKZA 4PFOA 5HOOA 5CQEA 4ZC3A 3F9KA 3QODA 3DU6A 2WA0A 2VXZA 1TT0A 3K4NA 2XF5A 2K5CA 3SDBA 2X6XA 3HXLA 1W36C 2R7XA 2VLAA 1SFKA 4LIVA 2VXDA 1VZ0A 2V6EA 3OYIA 2XDVA 1P9QC 4PFPA 4YELA 3S93A 1WJBA 2HU9A 3KEYA 2WAQA 1LDKB 1WJDA 3ZQQA 3CESA 5LFAA 3AL0C 1OR7C 2CH0A 3I9V2 3LSIA 4JOMA 3HKZA 4R79A 4RM2A 4IQJA 2HVQA 2FUG2 4NNJA 1MMGA 4U7BA 2V9KA 4AVZA 5JHFA 2L2OA 2MYSA 4JQFA 4E7ZA 3K70C 3OYCA 2VJ5A 2XAUA 5HLTA 4LG3A 2Z2SB 4LIUA 1YE9A 4BL0B 1ERDA 3PSFA 3BCBA 2BVMA 2ZXIA 1D0ZA 1JI8A 2IGMA 2X6YA 3MKYB 2E1MC 2R7UA 4BS9A 2K9LA 3HPGA 4CUGA 2IGKA 3BCAA 3DPTA 1HA8A 4XOTA 5HNHA 2IGOA 4BE1A 2QKLB 4E7LA 1X1DA 2LREA 3K4BA 3NWTA 4J01A 2VPLA 3QYFA 4CH7A 2LBFB 1BR2A 4AYBA 3G2BA 1D0YA 2LRDA 1X4OA 3H5NA 2VASA 4PJMA 4NC8A 5KHDA 4NQWB 1WJ5A 4XKCA 1T0FC 3S3MA 4XN3A 3IAM2 4XLFA 3ZCOA 3KX2A 2W00A 3L2RA 3HG9A 2CV1A 3K4MA 4BQQA 2L7KA 4CCKA 2P0WA 3OYBA 1X1CA 4D1QA 2O5RA 2VIXA 4H4KC 1NG6A 1PJRA 4FASD 1Y6IA 2CV0A 3OY9A 2K3PA 3KYLA 1D1BA 2CUJA 4CCLA 2V26A 3DLAA 4RM3A 1DQUA 4BU2A 4CCMA 3CP8A 2LOOA 3RCOA 1X4PA 3FHNA 2CW8A 4HPQA 2IS4A 2F4IA 2QKMB 3H9QA 3C2GA 3DU5A 3HOTA 4PJLA 3FBIB 4ITVA 3RPUD 2WBMA 2L9SA 4B44A 3PJRA 4XN0A 3PNTA 3K6GA 1N78A 2X1DA 2LBFA 3OR1C 1S9HA 1WJFA 3L2QA 3DPUA 3K10A 3QOEA 2ELJA 4DBQA 2VB6A 4ZTFA 4PK4A 2KRHA 4XNFA 3HC7A 1KONA 3HUGB 4B48A 4BUPA 3S32A 5KNLA 2F6CA 3K70D 3OYMA 2CUZA 3DTKA 1TZLA 1WJCA 1DGWY 4BXFA 2M7AA 4NUBA 3LMMA 4C2UA 3DPLC 3MMYB 3SEQA 4QPOA 4KITB 3DKYA 2MFZA 3MKWB 1T95A 3BG6A 2V1NA 3OOUA 4CCNA 4J00A 2BVLA 4HNUA 3I3LA 1MMNA 4PUSA 2RQQA 1Z3YA 2VQCA 4E7JA 4FETA 4XR6A 2IGNA 3K4CA 4BJ5C 3LSHA 1J09A 3H5RA 4CA0A 1FMWA 4HSTA 3OWTA 4DBRA 2OC6A 2VQGA 3S3OA 2IXSA 5FRNA 1K6YA 1D0XA 3PNYA 3K4JA 4HNTA 2WAEA 4XLEA 3W2WA 1LVKA 1MNDA 2DT6A 2E5ZA 5HVQC 4E7HA 3HPHA 3D5SC 5LD2C 1LKXA 4N4OB 1MW7A 2HQAA 2LG4A 3GBGA 3UNGC 3DQVC 3H9JA 3DKXA 4D9JA 4BGDA 3H0DA 4Y4RA 1LFPA 2W1OA 3OIPA 5CPRB 3PNVA 3EUKL 2VJ4A 3D5LA 2R7SA 4NC7A 4XKVA 3OYAA 3AFHA 2JVGA 4CSWA 3W3CA 2HDWA 3FDYA 2L5QA 2RNGA 1R6RA 1DP3A 2M4KA 4IZZA 2V7FA 1PYVA 2DXIA 4OAYA 2R7OA 1QHGA 2E5NA 4E7KA 4PSWA 3BLYA 3PSIA 3SZGA 2WY8Q 4CCOA 4ZJZA 2VL8A 3NWSA 4PJNA 3A4CA 4DGWB 2Z16A 2OV7A 2BW3A 5CKTA 2XF7A 3SYTA 2VKDA 1NG7A 4RLQA 2DCEA 4LITA 2KP6A 4EATA 3LSKA 3VYUB 2Q2EB 4ZTJA 1W36D 5CQGA 2LY2A 5FRMA 4OWRB 4GRIA 3VWBA 2UV1A 2VJJA 2UUZA 4N4NB 1OLTA 2R7WA 3H5AA 3RTRA 3E1SA 4F92B 4E4HA 2JA2A 4XKBA 2M3AA 4C2TA 4KISA 1Z7LA 2NOJB 3PFYA 3C2HA 1WJAA 1MNEA 3BG7A 1WJEA 4YEJA 2CFOA 4HG2A 3OS2A 4ZYAA 1QU3A 4XLHA 3A2KA 2DOAA 2AQEA 4MLOA 1QHHD 2MD0A 4XQFA 4XORA 3J7AY 4BDYA 3OYJA 2W7NA 3CJRB 3HL2A 3OS1A 2HZDA 3VDXA 2IS2A 2R7RA 2XSJC 4XM3A 4BQOA 2MC4A 1V5FA 2L9NA 2ZFUA 2HNHA 4IQ4A 1X1AA 3SEZA 3U21A 2W82A 2HPMA 3HOSA 2CMPA 4C9YA 2HVSA 3TL4X 2V4JC 2VJIA 2XC7A 3VSKA 3VYSB 1IRXA 3CZ6A 2A5WA 4ZDPA 3LFUA 1V5EA 1D1AA 2KL4A 3FBNB 2UWMA 4B47A 4Y33A 3PUBA 3FKJA 4BJTA 1GLNA 1Y56A 3QYEA 2K9MA 2XF6A 2VQLA 2BW3B 3CF2A 4B3XA 3IP4B 4F93B 4BQNA 3DWLE 2KHMA 4XKWA 4XONA 3W2AA 4DOZA 4BE2A 4E7IA 3H35A 1FMVA 4IKFA 3CJQB 3VYRB 1UELB 3W2VA 1YX3A 2LH9A 4BEHB 1X19A 4BJ6C 1SAUA 1BR1A 4OAZA 4XLCA 3L2WA 1UAAA 2MABA 3V42A 2Z1DA 4HEA2 1UG0A 2CW7A 2ZXHA 3MKZA 5TGTA 3K4KA 4E7SA 1YX5A 4QPQA 3PL8A 3TBIA 3OL3A 5KCMA 3ONQA 4ZDOA 2E1MB 4P5OA 4E6KG 2WAFA 3EUHC 1ZELA 2KMUA 2KRCA 3S3NA 4ZDLA 2KPMA 3OYDA 1X1BA 2JSPA 3UR3C 4DIQA 3M8JA 2AQFA 4C30A 2KQRA 4CCJA 2R4GA 4F91B 2IS6A 3EUAA 4XLAA 2WB1A 3OYNA 3EPZA 2JVHA 2LYCA 2R7VA 2X85A 2ZSHB 3OL4A 1U0JA 2F5VA 2X51A 2CS3A 2WADA 2R7QA 2M4GA 4KJZA 4XOPA 3VSLA 3OYHA 2M0MA 2X1CA 1N75A 3OMYA 1BOBA 4F55A 2HPIA 3OR2C 4BE0A 2VQHA 3S8PA 1Z3XA 4P1WA 2DJIA 2PJRB 4BDZA 2BOLA 4HSRA 2Q1ZB 2HVRA 4B43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC4 A;  4OAY A;  4OAZ A;  5KHD A; 
#chains in the Genus database with same CATH topology
 4II2 A;  2VT3 A;  3FM5 A;  4AU7 A;  1B8I B;  4HRI A;  3TGN A;  5KVR A;  3CJN A;  1PUF B;  3CJT B;  4RMN A;  2PJP A;  3HZJ A;  5HDK A;  3WGG A;  1S7O A;  4II3 A;  1H0M A;  5ILU A;  3RSN A;  2HXI A;  2XSD C;  5E3N A;  5FKN A;  4KIB A;  1E0E A;  3JRI A;  2CQ7 A;  5IYB J;  2DO7 A;  2KDO A;  4KFC A;  2FML A;  2GOM A;  3ZMD A;  1YOV B;  2BHZ A;  2EIL H;  3T5X A;  3VOD A;  5A2Q Z;  1P92 A;  4DQ2 A;  1S5L C;  3L2C A;  1JXS A;  1Z1D A;  2XHK A;  1A04 A;  1R5G A;  2OQR A;  2ELK A;  5C3E J;  1WHU A;  2LY1 A;  1Z21 A;  4HQE A;  2KRF A;  1YIT I;  1F5T A;  1POG A;  2PJR A;  1N77 A;  2CV2 A;  2VN2 A;  2LC2 A;  1BW5 A;  1DGR M;  2DMP A;  1D1C A;  3JRB A;  5TIS C;  1DP7 P;  3JCU C;  3B6A A;  1F1Z A;  4Q47 A;  1YG2 A;  3QOP A;  1JJ8 C;  3D5R C;  2KLO A;  2RRE A;  1TWH J;  2MC3 A;  4F52 A;  2RGV A;  1WRJ A;  3IAS 2;  4A3E J;  2NYX A;  3R0J A;  3VB2 A;  1ENH A;  1XN7 A;  3ESW B;  2QBY A;  2VBX A;  2A5Y B;  1QVU A;  1XCV A;  2M7B A;  4I0B A;  1TWF J;  3KFW X;  1XDS A;  3DEW A;  5GPA A;  1DPR A;  2GXG A;  2JUG A;  3IC7 A;  1KA8 