2MC4A

The solution structure of the c-terminal domain of bldd from streptomyces coelicolor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
MEPPPKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAVASHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the C-terminal domain of BldD from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
molecule keywords DNA binding protein
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mc4A00
4OAZA 5KHDA 2MC4A 4OAYA
chains in the Genus database with same CATH superfamily
2MD5A 3RKWA 1X1BA 4LG0A 4YEJA 3S15J 1R71A 4B3XA 1FIAA 3HOSA 2DYRH 3WHCA 3S1QJ 5DD4A 3WG7H 3EETA 1I6HJ 3UR3C 1IXCA 1JUPA 5IYBJ 5GAEJ 3F8BA 1S7EA 4GYIA 1V54H 1I50J 5J8FA 2DT6A 4NDLA 4Z6YA 2D2WA 4M9SA 4NC6A 3B73A 3S14J 2QZ8A 3OL4A 3RPUD 2ISZA 4HA8A 2JZYA 2CUZA 2IGNA 1D1CA 4AD9A 4HLYA 4BXUA 2Y30A 2EQRA 3LSTA 2HOAA 4C9YA 3CDHA 2VXDA 2ZJRF 2Y31A 3BZCA 1P4XA 3RPQA 2E2IJ 2JT1A 2VOPA 3ZMSA 1LFBA 4IRHA 5HS8A 3FISA 4BACA 3S3NA 1W5SA 3HDDA 1RNLA 1WFXA 2EJRA 3OYJA 1TZLA 1XGSA 2HPMA 2WY7Q 5JHUA 3RCOA 3S8PA 3HL2A 2DW4A 2ZXWH 1ETVA 3TMOA 1HXDA 2LD5A 1B72B 1AKHA 2TCTA 4BBSJ 2E35A 4PJ0C 1XG1A 5FRMA 4RDUA 4AUXA 5K7ZA 3GLLA 1TW2A 2A05A 3LSRA 3PFYA 3OIOA 3L2WA 3HGYA 5JLXA 2PMZA 2HTJA 2M45A 3ECHA 2Y69H 3G1OA 4DNCA 2MABA 3FXQA 1T6SA 3IH2A 3OYDA 3OYLA 4LIVA 3BJ6A 3FHNA 2HZTA 4D5CA 3OYBA 2L5QA 3FX3A 1TQPA 5HS7A 4ZH4F 1RZ4A 3G2BA 4IO9F 3A1YA 1AOYA 3OS0A 4LD5A 2EV6A 4AM3A 3I55I 1U2WA 2QGUA 1JE8A 1HDPA 5GTHC 2L7MP 3I5UA 2VODA 4MQVA 1BI0A 5FRNA 3HUGA 4XN3A 1HW2A 2LY2A 5LD2C 4DW6A 3LSGA 3PJRA 1MNDA 2PMHA 1D1BA 2QCOA 1OCOH 3FXLA 3H9JA 3W3CA 3HYIA 2IRFG 3FBNB 4IOAF 4ABZA 3PNTA 5CLSA 4PGGA 3BPVA 3I4PA 4XMYA 4Y52J 1PDNC 2DA3A 5IPAA 3JRIA 4YELA 5LGUA 4B48A 4AIKA 1YYVA 1MSFC 1AHDP 3I71A 5EZGA 1QHHD 3CJRB 2O3FA 1VTNC 2E19A 2DU9A 1QQIA 2DDBA 2F5VA 4YRVA 5F08A 3Q3SA 2CFXA 5JVGF 5C4XJ 3CJTB 4XICA 3H92A 3VDXA 5JLWA 2DOFA 2QF7A 1IO2A 3ZQGA 3TP3A 4A3FJ 2OZ6A 2QQ9A 1J9IA 2BEOA 3CQZJ 4U88A 3BOQA 2R5YA 4HSTA 3ZRGA 2XGEA 5AONA 2DPDA 2IS6A 1SVLA 4RMNA 2E34A 1ETYA 3C3WA 4XKVA 5BPIA 2ME0A 3SFZA 3QOPA 1ON2A 2V1XA 4HOBA 4M6XA 2CRGA 3E97A 1RI7A 2VB6A 5C4JJ 3L1PA 1MBJA 5F0FA 1JXSA 3PUFA 4BJTA 4JP0A 4R8HA 5IT3A 2CYYA 4RAGA 3LA2A 1NHAA 4KJZA 2VKHA 1Y1WJ 2BXYA 3FM5A 4XRSA 1B8IB 3WGGA 3WE3A 3CJNA 4G7HF 2W4SA 2H27A 1Z77A 2HVSA 3L2CA 4C3IJ 2IGOA 5F0CA 1OMIA 1HSTA 1Z05A 2GXBA 3FIWA 3E6MA 3BDDA 2HYFA 5GP9A 1X19A 1JUMA 1U9NA 4A0XA 2BGCA 2XF5A 3DKWA 1S3JA 1MBHA 2F48A 4X0GA 1P2FA 2XGDA 2M87A 5E79C 4HRIA 1RIOH 5E1XA 3LWFA 3NARA 4PZJA 4BHBA 1V5GA 2A6EF 2DK8A 3QODA 4D5FA 2D1VA 2R7FA 4A0ZA 2K4JA 4YIRX 2XAUA 4DZJA 4QSHA 3F8MA 4RB1A 1LE8B 4UV8A 2Z5UA 4Q5SF 4ESFA 4BJ5C 1ZN2A 1ONVA 1AA7A 1Y0UA 2JWTA 3LSIA 3JSPA 3GZNB 3U21A 2CQ7A 4ZYEA 2JSPA 1XMXA 2RDPA 5ICCA 1GVJA 2VC1A 4HQEA 3TQNA 3HTUA 2STTA 3K2ZA 4Y13A 3JAMZ 2X51A 4G9YA 2ZXIA 3CMAI 1XDSA 4MO7A 4M73A 1FOKA 3QP5A 1IUYA 1ZLJA 4M3DA 2BOLA 2LREA 3W2VA 1D8JA 1XX5A 2HXIA 1HBXG 1FLIA 2Q8KA 2E1OA 4LFUA 3F72A 3ZN1A 2VN2A 1MDMB 2IA1A 4QPQA 4UUTA 2VPRA 4FISA 1Y8RB 2ZNZA 1SFKA 3IP4B 5J8CA 2RREA 3QWLA 1OYWA 5HLHA 1GLNA 2DFIA 2XKOA 5D5UB 1AWCA 1U5TB 3HIFA 3V8LA 4LB6B 4XLCA 2RNJA 5EYRA 4CCOA 2HYJA 3IHUA 2O61A 3KCCA 4AVZA 4PDKA 2XAFA 3S3MA 3PUBA 2H94A 2X48A 4EJTA 3ZQ7A 1MBEA 2XAJA 3HOUJ 2JPCA 2LK2A 3KIOA 3RYRA 2LTPA 2ECCA 1HOMA 5HNFA 2X4HA 5BQTA 1POGA 2M0MA 3HPHA 2LKPA 3IAM2 5J6XA 1HLVA 5EGOA 2BHYA 4QPOA 3OMYA 1ZG1A 1Z0XA 2ZFWA 4RGUA 1A36A 3GUDA 4M9ZA 4XL9A 1VQ5I 1CF7B 2GIVA 2V6CA 3P9CA 3S32A 5LEKA 2IT0A 5IYDJ 1W7PB 2OBPA 3W6VA 4HDVA 1SVOA 2JVGA 3T8RA 5LHGA 5DUIA 4RLQA 4OIQF 2IJLA 4HEA2 1T38A 4CCNA 2CSOA 3ZQHA 1LEAA 1I3QJ 2CO5A 3SDBA 1FMWA 3ABLH 1BBYA 2JA6J 1YS6A 3G71I 2LP0A 2WB1A 2WAQA 1PVEA 1TP4A 2MGQA 4Y17A 4EATA 2Q2EA 2CH0A 1U0JA 2VC0A 4CSWA 3ZXSA 4EV0A 3E6CC 2EIJH 4RM2A 1E3HA 5KNLA 1QZZA 4LJZF 2DA1A 2R3SA 2W57A 3S1MJ 3HRTA 5BMZA 1F1ZA 2UV1A 2D45A 3HZJA 1D5VA 2JVHA 3MKZA 1T0FA 2Q0OA 3DTEA 1HC8A 1DGRM 2EFWA 1UB9A 1ZKGA 3CCRI 2CW7A 2L3DA 4HV5A 1K7AA 2P81A 4BHCA 1BJAA 1IV6A 4LLLA 1P4WA 3WGIA 3LSMA 3H5RA 2LVSA 1G6NA 1FYLA 3FBIB 4PSWA 3TBIA 4OIRF 1FOWA 3CP2A 1SANA 2L9VA 4RB0A 1EV7A 3ZP5A 3L00A 4BE0A 3WU2C 3BCAA 2HOTA 1TW3A 3H5NA 2LR8A 1ORKA 4AIHA 3J7AO 3HSRA 1X3ZB 3VEPA 2XKPA 3TP0A 3CC7I 2V9KA 2P7CB 2HDDA 1FJLA 1IAWA 1Z21A 4WXCA 2PBIA 2Y0MA 2P5KA 5BPDA 5TGTA 3G1MA 4NB5A 2OC6A 1Y8QB 2M30A 3ONQA 4JK1X 2OQRA 3OYFA 1FBQA 2MBFA 4N4OB 