A;  3JW4 A;  4PFO A;  4Y52 J;  5GPC A;  3F9K A;  2E19 A;  4P9F A;  4BHB A;  1IN5 A;  5BOX A;  1SMT A;  1VF9 A;  1MNM C;  1W36 C;  2R3S A;  2VLA A;  5ICC A;  1F43 A;  4LIV A;  1ULY A;  2VXD A;  1HC8 A;  2HDC A;  2VC1 A;  3C7J A;  3KP7 A;  1HLV A;  4A93 J;  2WAQ A;  1LDK B;  4KNY A;  3CES A;  5ICF A;  3CDI A;  4L0Y B;  1FYL A;  4ENM A;  1R4M B;  1TQM A;  2B0L A;  4JOM A;  3HKZ A;  1EF4 A;  3ASN H;  4HLY A;  2HVQ A;  2FUG 2;  4NNJ A;  2LD5 A;  2V9K A;  3F8B A;  2DOF A;  2L2O A;  4E7Z A;  2LF7 A;  4WWC A;  4LG3 A;  3KZY A;  5BPD A;  2W24 A;  2COM A;  1UHM A;  3I58 A;  2K3F A;  3ZP5 A;  4HX7 A;  1FBS A;  2QQB A;  3CD6 I;  1BC8 C;  2M87 A;  2R7U A;  3CMA I;  2O8K A;  1P4X A;  2K9L A;  3MZH A;  2IGK A;  3FIS A;  2PLY A;  4FIS A;  3DKW A;  4XOT A;  3K2Z A;  1ZTR A;  2IGO A;  4HA8 A;  4OIP F;  3K2A A;  2LRE A;  3JRA A;  2F4O B;  1W5T A;  2FU4 A;  4Q48 A;  4WXH A;  3T1B A;  4CH7 A;  5EDN A;  2A6H F;  2P8T A;  2LBF B;  2G7H A;  1XMA A;  2CGP A;  3RZO J;  1QO0 D;  3H5N A;  2VAS A;  1NK2 P;  1WJ5 A;  3M9A A;  1T0F C;  3S3M A;  3S15 J;  4XN3 A;  1R1T A;  2IJL A;  3IAM 2;  4XLF A;  4K2E A;  3ZCO A;  1SC7 A;  2W00 A;  4L9N A;  2EV6 A;  5LLQ A;  4EV0 A;  3M7G A;  2F2E A;  2Y9Y A;  3BR6 A;  1VQ8 I;  2GA2 A;  1RZ4 A;  2P0W A;  2A3S A;  3J7Y J;  3OYB A;  2L54 A;  4D1Q A;  1WSU A;  3IH2 A;  4JBA A;  3I59 A;  3DBR B;  2O5R A;  2NNY A;  1UHW A;  2KKO A;  5ERI A;  3SDG A;  1SD6 A;  3ROU A;  3P5J A;  1Y6I A;  4D7M A;  2YR2 A;  2BEO A;  3KYL A;  1D1B A;  4L9J A;  2LP0 A;  2MA3 A;  4CCL A;  1IRZ A;  2ID3 A;  1DQU A;  4BU2 A;  3I0T A;  2DI3 A;  5F27 A;  1O3S A;  2HYJ A;  2B9S A;  1X4P A;  3F22 A;  1L0O C;  3HRU A;  2RAE A;  1K61 A;  2ZO4 A;  2IS4 A;  2E35 A;  2F4I A;  1VI0 A;  5GAD J;  5BPI A;  2BYV E;  1VQN I;  3FKI J;  3TOB A;  4D5C A;  3RPU D;  5AIP A;  3FK7 A;  4KIC A;  1EH7 A;  4XSZ F;  2XGE A;  2LBF A;  1GXQ A;  2PMH A;  2QQ9 A;  2CQX A;  1AHD P;  3L2Q A;  1H9G A;  1R71 A;  2BHY A;  3DPU A;  1OCO H;  3K10 A;  1ORK A;  3HYI A;  4LG0 A;  2L7F P;  2VB6 A;  1XSD A;  1PUE E;  5HS9 A;  2CQQ A;  4PK4 A;  2KRH A;  4B48 A;  1XMK A;  2XV4 S;  4LG0 B;  2GWR A;  3S32 A;  1YLF A;  1ZRC A;  4MGR A;  3BJA A;  4M3F A;  2G0E A;  4BY1 J;  1B72 B;  5LBQ A;  4YFN F;  3AAF A;  4MTE A;  3JSO A;  3MMY B;  5CYV A;  2HQR A;  4KIT B;  2GA1 A;  5L3F A;  2MFZ A;  2HQ5 A;  2JRT A;  3N97 A;  1XPX A;  2ZJ2 A;  2DDA A;  3OSF A;  2DU9 A;  4IHS A;  4PUS A;  3CO6 C;  1QA6 A;  1KU9 A;  2CW0 F;  4FET A;  1J5Y A;  5CVR A;  1K79 A;  1A31 A;  1SVL A;  1FC3 A;  4F7Z A;  4CYC A;  2M5W A;  4CA0 A;  5E3M A;  4HST A;  3OWT A;  2COB A;  2VQG A;  1OCT C;  1EKE A;  5GP9 A;  5FRN A;  5H2F C;  3PNY A;  2OJE D;  2N8G A;  3K4J A;  4HNT A;  2WAE A;  4XLE A;  3S2D J;  1WPK A;  1UCR A;  2ZJP F;  5FO5 A;  1IC8 A;  4XRM A;  2DT6 A;  2J5P A;  2XAQ A;  2VUM J;  2DOD A;  3CCU I;  1V3F A;  2PI0 A;  2YX4 A;  1IV8 A;  4E7H A;  1ETX A;  2L0K A;  3V8K A;  2NVT J;  2LG4 A;  2NS8 A;  3UNG C;  4HF2 A;  1XSV A;  2PQ8 A;  1FLI A;  1OYW A;  5EG0 A;  3HEF A;  2RDP A;  4A0X A;  3T0Y A;  1Z67 A;  4D9J A;  4BGD A;  3OIP A;  3Q0W A;  2VBZ A;  4BAY A;  4EEF G;  5M5W J;  1PVE A;  1ON1 A;  1MJB A;  1MBF A;  2Q2E A;  2Z5U A;  3BR2 A;  2ME0 A;  3OYA A;  3CCL I;  1VQ5 I;  2NXN B;  4EGY A;  5K5Q A;  2HDD A;  2JVG A;  1B6A A;  3W3C A;  3HRS A;  4ZYH A;  1SVM A;  4YG2 F;  5FFX A;  2RNG A;  1R6R A;  3GLL A;  1A5J A;  5E3L A;  4A3G J;  3CQZ J;  1W5S A;  4E7K A;  4UUV A;  2M1B A;  1MSF C;  3B73 A;  3SZG A;  4CCO A;  3NWS A;  1BA5 A;  3GYH X;  1Y1V J;  4DGW B;  4DW6 A;  1QQI A;  1TQI A;  3W6V A;  2X9D A;  3LA2 A;  3J7Z I;  2XF7 A;  3GZ6 A;  1AWC A;  4IHT A;  5KAF C;  4RLQ A;  5J4Y A;  4WF2 A;  2KP6 A;  3N4M A;  2EFO A;  4M6V A;  4R8H A;  1YRN B;  2H27 A;  4L9T A;  3VYU B;  4IJA A;  3A0B C;  3O3K A;  4OWR B;  3BWG A;  3V4G A;  3HB9 A;  3CCM I;  1RNL A;  2UV1 A;  4RBO A;  3OSG A;  2YUS A;  4N4N B;  2O3F A;  1FYK A;  2R7W A;  3G6E I;  2FBK A;  4PDK A;  4RAG A;  2MLG A;  4E4H A;  4XKB A;  2HOS A;  3EYY A;  2LNB A;  1ZH5 A;  3E6D A;  2NRA C;  1XDU A;  2ESN A;  1EH6 A;  1WJA A;  4G7Z F;  2DFE A;  5IPA A;  4I09 A;  4EQQ A;  1E17 A;  2OBP A;  3GWZ A;  2NS0 A;  2TRT A;  3MCZ A;  3JAM Z;  2EIK H;  2DA7 A;  4GDF A;  4ZYA A;  4Q5S F;  2DA6 A;  2M45 A;  4FE4 A;  2AQE A;  2DPD A;  3CCJ I;  2NNN A;  1VQL I;  4FHT A;  5B3S H;  1ZG1 A;  1YW8 A;  1YFH A;  3ML6 A;  4BQO A;  5HLI A;  4KMU X;  2HNH A;  2F5E A;  4MFD A;  4ENJ A;  2A07 F;  1O57 A;  3DCF A;  2CMP A;  2I10 A;  2VKE A;  3KYD B;  4LD5 A;  3F8M A;  1AKH A;  3K1N A;  2K9N A;  3FBN B;  1R58 A;  3ZQ7 A;  4Y33 A;  1XTA A;  3FKJ A;  5J8C A;  1Y56 A;  3QYE A;  2XF6 A;  1XGO A;  2IP2 A;  3DWL E;  3HSE A;  3BPX A;  1CQT A;  2CSO A;  2H6C A;  3V7R A;  1ZN2 A;  5F6F A;  3ZN1 A;  4DOZ A;  4RGR A;  2UXN A;  