2QQ8A 1K6OA 2FNPA 2RNGA 3GW2A 4L9NA 4XRSG 4XORA 1MZBA 1YE9A 2W84A 3WG9A 3K4MA 4WK8F 4JQFA 1GUUA 3AG3H 3PQKA 2LMDA 2HI3A 3K69A 2E5NA 4HDUA 4DYCA 3GTJJ 2OCCH 1TQIA 3H3VK 2MW8A 1OKRA 3DEUA 1OR7C 4U0WA 3KZYA 4XBFA 2DQLA 3ROUA 2HVRA 2XPVA 1MIJA 3HJEA 4XN0A 4BY7J 3PIPF 3BPXA 4EMSA 4W1UA 5CQEA 4FX0A 2IEKA 5K5OA 3LSKA 2L4MA 3K4CA 4BAYA 1CQTA 5LGTA 4BDYA 2EB7A 1OJLA 2PMUA 2EFQA 4OWRB 3JW4A 4XIDA 3QPSA 1JT0A 1KQ0A 2RN7A 2TRTA 5J1YA 1TWHJ 4IPAA 4Z2YA 2M4KA 2CV0A 1S6LA 3HM5A 5K7FA 4XOTA 3OYIA 2O0YA 2GXGA 2F4MB 2DJIA 2EA4A 3GMEA 5L3FA 3O6BB 2E60A 4CCMA 2H6BA 5J40A 4B09A 4XQFA 5L3BA 4MEXF 2TDXA 1PUFA 1WH5A 4DBRA 5IP9J 3ASNH 1XPXA 1P6RA 2HQRA 4Y15A 5FFXA 3V7CA 1SD7A 2NNYA 1RUOA 4LIUA 3A0BC 2DJNA 4D9JA 2DODA 2K4BA 2KT0A 4F7ZA 5HODA 3QP6A 4KIFA 3BR1A 5ICEA 3K4KA 3ESWB 4II2A 1O4XA 3WTUC 4P96A 5CJ9A 4RGRA 1BIAA 1SAXA 3EYIA 1JT6A 5TRDA 4RAZA 3HOWJ 4L0YB 4D0PA 5M5WJ 3P5JA 1LFUP 2VASA 3RI4A 5E17F 5EEAA 2DBBA 2P6SA 1VQLI 1ZREA 3SZPA 2V9VA 3RTRA 1KONA 3C18A 3ERED 1S72I 3O8GA 2AHQA 2KIUA 2NVQJ 1PJRA 4A6DA 2BY2A 4HG2A 6PAXA 4B47A 1V3FA 5IOZA 2ZXHA 4GDFA 4QIWN 1KYWA 3SZGA 1RKWA 1APLC 3DTIA 2X85A 5LRRA 4EGZA 1ZTRA 4F91B 1GV2A 2R7RA 2QLZA 3E5UA 5BOXA 4E7SA 4BXFA 4WF2A 2CW8A 1BI2A 4KNYA 4A5MA 1A6QA 2KIMA 2HU9A 4EGYA 3ML6A 1BJZA 1YJNI 4M6VA 5DCFA 5ILSA 5JR3A 1I3AA 2L9SA 3EDPA 5FKLA 5KCMA 4XKBA 3PO2J 1G3TA 5LHHA 2XAHA 1QPIA 5EDNA 4IQJA 1BW6A 1EH7A 3IWFA 3QQAA 2Y2ZA 3M8EA 2X0LA 5LHIA 1ZRFA 2HDCA 4CXFA 3IAS2 5C3EJ 4IRIA 3H35A 3FXUA 2Y0SA 1W5TA 2DFEA 3T5XA 4HX7A 3ZMZA 2BYVE 4CA0A 1JGGA 3ABTA 2Y75A 5F27A 1D0XA 3N97A 3OYNA 3CC2I 1X1PA 2PMZN 3OYAA 2F5EA 4M74A 5E3NA 3A03A 2JN6A 2ID3A 1TTYA 2MC4A 3C1DA 3GZ5A 3QU3A 1OFCX 3S2WA 2M7AA 3ZMUA 3I3LA 2O5RA 3D0SA 2GWRA 2HR3A 1REPC 4G8XA 4ZDOA 2ELJA 2EA2A 2X9DA 4M3EA 2A5WA 4F93B 1IRXA 1W1WE 3FXKA 2DN0A 3CMMA 3VPRA 4AWXB 2CUFA 1PYVA 2ESHA 2R7QA 5GAGJ 3TOBA 2FA5A 2NVXJ 2K40A 1O3SA 2ELKA 1R6RA 2NOGA 4Y3OA 4RBOA 5CPRB 3V42A 2ZMEB 1ETQA 3RKYA 4ASNA 1YIJI 1XN7A 4XR6A 4M6YA 4L18B 3JSOA 5D8KB 2P5LC 3MD2A 2XRNA 4AC0A 3LSHA 2G7HA 2CQNA 1FOXA 3SEZA 3OYGA 3TEDA 2DOEA 1G2HA 3FMSA 1I39A 2FU4A 4ENKA 2JJ7A 2PLYA 3WODF 2E2JJ 5B3SH 5EZHA 3ERMA 2XV4S 1RKTA 2ECBA 3D5SC 1VF9A 2JA2A 3CJQB 5DCMB 3L2QA 1MMSA 1Z6TA 3D1NI 2CV2A 3GTKJ 3OYEA 4I7HA 4IEJA 3Q0VA 2Y9YA 2BE5F 4QTRA 3LAPA 2IPQX 1UG0A 2K02A 2LBFB 3TL4X 3P9KA 3MFKA 3CESA 1X4PA 4BH9A 1B72A 1YO5C 2BW3A 4NNJA 3WTTC 2L54A 3GFIA 1H89C 1U3EM 2O03A 1X4OA 4Y33A 1P9QC 4MEYF 1LNWA 3ISPA 3EYYA 2ICWG 3CTAA 1D8KA 1Q1VA 2LFBA 1QZYA 3GBGA 1ACIA 1QNTA 1JJ8C 1ZRDA 1KU3A 4D1QA 4PK4A 4H0EA 4FX4A 2I10A 3LFKA 3WTXC 3CLOA 1FSEA 3HTSB 2CMPA 1Z67A 4NC7A 3CCJI 1J5YA 2L01A 1NTCA 1UHSA 4GFBA 3F23A 3G4SI 4OOIA 2WB1N 4GGGA 1V4RA 3KEOA 3SZTA 2PFBA 4CYCB 1MW7A 3FKIJ 5D5XB 3DQVC 3RZDJ 1X2NA 2Z16A 4JOMA 1ERDA 1N25A 4C2UA 2WV0A 3AKZA 1M1EB 3GTGJ 2KHMA 2O7OA 3CF5F 4IX7A 5FLMJ 1GVDA 4A3MJ 4RA2A 2MFZA 3KX2A 1LDDA 1DDNA 1BW5A 2M2EA 2EPFA 1VQKI 4Q48A 2NS0A 2O6GE 3PNVA 3J80K 3S93A 2V7FA 2DXIA 1ETKA 4OMYA 1OYYA 1IC8A 1LVKA 2X6YA 3W6KB 3JREA 2A3SA 5FD6A 1RR7A 2IS1A 3IKVA 1WVRA 3I4MJ 2FMYA 3E0JB 4U0VA 2OCEA 2ZO4A 1U8BA 2VJJA 4I0AA 4XRMA 3HOYJ 2JA8J 3MVPA 2X6XA 2LY1A 1Q1HA 1KU2A 1N75A 2K9LA 3MN2A 3ABUA 1BN5A 3FXJA 1IJWC 1EF4A 2RKHA 4FE4A 5D6FA 2X1DA 3GFJA 4HPQA 4AIJA 3RQ4A 2WBMA 4A3LJ 3KZZA 4ZDLA 1ETXA 1XMKA 2ZJQF 2CV1A 3F22A 4V2FA 5E3LA 2COBA 4DBQA 2VKDA 1XCBA 3P9IA 2G0EA 4BUPA 4BKXA 3OOUA 1ZH5A 3NAUA 3CDIA 1Y1VJ 4RGSA 3EUKL 1R58A 1V55H 4EVIA 2QWWA 5M5XJ 3QPLA 2ZSHB 2FMLA 3BJOA 4XLFA 5E3MA 5C44J 4N0BA 2JUCA 2E71A 3E6BA 5IP6A 2GLOA 1YS7A 3ABMH 1S8NA 2KRHA 3ZQCA 3N4MA 1QHGA 3BG5A 3LA7A 3J7YJ 1L0OC 2A6HF 4A3JJ 4ENNA 2JSCA 4HBLA 3WGHA 4YG2F 4RLFA 5HDKA 4ENMA 3KP6A 1HDDC 3SXYA 3DLLF 1B4AA 5A2QZ 4UY8I 4RB3C 3EPZA 1IRFA 2XDVA 4CCJA 1S29A 3DBRB 1EJ9A 3WU1B 4FQGA 3KETA 4KISA 3CCYA 3U9GA 2AQEA 3L2RA 5ILUA 1G3YA 4I98B 4JX4A 3NQOA 3QU6A 3U2RA 1P7IA 1QPMA 2VUMJ 1Z7UA 3C2HA 4XLPF 4RB2C 1YX3A 1DU6A 2D1HA 2V1UA 3GYHX 1XC5A 3LFUA 5IOYA 4CYCA 1A5JA 4KT6A 1W7PA 1MH4A 1JTXA 2PQ8A 3KP4A 4ZDPA 1G4DA 2GOMA 4I2OA 1PUFB 1SFEA 4MGRA 2I5UA 5H6RA 3JRGA 1IN4A 2M8GX 4HV6A 3OWTA 2PX9A 3HB9A 1IW7F 1QO0D 4LLGF 1QZEA 3K4JA 1QU3A 3SHFA 2F5DA 3LL7A 3IKTA 3PO3J 2JA5J 2KZGA 2VOOA 1YITI 3H9QA 3MMYB 1A35A 2DFHA 3WE2A 1YFHA 2PEXA 3WTSC 2EWNA 2BVMA 5AIQA 1O7FA 3ZQLA 4FETA 2HPIA 3EUHC 2W7NA 4FT8A 1H9TA 2M4GA 4LGWA 4BQNA 1FTZA 1O57A 5HDNA 2R92J 3T1BA 3DF8A 4WCGA 5JI6A 