2ID6 A;  3HJE A;  3IRQ A;  3GVA A;  3CJQ B;  4U88 A;  3VYR B;  1UEL B;  2YX7 A;  2RQP A;  3W2V A;  2QEX I;  1YX3 A;  2LH9 A;  1M1E B;  1JJ6 C;  2E71 A;  1R1V A;  3DF8 A;  1SAU A;  3P9C A;  3ZQH A;  3HTS B;  1BIA A;  3I4N J;  4HEA 2;  3REO A;  1XCB A;  5TGT A;  1O3Q A;  1E3O C;  3CLQ A;  2ZJQ F;  3PL8 A;  2A61 A;  2EB7 A;  4D5F A;  3JRE A;  3JTG A;  4KDP A;  3S14 J;  1U6G A;  4V2F A;  2K9S A;  5B1A H;  1GV5 A;  3EUH C;  2XAF A;  1RC9 A;  4RGS A;  1K4S A;  1FSE A;  2HOE A;  1K6O A;  2P5K A;  1DU0 A;  1X1B A;  3BY6 A;  4O3M A;  3UR3 C;  2P7C B;  1I1G A;  2FMY A;  4DIQ A;  4QIW N;  2AQF A;  2KQR A;  2R4G A;  4MEY F;  1FJL A;  1LB2 A;  1RRJ A;  3BR0 A;  1MIJ A;  4Y7N J;  2R7V A;  4O5V A;  2H1L A;  2IPQ X;  3NAU A;  5HOD A;  2MH9 A;  2QVO A;  2M4G A;  3QPL A;  4A3K J;  1WZ2 A;  2FQ3 A;  5HS8 A;  3VEP A;  3O8G A;  4IHY A;  3R61 A;  3VOE A;  3FXU A;  3OR2 C;  2MGQ A;  1QZE A;  4FE7 A;  1A6Q A;  3K9T A;  3P7N A;  1JE8 A;  4AYB N;  4GGG A;  3J81 K;  3WTS C;  3F8C A;  3M8E A;  2WTE A;  3BQY A;  3CDL A;  3ZMZ A;  5EF6 A;  5AIQ A;  5FLV A;  4B1R A;  1ZG5 A;  3RIR A;  3ABU A;  2WY7 Q;  4A0Z A;  2H1K A;  3OYG A;  3H9G A;  3TO6 A;  4A3L J;  1AOY A;  1NTC A;  3IUO A;  2HEO A;  3HIF A;  3WOD F;  3IL2 A;  5E1X A;  4RAF A;  5IT9 K;  3QYB A;  3E0J B;  5E8G A;  1OR7 A;  1UG2 A;  4V19 K;  4HAM A;  1FNN A;  2VON A;  1YS6 A;  1LJ9 A;  3HOX J;  4AIK A;  3VYT B;  1YI2 I;  4RLF A;  4ASN A;  2ISY A;  2H8W A;  2Y75 A;  2IS1 A;  3CC2 I;  1FP1 D;  2QEN A;  2O03 A;  1U8B A;  2LF8 A;  1EH8 A;  2CG4 A;  1EA3 A;  1RUO A;  1UMQ A;  2X48 A;  2OQG A;  2E36 A;  4WX9 A;  1VQ9 I;  1TNT A;  2E60 A;  3U9G A;  4AID A;  3TMO A;  4PJJ A;  3GTP J;  1D5V A;  4IX7 A;  2LR8 A;  2JPB A;  3A1Y A;  1KU2 A;  3JRG A;  2EPF A;  3OS0 A;  3LL7 A;  4V2G A;  3EDP A;  3DLL F;  4KIF A;  3CUQ C;  4L18 B;  3GTQ J;  4NBQ A;  1ETK A;  2PMZ A;  2XGD A;  3FF5 A;  2AS5 F;  4Y3O A;  1BIB A;  2XVC A;  3CLO A;  5J4V A;  5HNF A;  3SHF A;  3OYK A;  2AXT C;  4DJA A;  3OYL A;  4G6T B;  4I76 A;  1R5H A;  2NVY J;  3CMM A;  1UST A;  3OIQ A;  3S2W A;  5M5X J;  4BEH A;  1OCR H;  5HOO A;  1JUS A;  3QOD A;  5JVT A;  3ZN0 A;  3DU6 A;  2VXZ A;  5B66 C;  1ZAR A;  1TT0 A;  1I50 J;  2QF7 A;  3BRO A;  4A5M A;  1JT0 A;  2XF5 A;  1ZQ3 P;  2E34 A;  3SDB A;  2O8X A;  3W6J B;  1WI9 A;  2F48 A;  3EET A;  3KE2 A;  2XPU A;  1VZ0 A;  2XDV A;  3FIW A;  3CCR I;  4PFP A;  2PN6 A;  2GIZ A;  3S93 A;  1FTT A;  2HTJ A;  2P5L C;  3KP2 A;  2IA1 A;  4N9H A;  4B4C A;  1RET A;  4WK8 F;  1G2H A;  1Z6T A;  4G7H F;  1JKO C;  1WKM A;  2EWN A;  4GO1 A;  1APL C;  4A3C J;  4CXF A;  4AVZ A;  3CC7 I;  5JHF A;  2JSC A;  5FLX Z;  3HBL A;  4HZF A;  2VJ5 A;  2XAU A;  1CF7 B;  4LIU A;  2BGC A;  2Z2S B;  1YE9 A;  4AD9 A;  5HDN A;  1ERD A;  4ESF A;  2FBH A;  1J2X A;  1WGX A;  1ZLJ A;  5J8F A;  3GME A;  3ZMV A;  3TP0 A;  1OYY A;  3HSR A;  3B6C A;  2E1M C;  3SZT A;  2IW5 A;  2HZT A;  3QWL A;  3MKY B;  4CUG A;  3PIP F;  3BCA A;  4JX6 A;  4YIF A;  1SD4 A;  2IA2 A;  4HDV A;  1X1D A;  3GZN B;  4BHC A;  2VPL A;  2D45 A;  3DV8 A;  1VQP I;  3K7A J;  5F64 A;  4AYB A;  3G3Z A;  2OA4 A;  1G6N A;  2LRD A;  1FOY A;  3BZK A;  3L1P A;  2EZL A;  4PJM A;  5FLM J;  4XKC A;  3GX4 X;  2EQR A;  1ZGW A;  2BY2 A;  1UFM A;  3TDZ C;  4RB0 A;  4LMY A;  5J1R A;  4M6X A;  4BQQ A;  1K4T A;  2RKH A;  4CCK A;  1RKT A;  3BR3 A;  1REP C;  6PAX A;  1IW7 F;  4D7N A;  1BJA A;  1NG6 A;  2DQR A;  4N9I A;  2GAU A;  5M5Y J;  3OY9 A;  1JUP A;  5D5U B;  1XSX A;  3NRV A;  2XRO A;  2CUJ A;  3CTA A;  3DLA A;  3FXR A;  5EGO A;  3MZY A;  4RM3 A;  2E1C A;  4CCM A;  3JAM K;  2NAZ A;  3CP8 A;  2IEK A;  3RCO A;  3LSJ A;  3CUQ A;  1EV7 A;  1KQ9 A;  4EM1 A;  2QKM B;  1MMS A;  5K5R A;  2M2E A;  1QBJ A;  3GTM J;  1JUM A;  1IDZ A;  3HOT A;  3FBI B;  2WBM A;  4XN0 A;  4KUM A;  2EIJ H;  2X1D A;  2XB0 X;  2JA6 J;  4UV9 A;  3Q5F A;  1K78 B;  1WJF A;  1ZR4 A;  1LQ1 A;  3MAJ A;  2QYO A;  4I2O A;  2NVU B;  4DBQ A;  1KZH A;  3GUD A;  2V6C A;  3ULQ B;  3QAH A;  2M34 A;  3FMR A;  5L3E A;  3K70 D;  5GAH J;  1TZL A;  1WJC A;  3E3V A;  2ZXW H;  2B63 J;  1MKM A;  3WHB A;  2LK2 A;  2FX0 A;  3DPL C;  1GXP A;  2DTR A;  2K40 A;  4QPO A;  3DKY A;  2ACJ A;  1RIO H;  2ZME A;  1DU6 A;  4BBS J;  1OFC X;  2CQK A;  5ED4 A;  3CC4 I;  2DMU A;  4J00 A;  2R5Y A;  4HV5 A;  2L9V A;  1MMN A;  3I3L A;  4MIM A;  3RKX A;  2C6Y A;  1T0F A;  4E7J A;  4XR6 A;  4BJ5 C;  5L3G A;  2ECC A;  3LSH A;  3QPT A;  1S7E A;  2EH3 A;  5F1R A;  1LEA A;  2M9H A;  3F21 A;  4UB6 C;  1V4R A;  1K6Y A;  1SD7 A;  5HLG A;  2NS7 A;  3WG9 A;  3E6M A;  1D8J A;  1W1W E;  3DXJ F;  1LVK A;  2ME6 A;  5LGN A;  1BI2 A;  2ZB9 A;  2FXA A;  1HOM A;  1IUY A;  4MO7 A;  3SQN A;  1JGG A;  2V9P A;  1LKX A;  3QPS A;  4N4O B;  4W97 A;  1ETY A;  1YO5 C;  3BDD A;  2JJ7 A;  2ADU A;  2MW8 