4E7LA 1JKOC 4BNCA 2HZDA 2BXZA 4KUMA 1STZA 1UHMA 2FBKA 2YSRA 4P1WA 2IS4A 2PI0A 2XC7A 2FXAA 4MTDA 2OTLI 4M9XA 3BG9A 3CCQI 1IF1A 1MJBA 3HSEA 5F64A 3NRVA 1HCRA 1FEXA 4I6ZA 5K5RA 4KMUX 2CGPA 4C3JJ 3ZR8X 1ZR2A 1Y6IA 2O8XA 5FFZA 3ZMTA 3IL2A 2GXAA 1OQYA 1WPKA 4LB5A 2XPWA 2XRLA 3RSNA 3CUQB 4A12A 4HF2A 3KZIC 2K3PA 3M9AA 2X1CA 3QYFA 2RAEA 1TL8A 3LSJA 1XGMA 3TO9A 3BR6A 4AYBA 1OCPA 3JRCA 3SFIA 1K79A 4G7ZF 3R60A 3SEQA 2VBZA 1ETOA 2XGXA 5E18F 5K7HA 4DIQA 4ZZDA 1T98A 2KLOA 4NC8A 4U0YA 3K9TA 2M5WA 4HNVA 5F1RA 5CKTA 3OR1C 2DT7B 1KZHA 3F21A 5M3FJ 1SMYF 4G7OF 4L9JA 4A0YA 2VT2A 1R5GA 2VIXA 2L9RA 2P5VA 2WAEA 1D5YA 3MZ8A 5KHDA 2BBYA 5EG0A 1SC7A 2EIKH 4FTHA 1F5TA 4N9IA 3MKWB 5EG0B 2QVOA 5E1WA 4I0BA 3H3UA 1E3OC 1FOYA 2VI6A 3HEFA 2VL8A 4B8XA 4S04A 3CCVI 4FCYA 3OSFA 3ZN0A 2R7XA 3O3KA 2HS5A 4EM1A 1UJ8A 2DMQA 3MWMA 3R61A 3FDYA 3I59A 3HC7A 5FGMA 2HTSA 1PP8F 3S2DJ 2M0CA 4HF0A 4UUVA 2VJIA 2YUSA 2F5CA 3I59B 3VFZA 4Y7NJ 4P9FA 2FJ1A 3BCBA 2CWEA 3KYDB 5HNHA 5GPCA 3E5QA 4EJOA 1MBKA 4KIBA 2NVUB 3I54A 4HNTA 1R9TJ 4LITA 2HGCA 1CF7A 1IGNA 5HOOA 2ZCWA 2R5YB 3MZYA 2B0LA 4X6AJ 2P7VB 1K6YA 1S5LC 1WJBA 1SD5A 1B1BA 5EEGA 2GA2A 3HOVJ 1FX7A 2HKXA 1IDYA 5D5VB 4XLNF 1SFOJ 2UZKA 3HOXJ 3E7LA 1OYIA 2F4IA 1MBGA 2Q2EB 2AS5F 2A61A 3S1NJ 1DPRA 4DZPA 3OS2A 3VSLA 4KYWA 2E1MC 3ZMDA 3HHHA 1E17A 2GA1A 1JGSA 1KQ8A 2YX7A 1YW9A 3BG7A 1MMGA 2VBWA 3OYHA 3SDGA 3ELKA 1NG7A 2EFOA 2VJ5A 4S0HB 1HF0A 5DS9A 1VNDA 4G6QA 3CCMI 2KDOA 3F8CA 1EH6A 4LK1F 3BY6A 2RGVA 3P7NA 3DEEA 1YLFA 4ZYAA 3S16J 2V4JC 4XNFA 2CUEA 4IJAA 1MMAA 2K9QA 2W24A 3E1SA 5ILVA 1EH8A 1H88C 2L0KA 4BXXJ 3PSFA 4HX8A 2FBHA 3I64A 2E1NA 4XKWA 1R4NB 4XLHA 4GYGA 3R0JA 1OLTA 4UB6C 4UUSA 2K7LA 3FF5A 1XMAA 4CZCA 2CUJA 2KIFA 4HNUA 2OPTA 3RQIA 1U78A 2ME6A 4KT5C 3KP7A 2DI3A 2K27A 2HXOA 1ZHFA 2OA4A 1F43A 3BG6A 3HRSA 4JX5A 1SFUA 3IRRA 3GTMJ 2R7UA 2KJCA 3A4CA 3FXRA 2IA0A 1BI3A 4BL0B 2KRCA 2CQQA 3GEZA 3CCEI 4HAMA 1XSVA 2OV7A 2L7KA 4CDGA 1RPWA 1R49A 4OIPF 3TW6A 4ZTFA 3A0HC 2DT5A 2ZNYA 3NWTA 1FSHA 2Z9OA 4DYQA 4MQ9F 4R1HA 3K4NA 4A93J 3LNQA 3CDLA 2R5ZA 1VFCA 1R36A 3UKGA 2NAZA 3H5AA 5EEHA 1D3YA 2J5OA 3K7AJ 1NK3P 5HS9A 1JUSA 2VONA 2H1LA 3CC4I 2F2EA 3K6GA 2K3FA 1G3SA 1XD7A 4KFCA 4EJUA 1YRNA 2QSHX 1H8AC 2EFNA 5F04A 2DQRA 5ERIA 3NWSA 1G3WA 2ZMEA 2QA4I 2JPBA 3MAJA 2VKVA 1V5FA 1LE8A 1KA8A 1U5TC 2LLKA 1VQ8I 2XF7A 5ICGA 4IVNA 4V2GA 2QUFA 3F9KA 3GTLJ 2STWA 3BTJA 4YIIA 1ZELA 1C0WA 5DDGA 2EIMH 1FMVA 2P0WA 3EUAA 1QA6A 5FLXK 1LPQA 1R4MB 2DFFA 4N9HA 2BV6A 1DQUA 2X1EA 1MD0A 4MHGA 1MMNA 3HHGA 1E0EA 3K0LA 1XCVA 1J7KA 2XAGA 4E7IA 2NVYJ 2LOOA 2ISYA 2P6TA 2J5PA 4I76A 4YFXF 5FB2A 1K83J 4UXNA 1J75A 2F6CA 1FY7A 3DWLE 4B1RA 4UHTA 4UVCA 2NYXA 1UG2A 1RR8C 2FE3A 3G6EI 2OTJI 3K1MA 1LVAA 3GZ6A 1XGOA 3L9FA 4IHTA 2DAOA 4EJVA 1R1UA 4HQMA 4ENJA 3GTPJ 3HKZA 1UFMA 5TJJA 2E5ZA 1I5ZA 4F92B 1JHHA 2Z3YA 1K4SA 2PJRB 2PJRA 2BY3A 4CICA 4KMFA 3H36A 5AIPA 2E1MB 2CU7A 1TWAJ 1Z1DA 3F8NA 3FZVA 3VYRB 3JRAA 3DU5A 3HRUA 4CH7A 3DBLB 1QBJA 1BI1A 1MH3A 2CS3A 3GWZA 2OAZA 2ZKZA 4LG3A 1IZ1A 4AU7A 4F55A 4IKFA 4CUGA 4W97A 2K5CA 4IHSA 1Z3XA 3AG2H 4UB8C 4CYDA 1SEUA 2DOAA 2WA0A 3W2WA 2EK5A 2M8EA 4Q47A 4BU2A 1GHCA 4HF1A 3GTOJ 1IUFA 4A3KJ 2QKMB 1ENHA 2EILH 3BTIA 1WH7A 3F3XA 1A31A 2IAIA 3D5LA 3CD6I 4RS8A 1U5TA 1FC3A 1USTA 1BOAA 1TLHB 4I99C 4XLEA 2H8RA 3KEYA 1IRGA 1QGPA 1USSA 3KP2A 2LBFA 4BHPA 3LQRA 3FK6A 2OQGA 3TKYA 3OV8A 2PG4A 4IHXA 4I02A 2DMNA 3HPGA 2GM4A 4ANJA 2HYGD 2P8TA 5LBQA 2V1NA 4FE7A 2JQ7A 3ZGKA 3N05A 4II3A 4A5NA 5J1RA 3F6OA 4I01A 1TWGJ 4C2MJ 2DA6A 2KRFA 4ZJZA 1JTYA 3U1KA 1F4KA 1QRYA 1WRJA 1ZGAA 1QVTA 4LLNA 2ZXJA 5J1UA 4UNOA 1D0ZA 2OU2A 3FMQA 1FT9A 3RKQA 2Y9ZA 1UCRA 1ZYRF 2XSJC 2I8DA 4IHVA 2HNHA 3EQLF 3I9V2 3PQJA 4FHTA 4YFKF 5ED4A 5D4RA 3QPHA 2E7XA 1K61A 3I4NJ 1U8RA 1U6GA 3TOAA 2BW3B 4CHUA 3IH3A 5HLTA 1HW5A 2V9PA 4H4KC 4WX9A 4UVBA 3BROA 2N8GA 5JVTA 2FUG2 4BY1J 5FLVA 2XF6A 2LY9A 3ECOA 3VODA 2VQLA 1VQ9I 1HKQA 5GTIC 4Q4ZF 4GRIA 2QEXI 3M7GA 4PCQA 3R4KA 3S2HJ 2O8KA 1VQMI 1FYKA 3ZOBA 1OR7A 5CVRA 3MQ0A 2R7SA 2DTRA 1D1AA 5E3OA 1SD6A 2B9SA 4PJLA 2VBYA 3JRFA 5F6FA 4UUSB 1BM9A 4HLXA 1BC8C 2MLGA 2M34A 1WHUA 3M07A 4A3CJ 2HFHA 3PL8A 5BNGA 1W4MA 1XB4A 2DLLA 3FHZA 2M7BA 4ZC3A 1O7LA 2LKXA 5DYMA 5B5EC 5IT9Z 1WQ2A 3HGGA 2JUGA 3OYKA 3CMYA 3C2GA 4M3BA 3O8HA 1FWZA 1TT0A 3V8KA 3J81Z 4BE1A 1ZG3A 2HVQA 3KE2A 1XGNA 3M4OJ 1T33A 4A6EA 2CG4A 2JTVA 3RZOJ 2V79A 2EV5A 4XLAA 1ZR4A 4ESBA 1XSXA 2D5VA 2Y48A 3DFGA 4JYKA 2HEOA 4TV7A 