A;  4IVN A;  3H9J A;  1PDN C;  1A6I A;  3H0D A;  3BG5 A;  3ZOB A;  3BR1 A;  3BG9 A;  5JLX A;  2R7S A;  1H89 C;  4IHV A;  1MGT A;  2CRG A;  3HKZ N;  2JMW A;  3HTU A;  4AWX B;  4BXX J;  5CVU A;  4MHG A;  2CUF A;  2F5D A;  2LLK A;  2EK5 A;  1HDD C;  2FA5 A;  2MSY A;  4CSW A;  1ZRD A;  2HDW A;  3K1P A;  2L5Q A;  5EEA A;  1R9T J;  2XRN A;  2M4K A;  2ELH A;  4G6D A;  2V7F A;  1A35 A;  2WB1 N;  5JFR A;  2R7O A;  3GFL A;  1QHG A;  4HBL A;  3BLY A;  1GV2 A;  4PJN A;  3ISP A;  2R5Z B;  4BKX A;  2BW3 A;  1XS9 A;  5CKT A;  5J1U A;  3BP8 A;  5JHU A;  3FXO A;  1RPW A;  5EEG A;  3JSP A;  3C3W A;  1TNS A;  1K78 A;  5BMZ A;  3WG7 H;  3BTL A;  1Z77 A;  3CDH A;  4RS8 A;  3DBL B;  4XRS G;  2GLO A;  3VFZ A;  1JGS A;  2A05 A;  5D4S A;  4GRI A;  4XBF A;  1LEB A;  1I27 A;  3C18 A;  1MBE A;  3F8N A;  1LPQ A;  1OLT A;  2VBY A;  4QLC U;  2ZKZ A;  4F92 B;  1LE8 B;  2EFP A;  4C2T A;  2EV0 A;  4KIS A;  1FOX A;  4S05 A;  1V54 H;  1IN4 A;  2NOJ B;  4G12 A;  1Y0N A;  3WU2 C;  4EM2 A;  3C2H A;  5F0H A;  1NK3 P;  2O9L A;  2E1N A;  1WJE A;  4YEJ A;  2LKS A;  1U9O A;  2CFO A;  1OYI A;  2A6E F;  2GZW A;  2KJC A;  4HG2 A;  4RB3 C;  4C3J J;  1X3Z B;  5B1B H;  4MLO A;  5B5E C;  1QHH D;  2MD0 A;  5IYC J;  1R1U A;  3OYJ A;  2W7N A;  3F72 A;  4AIJ A;  4Z2Y A;  3HL2 A;  2HZD A;  2KIU A;  4Y17 A;  2DW4 A;  1T08 B;  1XD7 A;  4S0H B;  1V5F A;  5IP6 A;  2L7M P;  3GXO A;  1W7P D;  4CZZ A;  5EG0 B;  3BZC A;  1H9T A;  2DT5 A;  1AU7 A;  2W82 A;  1B59 A;  1JHF A;  1YYV A;  5F04 A;  4PJ0 C;  4HDU A;  5IP9 J;  2OZU A;  1I5Z A;  3TL4 X;  2HVS A;  2A69 F;  1ACI A;  3VYS B;  3CZ6 A;  1VQM I;  5FKL A;  4M74 A;  2EV5 A;  1V5E A;  1TT5 B;  1D1A A;  2I5U A;  2KL4 A;  2V1D A;  3M07 A;  5M3F J;  2UWM A;  3BQZ A;  5JLW A;  4EJT A;  1TW2 A;  1IN7 A;  2HYF A;  4W1U A;  2ZC2 A;  1GVD A;  1GLN A;  2OF7 A;  1B9N A;  2K9M A;  2K9Q A;  4LLL A;  2RV8 A;  4B3X A;  1ZGA A;  4DZP A;  1CGP A;  2Z3Y A;  1UB9 A;  3ABM H;  4IRH A;  4XKW A;  4XON A;  2AHQ A;  3RKW A;  1U8R A;  1W5C C;  3JRD A;  4I98 B;  1MDM A;  3LQR A;  3R60 A;  2QM3 A;  3IV5 A;  1LDD A;  2M0C A;  1BI0 A;  1IJW C;  2QUF A;  4AVP A;  4BEH B;  2HTS A;  4BJ6 C;  2DN0 A;  2STT A;  5D8K B;  1RUN A;  2JUC A;  2DA3 A;  1PUF A;  4OAZ A;  1HBX G;  2LSO A;  4EVI A;  2DDB A;  1GT0 C;  5FKO A;  3QPH A;  2MAB A;  3V42 A;  5FB2 A;  2V1U A;  1X1P A;  4I99 C;  3RZD J;  4FX0 A;  2VKV A;  1NH3 A;  5KCM A;  3PIO F;  3Q0U A;  3ECH A;  2DYR H;  1MBG A;  5K7Z A;  1IRG A;  1ZEL A;  2KRC A;  2WC2 A;  4HX4 A;  2BXY A;  5D5X B;  1HST A;  1QZZ A;  4GCV A;  3KEQ A;  4ZDL A;  1B1B A;  2O61 A;  4LK1 F;  3MEX A;  2JSP A;  1X2M A;  4ZZD A;  2KIF A;  4UV8 A;  3M8J A;  1KQ0 A;  1QNT A;  4CCJ A;  4F91 B;  1OIS A;  2L01 A;  3EUA A;  2E7X A;  3HRM A;  2L4A A;  2QQA A;  1SVO A;  3EPZ A;  5C44 J;  2KJB A;  2Y0M A;  2JVH A;  3H36 A;  2WV0 A;  2AXL A;  2QCO A;  4M9X A;  3Q0V A;  1SEU A;  2VBW A;  5LEJ A;  2V9V A;  2F5V A;  3HOU J;  4OIQ F;  2R7Q A;  4XOP A;  1TC3 C;  4MQV A;  3GFJ A;  4AIH A;  2EFQ A;  1IRF A;  5LHG A;  4M3D A;  1OQY A;  4F55 A;  4M9Z A;  2DLL A;  1YJN I;  1ZAO A;  4KYW A;  1YQA A;  2HGC A;  4I02 A;  4P1W A;  2XAJ A;  4U0Y A;  5D4R A;  2DJI A;  5E79 C;  2PJR B;  1VQK I;  2E2H J;  4HSR A;  4XLP F;  1MSE C;  3B02 A;  4B43 A;  2DMQ A;  3ASO H;  2P4W A;  3I4M J;  1B72 A;  1HW2 A;  3L7W A;  5D6F A;  2CQN A;  1ETV A;  4IEJ A;  3LA3 A;  3E7L A;  2Z33 A;  1JKR C;  1JKQ C;  1DUX C;  2R7T A;  1ON2 A;  2Y0S A;  5BNG A;  3MD2 A;  2A6T A;  3BT9 A;  3QP5 A;  3HOZ J;  3L9F A;  1S3J A;  3FXJ A;  4Q4Z F;  2P7V B;  3CP2 A;  4EJV A;  1K83 J;  2ZJR F;  2CO5 A;  3QRF F;  3C1D A;  3GFM A;  3BOQ A;  1X3U A;  4B8X A;  1G59 A;  2F5C A;  2HR3 A;  4M6Y A;  1TTY A;  1MMA A;  1JT6 A;  3RPU A;  3KP4 A;  1AA7 A;  3ZRG A;  1IUF A;  3K69 A;  3PO3 J;  1QRY A;  4XL9 A;  1HQC A;  5J40 A;  2X0L A;  3I53 A;  3EUH A;  2QZ8 A;  3AL0 B;  5H6Q A;  1LFU P;  1AKH B;  3N05 A;  4LLN A;  4ANJ A;  1O4X A;  2Z99 A;  3RKQ A;  1MJA A;  3S1N J;  5FRO A;  2B7E A;  3J80 Z;  2CWE A;  2FNA A;  4PCQ A;  4X6A J;  4M71 A;  4YRV A;  2HKX A;  5FKK A;  3T8T A;  3DEE A;  4BAC A;  3H92 A;  2L02 A;  5DEQ A;  4LJZ F;  3DTE A;  2H94 A;  4A69 C;  3LQQ A;  3CCS I;  4UXN A;  1OCC H;  1ETQ A;  4X0G A;  2K86 A;  4YII A;  4G94 A;  3RQ4 A;  2Y69 H;  3WHC A;  4DYC A;  1ZR2 A;  3S1Q J;  2P6T A;  4WXC A;  4KT6 A;  2E7W A;  1T2K A;  1E3P A;  5K5O A;  2XUB A;  4LK0 F;  4F3Q A;  3HDD A;  3FWE A;  3A0H C;  1TWA J;  2GXB A;  2EJR A;  2R7Z J;  2KDZ A;  2X6O A;  3DEU A;  3LSG A;  1BJZ A;  1IZ1 A;  5IOZ A;  1MBH A;  2W4S A;  5D5W B;  1TLH B;  5CQE A;  4ZC3 A;  4MFE A;  3MWM A;  3O2P E;  2EBI A;  3P9I A;  2WA0 A;  2XPV A;  1MDM B;  4LFU A;  5EJC A;  1FSH A;  5EZH A;  2K5C A;  3HXL A;  3IWZ A;  3WTY C;  3M1E A;  3JRC A;  2R7X A;  1SFK A;  2V6E A;  