3S3OA 3DKYA 2L9NA 4CZZA 2FOKA 1MJAA 2L7ZA 1J59A 3L7WA 1XDUA 5E1ZB 4DGWB 5L3EA 5D8LB 3I53A 1AU7A 3DPUA 3OYMA 1H9GA 1TWFJ 2GZWA 2ZB9A 1IV8A 1X3WB 4RAFA 1R7JA 1SVMA 4L5JA 4BYYA 1SMTA 3BR3A 2KQRA 3REOA 3B6CA 1VQPI 3DKXA 2LC2A 3CZ6A 4Y4RA 4BS9A 3LQQA 3DXJF 1JKRC 2ZJPF 3QOEA 1DGWY 3QPTA 3WU0A 3SJMA 2XUBA 4E7JA 3VB2A 5K5QA 4CGZA 3WTYC 1IXRC 4RAYA 5LEJA 2R7WA 1LDJA 1VQ7I 1WCMJ 3S1RJ 3GXOA 1WJEA 2LF8A 2PN6A 1UELB 5H2FC 3A2KA 3PIOF 4OAZA 3JRHA 2JRTA 5E8GA 5L3CA 2QYOA 3KYLA 1MNMC 1X3UA 2DK5A 3LMMA 4JBAA 3AG1H 1Y0NA 5IYCJ 1KQ9A 1W36D 5DEQA 3H0GJ 2FRHA 4HZFA 5DV5A 3VOEA 4QWQA 1FPQA 4LOCA 5EF6A 2IBDA 2KP6A 1LUJB 3VSKA 1MJ9A 4ZZLA 3K1PA 3R6SA 5EGOB 1N77A 3HOZJ 5CVIA 3IC7A 3BP8A 2MD0A 4XOPA 2VKEA 3DPTA 4J00A 3W6JB 2HOSA 2H6CA 1YQAA 1LJ9A 5KVRA 3C7JA 2DA5A 3CUQC 4OMZA 4KA4A 1R00A 2QENA 2IVMA 3DTKA 4BQAA 2WY8Q 4OINF 4OAYA 3HG9A 2Y0SN 3DU6A 4EM0B 2B63J 1X1DA 2KJBA 2QBYA 2M1BA 1R5HA 3OY9A 1UHWA 3JTHA 1LB2A 2OZUA 1YJ9I 1ZK8A 5L3DA 4CO8A 3KLNA 1BA5A 3AAFA 1B59A 2AXLA 2Z33A 1I6XA 2VQGA 2YPRA 1IXSB 4C3HJ 2M9HA 3HKZN 1XS9A 2UUZA 1WKMA 2HQNA 1JKPC 2O9LA 2FBIA 1S9HA 2KMUA 2L7FP 5D4SA 3W2AA 3S17J 3IH4A 5J4VA 3ASOH 1YJWI 4NHJA 1BR2A 5FLXZ 2IS2A 3UNGC 2NRAC 1ZARA 5J3LA 3J81K 3F6VA 1GXQA 4PFOA 5DM6F 1W0UA 3ZMVA 2NXNB 2FNAA 2C6YA 2QKLB 4IHWA 3B02A 3K4BA 3FMRA 3CO6C 2XHKA 1ZAOA 3PFIA 5KAIC 2LH9A 4EM2A 1DUXC 3VYUB 2WWYA 2EZLA 1IN6A 2H8WA 4XKCA 4E70A 4P9UA 2BY1A 5F1JA 4ETSA 3JR9A 1X2MA 5H20A 4BJ6C 4AIDA 2GQQA 2ESNA 3KYCB 2ELHA 3TO7A 5GPAA 5A2QK 3GTQJ 2EINH 3QAHA 3BLYA 3BT9A 5J4YA 1ETWA 2EZIA 1GT0C 2GIZA 3CLQA 2ACJA 1I1SA 1VQ6I 1T0FC 1TT5B 3BQYA 5FD5A 3AL0B 1ZLKA 4A3GJ 5B1BH 2KZVA 4KN7X 4IOCF 1YIOA 2EZKA 1FBSA 4I09A 4E7KA 3OR2C 5FJ8J 5H6QA 4XSXF 4J01A 4IF4A 3HRMA 1IG7A 2FQ3A 4ZYGA 2V6EA 4AYBN 3OIQA 2WTEA 1XTAA 4OIOF 3BR0A 4J19A 2IGMA 1ON1A 4LK0F 4O3MA 4BEHB 1IN7A 2VBXA 4FASD 2R7ZJ 1ZGWA 2K9MA 3BTCA 4L5IA 4PSXA 1ITYA 3AG4H 3PNYA 3E5XA 2FQ4A 2LF7A 1OISA 5F0HA 2DTZA 1WJCA 4UV9A 3AFHA 1K4TA 1WJDA 4DJAA 1O3QA 4DYRA 4E7ZA 3H9GA 3G73A 1LFPA 4XONA 1P7JA 3TGNA 5IT9K 3RPUA 4A3BJ 4BGDA 1XSDA 1OPCA 1JJ6C 2FD5A 4P55A 3M1CA 4DQ2A 3KPHA 1VQNI 3F0CA 2WADA 5M5YJ 2JA7J 3QYEA 4RGXA 5DD8A 1S7AA 2R4GA 1G8XA 3VYTB 1R1VA 