3M8F A;  1P9Q C;  4YEL A;  5KK1 A;  2JTV A;  3KLO A;  4AUX A;  4IHW A;  2HU9 A;  4FT8 A;  3G73 A;  5LFA A;  3CCY A;  1WJD A;  2L9R A;  4CIC A;  5LGU A;  3AL0 C;  1OR7 C;  2CH0 A;  4UY8 I;  2WWY A;  5ICE A;  4UVB A;  3I9V 2;  3KPH A;  3LSI A;  4L9V A;  1FZP B;  2HFH A;  1SD5 A;  4H0E A;  4IQJ A;  1IO2 A;  2WAQ N;  2MG4 A;  5K7H A;  5TRD A;  4LB5 A;  2D1H A;  3FXK A;  1D8K A;  1MMG A;  4RDU A;  3SJM A;  2JPC A;  2ZME B;  4JQF A;  3K70 C;  3OYC A;  1F4K A;  2Q0O A;  2M8E A;  2BE5 F;  2DA4 A;  5HLT A;  3BCB A;  1IN6 A;  4NC6 A;  1D0Z A;  4ESJ A;  2UZK A;  2IGM A;  2X6Y A;  3I56 I;  2YS9 A;  1QVT A;  3FXQ A;  3BTI A;  4ABZ A;  2IT0 A;  1B9M A;  4BBR J;  4P9U A;  4CO8 A;  4UUS A;  2ISZ A;  2Y30 A;  3DPT A;  1HA8 A;  2K85 A;  2JZY A;  4HQM A;  1QZY A;  4LGW A;  4LB6 B;  3G1L A;  3K4B A;  3BG3 A;  3NWT A;  4J01 A;  3RPQ A;  3QYF A;  3F6O A;  1S72 I;  1BR2 A;  1D0Y A;  1X4O A;  3KZZ A;  4A2U A;  2HXO A;  4NC8 A;  5KHD A;  2D1V A;  3ABL H;  5FGM A;  4OIN F;  5KAI C;  1B8I A;  3KX2 A;  1I3Q J;  1E3H A;  3CUQ B;  4RA2 A;  4LOC A;  5CJ9 A;  1TP4 A;  2QSG X;  2CV1 A;  3K4M A;  3GTK J;  4HV6 A;  1X2N A;  4JP0 A;  3F3X A;  2W84 A;  1X1C A;  4OMZ A;  1J59 A;  4Y15 A;  5E20 A;  4H4K C;  2PMZ N;  1PJR A;  2QGU A;  5DYM A;  2CUE A;  4FAS D;  2K3P A;  1FIA A;  3TO9 A;  4D0P A;  4GYG A;  2YPR A;  2DYS H;  1Z7U A;  1OCZ H;  3FHN A;  5DD4 A;  4HPQ A;  5CVJ A;  2CJJ A;  3DP7 A;  3G1O A;  1SAN A;  4I0A A;  1WWX A;  4PJL A;  3ZQC A;  4B44 A;  1W4M A;  4FTH A;  2L9S A;  2MBF A;  5LHI A;  5E8I A;  4MNU A;  2VOD A;  2VOO A;  1HSJ A;  2YSR A;  3ZMU A;  1WCM J;  3R0A A;  3H3Z A;  3A01 A;  4XLN F;  3ZMT A;  2R7F A;  1KYZ A;  3QOE A;  3HC7 A;  3HUG B;  4B09 A;  1T56 A;  1T98 A;  2VC0 A;  5KNL A;  2OTJ I;  3OYM A;  2CUZ A;  2DK5 A;  2M30 A;  4XRF A;  4G9Y A;  1G3W A;  1LE8 A;  3VPR A;  2DQL A;  2M7A A;  3BTC A;  4KN4 X;  2GXA A;  3IH4 A;  2IRF G;  3LMM A;  1FPQ A;  1XG1 A;  3SEQ A;  3M3Y J;  1IXS B;  1IF1 A;  1FY7 A;  1SFX A;  3KLN A;  1FIP A;  3BG6 A;  2V1N A;  3OOU A;  4CCN A;  5LEK A;  2BVL A;  4HNU A;  3I55 I;  4X1E A;  1Z3Y A;  1U9N A;  1MBK A;  2VQC A;  1SAX A;  2DJN A;  4B3A A;  2GM4 A;  3LAP A;  2EZH A;  3F6V A;  1J09 A;  3D0S A;  1P6R A;  3H5R A;  1MH4 A;  5EGO B;  2K4J A;  4DBR A;  1MJ9 A;  3CCQ I;  3ERE D;  1LVA A;  2E2J J;  3MQ0 A;  1WH5 A;  2LDU A;  3FHZ A;  3W2W A;  4M73 A;  1MND A;  1RES A;  2ZXJ A;  4Z6Y A;  5DS9 A;  3MFK A;  3ZQF A;  1XGS A;  1BOA A;  3D5S C;  3HPH A;  1MW7 A;  2YU9 J;  1XX5 A;  5ILV A;  3GBG A;  1TQP A;  3BZ6 A;  2XKP A;  2STW A;  1R36 A;  5EEH A;  3JRF A;  4A3F J;  3DQV C;  2DFF A;  1I1S A;  4ENN A;  3D1N I;  5J3L A;  3U1D A;  3GEZ A;  4Y4R A;  3L09 A;  5FD5 A;  3PO2 J;  1LFP A;  2NOG A;  2VJ4 A;  4XSX F;  1G4D A;  3I5U A;  5HS7 A;  4YIR X;  5DTD A;  5F1J A;  1KGS A;  2ZNZ A;  4IOC F;  3AFH A;  1IG7 A;  4PGH A;  3FK6 A;  2JA8 J;  4AC0 A;  3FDY A;  3G4S I;  3SZP A;  4U7D A;  2EZI A;  4HW0 A;  4OAY A;  1T8I A;  2E5N A;  3TQN A;  3E6B A;  4ZJZ A;  1WI3 A;  2WY8 Q;  1Y1W J;  3A4C A;  3FZV A;  1GDT A;  2FOK A;  2ZME C;  4L5J A;  2OCE A;  3A03 A;  1NG7 A;  3A01 B;  1RKW A;  2DCE A;  3HOY J;  5DCM B;  2L3D A;  1K7A A;  5M3M J;  2HWV A;  2Q2E B;  1IDY A;  9ANT A;  1W36 D;  4HF1 A;  4ZH4 F;  5J1Y A;  4HOB A;  5FRM A;  3E97 A;  4M9S A;  2VJJ A;  4GYI A;  2UUZ A;  1Y8Q B;  5DM6 F;  2DOE A;  1R7J A;  3K0L A;  3H5A A;  3RTR A;  3E1S A;  2EIM H;  1FTZ A;  3E6C C;  3HGY A;  2R7D A;  3C2B A;  2M3A A;  1O3T A;  4KN7 X;  4M3E A;  4BQA A;  1Z7L A;  1HKQ A;  5IOY A;  2DFH A;  3RQI A;  3BG7 A;  1GHC A;  1R22 A;  1ETW A;  3CCV I;  2K27 A;  1VTN C;  1F36 A;  5EZG A;  3MKL A;  3OS2 A;  4EJU A;  3OV8 A;  2JQ7 A;  4JX5 A;  4XLH A;  3RI4 A;  3PFI A;  1R4N B;  1MZB A;  2DOA A;  3A2K A;  1TWG J;  4XQF A;  4XOR A;  4BDY A;  1QPI A;  5IT3 A;  3CF5 F;  2LVS A;  5DD8 A;  3K1M A;  1KQ8 A;  2IS2 A;  2R7R A;  4ZYD A;  2MC4 A;  2ZFU A;  5FKM A;  1T6S A;  2NVX J;  4JX4 A;  3SEZ A;  2FF4 A;  3U21 A;  3FXM A;  3AG1 H;  2HPM A;  3HOS A;  2Y2Z A;  1QGP A;  4L5I A;  4C9Y A;  2HYG D;  2XC7 A;  2HKO A;  1IRX A;  3WE3 A;  1BI3 A;  3TW7 A;  2ICW G;  4KA4 A;  3HOV J;  1Z05 A;  4KT5 C;  3GTJ J;  3H1C A;  3KIO A;  3KET A;  4B47 A;  1STZ A;  4EM0 B;  4EMS A;  3PUB A;  1ONV A;  1ODD A;  2LFB A;  3NQO A;  3WGH A;  2QA4 I;  2RNJ A;  2VQL A;  1P2F A;  3IP4 B;  3WTV C;  3UKG A;  2OCC H;  5L3B A;  3W2A A;  2VOP A;  3H35 A;  1FMV A;  1ZG3 A;  2IAI A;  4IKF A;  4C2M J;  2ZCW A;  1YW7 A;  2DAO A;  2PMU A;  3GTO J;  4C3H J;  4M3B A;  2DPU A;  3O6B B;  1H8A C;  3ZPL A;  4BNC A;  1YJ9 I;  3H3V K;  4XLC A;  3L2W A;  3E5Q A;  1UAA A;  3ZQG A;  2VPR A;  5FFZ A;  1UG0 A;  2MLK A;  4IF4 A;  2ZXH A;  2PEX A;  1J7K A;  2KT0 A;  3MKZ A;  1ZYR F;  1JKP C;  4E7S A;  1HF0 A;  1BBY A;  1YX5 A;  4QPQ A;  3TBI A;  3ONQ A;  2E1M B;  4P5O A;  1I6X A;  4E6K G;  2WAF A;  2QQ8 A;  2KFD A;  4LLG F;  4A12 A;  3S3N A;  2XIG A;  2GBY A;  3MVP A;  3WTZ A;  3OYD A;  2FD5 A;  1Y39 A;  3PQJ A;  2EFW A;  5DV5 A;  2PFB A;  1PP7 U;  4UB8 C;  1YHQ I;  4XLA A;  4NB5 A;  2FQ4 A;  3OYN A;  1I6H J;  2Y48 A;  2ZSH B;  1IXC A;  2ETH A;  2DBB A;  3PQK A;  4JK1 X;  4ZZL A;  1Q1H A;  2X51 A;  2CS3 A;  2WAD A;  5D8L B;  5GAG J;  2R92 J;  2OZ6 A;  3RDI A;  3QP6 A;  2M0M A;  2W25 A;  3TW6 A;  3WTX C;  4CYC B;  2X1C A;  1N75 A;  3OMY A;  1BOB A;  5BQT A;  3IKT A;  4RAY A;  2HPI A;  4BE0 A;  1F9N A;  3BJ6 A;  1WVR A;  2VE9 A;  1Z3X A;  4CDG A;  1BW6 A;  3U2R A;  1KYW A;  4GFB A;  2M8G X;  4ESB A;  4XRS A;  2Q1Z B;  3KP5 A;  4L5E A;  4U0W A;  2EFN A;  3LSP A;  2HVR A;  2PG4 A;  2V1X A;  1WFX A;  3L2V A;  4N0B A;  3KZI C;  1R5I D;  4EGZ A;  3IWF A;  1S7A A;  1R23 A;  3DFG A;  1P4W A;  3S16 J;  3ELK A;  4JYK A;  2DT7 B;  2GOX B;  3ZXS A;  1FT9 A;  2DMT A;  3OYE A;  2VKH A;  4XMY A;  3LSM A;  2F4M B;  2X6W A;  3S17 J;  3CCE I;  4EJO A;  4CZC A;  1BR4 A;  5J47 A;  2YU3 A;  3O8H A;  1IGN A;  4AM3 A;  4PSX A;  1U5T A;  1HW1 A;  4UUS B;  4UNO A;  2OUM A;  3ZR8 X;  1X58 A;  3ZGK A;  3OOP A;  5FD6 A;  1VQ6 I;  1G8X A;  2I8D A;  1UJ8 A;  4U87 A;  4UUT A;  5JR3 A;  3OYF A;  3BC8 A;  2BXZ A;  3I64 A;  1ZK8 A;  2XB5 A;  3KCC A;  3LST A;  4PGG A;  5F0C A;  1CF7 A;  3M1C A;  1TW3 A;  3RJP A;  4RB2 C;  4RB1 A;  1A36 A;  2JWT A;  3G1M A;  2J5O A;  3WTT C;  3L2U A;  1TL8 A;  2AO9 A;  2OPT A;  2A68 F;  3WGI A;  3HGG A;  2Y0S N;  1JHH A;  4CHU A;  2OAZ A;  2DA2 A;  3KEO A;  1DDN A;  3S1R J;  3I59 B;  2ZSI B;  5ICG A;  1T33 A;  5GAE J;  3K4L A;  1V5G A;  2QSF X;  2X1E A;  3GLX A;  4I6Z A;  3AG2 H;  2DMN A;  5FJ8 J;  3JRH A;  4BYY A;  1MMD A;  4UHT A;  4A0Y A;  4YFK F;  2KZV A;  3DTI A;  1P7I A;  2MD5 A;  5DM7 F;  5CLS A;  1Z6R A;  4PZJ A;  4IHX A;  1VQ7 I;  5K1Y A;  3AKZ A;  1GUU A;  5J6X A;  1HKT A;  3K4N A;  1D3Y A;  4WXD A;  2X6X A;  3MZ8 A;  4BY7 J;  3GO5 A;  5DDG A;  3MN2 A;  4ENK A;  2LKX A;  4IO9 F;  2F5F A;  3R4K A;  5K7F A;  3OYI A;  1FBQ A;  3W6K B;  3WE2 A;  4DNC A;  2DTZ A;  4HNV A;  4G7O F;  4RGX A;  1WJB A;  3KEY A;  4OOI A;  4C3I J;  3DBH B;  1FP2 A;  3ZQQ A;  1T38 A;  3WU0 A;  2QLZ A;  1R49 A;  4A3B J;  4NDL A;  4R79 A;  4RM2 A;  1E2X A;  3ECO A;  1FOW A;  1G3Y A;  3HM5 A;  2ZNY A;  5H6R A;  2XAG A;  3U1K A;  4U7B A;  1X3W B;  2MYS A;  2DA1 A;  1ZLK A;  2JK3 A;  4ZYE A;  4IXA A;  4BL0 B;  5GTI C;  3PSF A;  1YIJ I;  1EJ9 A;  2BY3 A;  2BVM A;  2ZXI A;  2K4B A;  3I4P A;  2MH2 A;  1JI8 A;  1XMX A;  2PBI A;  4L0Z B;  1FEX A;  4BS9 A;  3HPG A;  2FJ1 A;  3H0G J;  1ZRF A;  5HLH A;  4ETS A;  3ABT A;  2VE8 A;  5HNH A;  2P81 A;  1BL0 A;  4BE1 A;  2XGX A;  3TKY A;  2QKL B;  4E7L A;  1VQO I;  3EYI A;  1P4A A;  5D5V B;  3SFI A;  3IRR A;  5LRS A;  3BR5 A;  4NQW A;  4A5N A;  3G2B A;  1NHA A;  2W48 A;  4EJW A;  1MBJ A;  4FCY A;  4IRG A;  2UXX A;  4NQW B;  2Y31 A;  5E1W A;  2XKO A;  4G6Q A;  2JRM A;  3L2R A;  3V7C A;  3HG9 A;  1W7P B;  2FE3 A;  2JA7 J;  1OMI A;  2L7K A;  4OIO F;  2X4H A;  1YTY A;  1FOK A;  2TDX A;  1JTY A;  1T39 A;  1JTX A;  5CVI A;  2VIX A;  2IVM A;  1LUJ B;  5CVV A;  3Q3S A;  2CV0 A;  2WV1 A;  1ZKG A;  4XIC A;  1SFU A;  2RN7 A;  2V26 A;  2R0Q C;  1V55 H;  1OPC A;  3SFZ A;  1W0T A;  3F0C A;  2LOO A;  3X2Q H;  4IL6 C;  1L3L A;  1Y8R B;  2CW8 A;  2FEZ A;  4Y13 A;  1VND A;  3FM3 A;  1Z0X A;  3H9Q A;  4UVC A;  3V8L A;  3E5X A;  3C2G A;  1B4A A;  3DU5 A;  4ITV A;  3PJR A;  2R93 J;  1IAW A;  3PNT A;  3K6G A;  1O7F A;  2V79 A;  4DZJ A;  3GF2 A;  1N78 A;  1YS7 A;  3RKY A;  4CGZ A;  4QSH A;  4U0V A;  2H6B A;  4ON0 A;  2HQN A;  2DK8 A;  4G8X A;  5E3O A;  2O6G E;  2G9W A;  3OR1 C;  1S9H A;  4KIG A;  4BH9 A;  2FNP A;  3IHU A;  2ELJ A;  1YW9 A;  3I71 A;  4ZTF A;  5HDG A;  1S6L A;  1UHS A;  4XNF A;  1KON A;  2E1O A;  2HI3 A;  3T8R A;  4BUP A;  4IOA F;  2EIN H;  2F6C A;  3TO7 A;  3CO7 C;  3DTK A;  4NHJ A;  3ZQL A;  1DGW Y;  1XB4 A;  4BXF A;  3GFI A;  1Z91 A;  4NUB A;  2BY0 A;  1VQ4 I;  5E17 F;  4C2U A;  1USS A;  1H88 C;  4ZYG A;  3MKW B;  1KU3 A;  1T95 A;  5A2Q K;  2OD5 A;  1BN5 A;  2E2I J;  1HXD A;  2RQQ A;  3HHG A;  2IGN A;  3NEU A;  3K4C A;  5ILS A;  3I54 A;  1W0U A;  1FMW A;  1XGM A;  1TWC J;  2OC6 A;  5GTH C;  4OU0 A;  3HOW J;  2Q8K A;  3S3O A;  2IXS A;  1D0X A;  5JVG F;  3RYP A;  1ZHF A;  3BTJ A;  3KP6 A;  1HCR A;  2TCT A;  1G3S A;  2R5Y B;  5E18 F;  4OMY A;  1UZC A;  2BZT A;  1DPU A;  2BBY A;  3NAR A;  1W7P A;  2E5Z A;  3J7A O;  5HVQ C;  1P7J A;  5AON A;  1LFB A;  3TED A;  1TBX A;  2RC4 A;  3Q9S A;  3GZ5 A;  1BC7 C;  2LTP A;  5LD2 C;  1FBU A;  1HW5 A;  2HQA A;  5IY5 H;  3R6S A;  2GQQ A;  3V7S A;  4A3I J;  4UVA A;  2W85 A;  1RI7 A;  3F23 A;  3A02 A;  1IN8 A;  3DKX A;  2XAS A;  2RVC A;  3GW2 A;  1O3R A;  3M4O J;  2QSH X;  5EYR A;  2W1O A;  5CPR B;  3PUF A;  3PNV A;  3ABK H;  3EUK L;  4I01 A;  1OKR A;  3D5L A;  2VI6 A;  4NC7 A;  4XKV A;  2XPW A;  3WTU C;  1MH3 A;  2O0Y A;  2P5V A;  3J80 K;  4R1H A;  1DP3 A;  2KIS A;  4HYE A;  4IZZ A;  2H09 A;  1PYV A;  2CU7 A;  1I3A A;  2LMD A;  3QU6 A;  3CME I;  2DXI A;  3P9K A;  3LAJ A;  4PSW A;  2FSW A;  3PSI A;  1XGN A;  2VL8 A;  3ZQI A;  3HUG A;  1HKS A;  2FOW A;  1ZRE A;  4FX4 A;  2H8R A;  2Z16 A;  4QWQ A;  2OV7 A;  3BJO A;  3LSR A;  3J81 Z;  5D6E A;  4J19 A;  3SYT A;  2VKD A;  4LIT A;  4EAT A;  1YIO A;  1VFC A;  1GVJ A;  3LSK A;  4M3G A;  4MEX F;  5IYD J;  4ZTJ A;  1BI1 A;  1J0R A;  1FWZ A;  2KZG A;  2W57 A;  3FXL A;  3KYC B;  5CQG A;  2LY2 A;  4HX8 A;  4A6D A;  3TOA A;  3L00 A;  4XID A;  3VWB A;  2EA4 A;  4I7H A;  1IXR C;  3LOC A;  3IKV A;  2R5Z A;  3BPV A;  3AG3 H;  1U5T C;  5FLX K;  3V8J A;  2JA2 A;  2XRL A;  2IBD A;  1FYM A;  1WQ2 A;  2D5V A;  5E1Z B;  4QTR A;  3RYR A;  3PFY A;  4YFX F;  4RGU A;  1MNE A;  2JA5 J;  2JN6 A;  3FMQ A;  2JT1 A;  1ITY A;  5DCF A;  3HHH A;  4HF0 A;  4BHP A;  4DYQ A;  1QU3 A;  3H3U A;  2LY9 A;  2K7L A;  2BY1 A;  2OU2 A;  2BV6 A;  3J7A Y;  1G3T A;  2CYY A;  2L4M A;  2DA5 A;  3LNQ A;  3CJR B;  1ETO A;  2G7U A;  2QBY B;  4S04 A;  3OS1 A;  3VDX A;  5IT9 Z;  5H20 A;  2HOT A;  2XSJ C;  4XM3 A;  3OIO A;  2L9N A;  5IP7 J;  3LA7 A;  4IQ4 A;  3WTW C;  1FX7 A;  1X1A A;  2ESH A;  1OCP A;  4CYD A;  5C4J J;  5L3C A;  2XGC A;  1U78 A;  4A6E A;  2HOA A;  3SXY A;  2V4J C;  2VJI A;  3QQA A;  3VSK A;  4E70 A;  1S29 A;  3CMY A;  3GTL J;  1ZGJ A;  4O6J A;  2D2W A;  1MD0 A;  2P6S A;  1KU7 A;  5L3D A;  5TJJ A;  2A5W A;  3QU3 A;  4ZDP A;  3LFU A;  2ZFW A;  3CUO A;  4WCG A;  1D5Y A;  1OJL A;  3ZMS A;  2KIQ A;  4IPA A;  1Z9C A;  4BJT A;  3LWF A;  3Q9V A;  1Q1V A;  3FMS A;  2XAH A;  2BW3 B;  3CF2 A;  3KP3 A;  4F93 B;  1U5T B;  4BQN A;  2IA0 A;  3HRT A;  5DUK A;  4A3M J;  3ERM A;  2OTL I;  1QPM A;  2KHM A;  3AG4 H;  1C0W A;  4KMF A;  1BM9 A;  2LKP A;  4E7I A;  4BE2 A;  5C4X J;  2O7O A;  1PP8 F;  3HSF A;  4HLX A;  3WU1 B;  4M72 A;  3S1M J;  1O7L A;  1SFO J;  1LDJ A;  4P96 A;  1X19 A;  1BR1 A;  3FX3 A;  3F8F A;  2FRH A;  1IV6 A;  4MTD A;  5F0F A;  3EQL F;  2ZBK A;  1HDP A;  5F08 A;  5BS6 A;  2Z1D A;  2ECB A;  2QWW A;  2CW7 A;  5LRR A;  2EA2 A;  1YJW I;  3K4K A;  4OIR F;  2EZK A;  1U3E M;  2DFI A;  1I39 A;  5LGT A;  2KIM A;  2CFX A;  3OL3 A;  5JI6 A;  1J9I A;  1SFE A;  4ZDO A;  4XK4 A;  3E5U A;  3S2H J;  2KMU A;  3TDU C;  2Y9Z A;  1U2W A;  2KPM A;  3GCM A;  4MQ9 F;  3JTH A;  1XC5 A;  3IH3 A;  4A3D J;  4C30 A;  2IS6 A;  4IRI A;  2WB1 A;  2NVQ J;  1RR7 A;  3TP3 A;  3GTG J;  2LYC A;  1WH7 A;  2GIV A;  2X85 A;  3OL4 A;  4FQG A;  4TV7 A;  2PX9 A;  1U0J A;  2VT2 A;  1SMY F;  3PM1 A;  4RAZ A;  1N25 A;  1Y0U A;  3G71 I;  3VSL A;  4BXU A;  4KJZ A;  3OYH A;  3LFK A;  5DUI A;  1S8N A;  2Z9O A;  1YRN A;  2L7Z A;  5DCM A;  4GXO A;  2VQH A;  3S8P A;  1J75 A;  4A3J J;  2FBI A;  5LHH A;  4DYR A;  1LNW A;  1RR8 C;  4P55 A;  2K02 A;  3COA C;  4BDZ A;  2BOL A;  1R00 A;  2HS5 A;  3JR9 A; 
#chains in the Genus database with same CATH homology
 4II2 A;  1WFX A;  3L2V A;  4AU7 A;  4HRI A;  4RMN A;  2WY7 Q;  4II3 A;  2R7T A;  2DT7 B;  2GOX B;  3ZXS A;  3OYE A;  2VKH A;  2Y0S A;  3RSN A;  3OYG A;  3MD2 A;  2A6T A;  4XMY A;  3LSM A;  3H9G A;  2X6W A;  3IUO A;  4CZC A;  1BR4 A;  3CP2 A;  3QYB A;  3E0J B;  1E0E A;  4PSX A;  2OUM A;  3ZR8 X;  1G59 A;  2KDO A;  3VYT B;  2GOM A;  3ZGK A;  1MMA A;  1G8X A;  2I8D A;  4U87 A;  3OYF A;  1AA7 A;  3BC8 A;  3ZRG A;  4RLF A;  2IS1 A;  4XL9 A;  2LY1 A;  1Z21 A;  3M1C A;  3AL0 B;  1EA3 A;  3N05 A;  4ANJ A;  2PJR A;  1N77 A;  3L2U A;  2CV2 A;  2E60 A;  2LC2 A;  3TMO A;  5FRO A;  1DGR M;  4PJJ A;  1D1C A;  4IX7 A;  3A1Y A;  4YRV A;  3OS0 A;  3LL7 A;  3DEE A;  4BAC A;  2ZSI B;  2KLO A;  3D5R C;  3DTE A;  2RRE A;  2PMZ A;  3K4L A;  4X0G A;  4Y3O A;  4F52 A;  1V5G A;  3RQ4 A;  2X1E A;  5HNF A;  3IAS 2;  3OYK A;  4KT6 A;  4DJA A;  3OYL A;  4G6T B;  4F3Q A;  2M7B A;  1MMD A;  3CMM A;  2KZV A;  3DTI A;  3OIQ A;  2JUG A;  3LSG A;  4BEH A;  2W4S A;  3AKZ A;  4PFO A;  5HOO A;  5CQE A;  4ZC3 A;  3F9K A;  3QOD A;  3DU6 A;  2WA0 A;  2VXZ A;  1TT0 A;  3K4N A;  2XF5 A;  2K5C A;  3SDB A;  2X6X A;  3HXL A;  1W36 C;  2R7X A;  2VLA A;  1SFK A;  4LIV A;  2VXD A;  1VZ0 A;  2V6E A;  3OYI A;  2XDV A;  1P9Q C;  4PFP A;  4YEL A;  3S93 A;  1WJB A;  2HU9 A;  3KEY A;  2WAQ A;  1LDK B;  1WJD A;  3ZQQ A;  3CES A;  5LFA A;  3AL0 C;  1OR7 C;  2CH0 A;  3I9V 2;  3LSI A;  4JOM A;  3HKZ A;  4R79 A;  4RM2 A;  4IQJ A;  2HVQ A;  2FUG 2;  4NNJ A;  1MMG A;  4U7B A;  2V9K A;  4AVZ A;  5JHF A;  2L2O A;  2MYS A;  4JQF A;  4E7Z A;  3K70 C;  3OYC A;  2VJ5 A;  2XAU A;  5HLT A;  4LG3 A;  2Z2S B;  4LIU A;  1YE9 A;  4BL0 B;  1ERD A;  3PSF A;  3BCB A;  2BVM A;  2ZXI A;  1D0Z A;  1JI8 A;  2IGM A;  2X6Y A;  3MKY B;  2E1M C;  2R7U A;  4BS9 A;  2K9L A;  3HPG A;  4CUG A;  2IGK A;  3BCA A;  3DPT A;  1HA8 A;  4XOT A;  5HNH A;  2IGO A;  4BE1 A;  2QKL B;  4E7L A;  1X1D A;  2LRE A;  3K4B A;  3NWT A;  4J01 A;  2VPL A;  3QYF A;  4CH7 A;  2LBF B;  1BR2 A;  4AYB A;  3G2B A;  1D0Y A;  2LRD A;  1X4O A;  3H5N A;  2VAS A;  4PJM A;  4NC8 A;  5KHD A;  4NQW B;  1WJ5 A;  4XKC A;  1T0F C;  3S3M A;  4XN3 A;  3IAM 2;  4XLF A;  3ZCO A;  3KX2 A;  2W00 A;  3L2R A;  3HG9 A;  2CV1 A;  3K4M A;  4BQQ A;  2L7K A;  4CCK A;  2P0W A;  3OYB A;  1X1C A;  4D1Q A;  2O5R A;  2VIX A;  4H4K C;  1NG6 A;  1PJR A;  4FAS D;  1Y6I A;  2CV0 A;  3OY9 A;  2K3P A;  3KYL A;  1D1B A;  2CUJ A;  4CCL A;  2V26 A;  3DLA A;  4RM3 A;  1DQU A;  4BU2 A;  4CCM A;  3CP8 A;  2LOO A;  3RCO A;  1X4P A;  3FHN A;  2CW8 A;  4HPQ A;  2IS4 A;  2F4I A;  2QKM B;  3H9Q A;  3C2G A;  3DU5 A;  3HOT A;  4PJL A;  3FBI B;  4ITV A;  3RPU D;  2WBM A;  2L9S A;  4B44 A;  3PJR A;  4XN0 A;  3PNT A;  3K6G A;  1N78 A;  2X1D A;  2LBF A;  3OR1 C;  1S9H A;  1WJF A;  3L2Q A;  3DPU A;  3K10 A;  3QOE A;  2ELJ A;  4DBQ A;  2VB6 A;  4ZTF A;  4PK4 A;  2KRH A;  4XNF A;  3HC7 A;  1KON A;  3HUG B;  4B48 A;  4BUP A;  3S32 A;  5KNL A;  2F6C A;  3K70 D;  3OYM A;  2CUZ A;  3DTK A;  1TZL A;  1WJC A;  1DGW Y;  4BXF A;  2M7A A;  4NUB A;  3LMM A;  4C2U A;  3DPL C;  3MMY B;  3SEQ A;  4QPO A;  4KIT B;  3DKY A;  2MFZ A;  3MKW B;  1T95 A;  3BG6 A;  2V1N A;  3OOU A;  4CCN A;  4J00 A;  2BVL A;  4HNU A;  3I3L A;  1MMN A;  4PUS A;  2RQQ A;  1Z3Y A;  2VQC A;  4E7J A;  4FET A;  4XR6 A;  2IGN A;  3K4C A;  4BJ5 C;  3LSH A;  1J09 A;  3H5R A;  4CA0 A;  1FMW A;  4HST A;  3OWT A;  4DBR A;  2OC6 A;  2VQG A;  3S3O A;  2IXS A;  5FRN A;  1K6Y A;  1D0X A;  3PNY A;  3K4J A;  4HNT A;  2WAE A;  4XLE A;  3W2W A;  1LVK A;  1MND A;  2DT6 A;  2E5Z A;  5HVQ C;  4E7H A;  3HPH A;  3D5S C;  5LD2 C;  1LKX A;  4N4O B;  1MW7 A;  2HQA A;  2LG4 A;  3GBG A;  3UNG C;  3DQV C;  3H9J A;  3DKX A;  4D9J A;  4BGD A;  3H0D A;  4Y4R A;  1LFP A;  2W1O A;  3OIP A;  5CPR B;  3PNV A;  3EUK L;  2VJ4 A;  3D5L A;  2R7S A;  4NC7 A;  4XKV A;  3OYA A;  3AFH A;  2JVG A;  4CSW A;  3W3C A;  2HDW A;  3FDY A;  2L5Q A;  2RNG A;  1R6R A;  1DP3 A;  2M4K A;  4IZZ A;  2V7F A;  1PYV A;  2DXI A;  4OAY A;  2R7O A;  1QHG A;  2E5N A;  4E7K A;  4PSW A;  3BLY A;  3PSI A;  3SZG A;  2WY8 Q;  4CCO A;  4ZJZ A;  2VL8 A;  3NWS A;  4PJN A;  3A4C A;  4DGW B;  2Z16 A;  2OV7 A;  2BW3 A;  5CKT A;  2XF7 A;  3SYT A;  2VKD A;  1NG7 A;  4RLQ A;  2DCE A;  4LIT A;  2KP6 A;  4EAT A;  3LSK A;  3VYU B;  2Q2E B;  4ZTJ A;  1W36 D;  5CQG A;  2LY2 A;  5FRM A;  4OWR B;  4GRI A;  3VWB A;  2UV1 A;  2VJJ A;  2UUZ A;  4N4N B;  1OLT A;  2R7W A;  3H5A A;  3RTR A;  3E1S A;  4F92 B;  4E4H A;  2JA2 A;  4XKB A;  2M3A A;  4C2T A;  4KIS A;  1Z7L A;  2NOJ B;  3PFY A;  3C2H A;  1WJA A;  1MNE A;  3BG7 A;  1WJE A;  4YEJ A;  2CFO A;  4HG2 A;  3OS2 A;  4ZYA A;  1QU3 A;  4XLH A;  3A2K A;  2DOA A;  2AQE A;  4MLO A;  1QHH D;  2MD0 A;  4XQF A;  4XOR A;  3J7A Y;  4BDY A;  3OYJ A;  2W7N A;  3CJR B;  3HL2 A;  3OS1 A;  2HZD A;  3VDX A;  2IS2 A;  2R7R A;  2XSJ C;  4XM3 A;  4BQO A;  2MC4 A;  1V5F A;  2L9N A;  2ZFU A;  2HNH A;  4IQ4 A;  1X1A A;  3SEZ A;  3U21 A;  2W82 A;  2HPM A;  3HOS A;  2CMP A;  4C9Y A;  2HVS A;  3TL4 X;  2V4J C;  2VJI A;  2XC7 A;  3VSK A;  3VYS B;  1IRX A;  3CZ6 A;  2A5W A;  4ZDP A;  3LFU A;  1V5E A;  1D1A A;  2KL4 A;  3FBN B;  2UWM A;  4B47 A;  4Y33 A;  3PUB A;  3FKJ A;  4BJT A;  1GLN A;  1Y56 A;  3QYE A;  2K9M A;  2XF6 A;  2VQL A;  2BW3 B;  3CF2 A;  4B3X A;  3IP4 B;  4F93 B;  4BQN A;  3DWL E;  2KHM A;  4XKW A;  4XON A;  3W2A A;  4DOZ A;  4BE2 A;  4E7I A;  3H35 A;  1FMV A;  4IKF A;  3CJQ B;  3VYR B;  1UEL B;  3W2V A;  1YX3 A;  2LH9 A;  4BEH B;  1X19 A;  4BJ6 C;  1SAU A;  1BR1 A;  4OAZ A;  4XLC A;  3L2W A;  1UAA A;  2MAB A;  3V42 A;  2Z1D A;  4HEA 2;  1UG0 A;  2CW7 A;  2ZXH A;  3MKZ A;  5TGT A;  3K4K A;  4E7S A;  1YX5 A;  4QPQ A;  3PL8 A;  3TBI A;  3OL3 A;  5KCM A;  3ONQ A;  4ZDO A;  2E1M B;  4P5O A;  4E6K G;  2WAF A;  3EUH C;  1ZEL A;  2KMU A;  2KRC A;  3S3N A;  4ZDL A;  2KPM A;  3OYD A;  1X1B A;  2JSP A;  3UR3 C;  4DIQ A;  3M8J A;  2AQF A;  4C30 A;  2KQR A;  4CCJ A;  2R4G A;  4F91 B;  2IS6 A;  3EUA A;  4XLA A;  2WB1 A;  3OYN A;  3EPZ A;  2JVH A;  2LYC A;  2R7V A;  2X85 A;  2ZSH B;  3OL4 A;  1U0J A;  2F5V A;  2X51 A;  2CS3 A;  2WAD A;  2R7Q A;  2M4G A;  4KJZ A;  4XOP A;  3VSL A;  3OYH A;  2M0M A;  2X1C A;  1N75 A;  3OMY A;  1BOB A;  4F55 A;  2HPI A;  3OR2 C;  4BE0 A;  2VQH A;  3S8P A;  1Z3X A;  4P1W A;  2DJI A;  2PJR B;  4BDZ A;  2BOL A;  4HSR A;  2Q1Z B;  2HVR A;  4B43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...