4YFNF 3K2AA 2CQXA 2DPUA 1W5CC 1B9NA 2E1CA 4L9TA 3ZCOA 1DU0A 3CCSI 1IN8A 3J80Z 3I56I 5HVQC 3M3YJ 3H1CA 1IDZA 4MTEA 1B8IA 2LKSA 4NQWB 3BJAA 1ZQ3P 1ODDA 3HOTA 4JX6A 3T8TA 3RYPA 3TW7A 5FKOA 3E3VA 3A01B 3Q5FA 1WI3A 5B1AH 3M1EA 3TDUC 1FTTA 2NS7A 1YHQI 4XRFA 4G6TB 4L5EA 1RUNA 5D5WB 3VYSB 1R23A 1T08B 3EUHA 4KN4X 5LLQA 2UWMA 1YTYA 4C2TA 2ZBKA 1D0YA 1MDMA 1W36C 1A04A 4A3EJ 1EKEA 2EBIA 1A6IA 3RKXA 3J7ZI 3H0DA 4BDZA 3HUGB 3DBHB 4UVAA 2CQKA 4ITVA 1O3RA 1Z7LA 5CVUA 1NK2P 4WXHA 1WWXA 5KK1A 5E20A 5DTDA 4PUSA 3VWBA 3CMEI 2B7EA 2X6WA 1FP1D 1VQOI 1IRZA 2A69F 3K10A 4KIGA 3BZ6A 3CCUI 5TISC 4XSZF 1OCZH 2LNBA 2Q1ZB 3PSIA 4G94A 3RIRA 5IP7J 3Q0WA 1WGXA 3JCUC 2MH9A 2DMTA 1JI8A 2IW5A 3ZPLA 1BC7C 2F4OB 1JHFA 3BC8A 1R5ID 2COMA 3G3ZA 4CCKA 2DA2A 2E2HJ 2XGCA 3GO5A 3WTVC 2HKOA 2ZC2A 4C30A 1HA8A 5CYVA 3H3ZA 1KU9A 3C2BA 2VT3A 1DPUA 1BOBA 4ESJA 3BTLA 3DEWA 4NBQA 4BBRJ 3PM1A 2W85A 2WAQN 2PJPA 2NS8A 3CUOA 2KL4A 2ZJ2A 2RVCA 4M3GA 3J7AY 1TQMA 2DCEA 1BIBA 2XVCA 2YU3A 2DO7A 3KFWX 1T39A 1RC9A 2LRDA 2ZMEC 4HW0A 1WJFA 2EH3A 3HSFA 5KAFC 2R7TA 2NNNA 3SQNA 1S7OA 5L3GA 3JAMK 2VLAA 3RJPA 1T56A 1RETA 3GCMA 3DCFA 5CVJA 4V19K 3JRDA 2VE9A 2L4AA 4NUBA 1G59A 4E6KG 4KDPA 1F36A 4KICA 2LG4A 4MLOA 3F8FA 3Q0UA 4EQQA 3HBLA 1SD4A 4IXAA 5HDGA 2L02A 1UAAA 4BE2A 9ANTA 1V5EA 2DA7A 2X6OA 3G1LA 1TWCJ 1H0MA 2XAQA 1ULYA 2ADUA 1TNTA 2VJ4A 2GOXB 3I0TA 2YU9J 3CCLI 1SFXA 2Z99A 2BVLA 3LSPA 1GDTA 2MLKA 2OF7A 5FKNA 2XROA 5CVVA 4WWCA 4L0ZB 1TC3C 2WAFA 5FO5A 3MZHA 4PFPA 1RRJA 1FIPA 4N4NB 1UZCA 4HYEA 2OUMA 1P4AA 1RESA 1I27A 2HOEA 4HX4A 3SYTA 3V7RA 5BS6A 1WZ2A 2Z2SB 2GBYA 1QVUA 2EZHA 3DPLC 1R1TA 1BR4A 4R79A 1YOVB 4IQ4A 5HLIA 4B44A 3L09A 5GAHJ 4QLCU 1HW1A 2FX0A 2H1KA 2A5YB 1DP7P 3D5RC 1UMQA 1E3PA 3V4GA 4X1EA 3RDIA 2AXTC 1YW7A 4WXDA 2EV0A 2DMUA 3HXLA 1T2KA 3ZQQA 3Q9VA 4O6JA 5M3MJ 4D7NA 3GFMA 3IV5A 4E4HA 1KGSA 4P5OA 3WTWC 3MKLA 1NH3A 1W7PD 4GO1A 4GCVA 3GVAA 2IGKA 1YRNB 5FROA 1OCRH 2XPUA 4K2EA 3TO6A 4IHYA 1B6AA 2CW0F 2LYCA 3IRQA 1LQ1A 1OCTC 3L2VA 1Z91A 3OS1A 4AVPA 1W0TA 2FOWA 2EFPA 4KITB 4MFDA 3IUOA 1PP7U 2W82A 2RC4A 4L9VA 4U7DA 4PJMA 4U87A 1E2XA 2R7OA 2QQAA 1R22A 1MGTA 3BQZA 1WJAA 2OJED 4PJNA 3MKYB 1OCCH 2W48A 4RM3A 3X2QH 5K1YA 1TBXA 1AKHB 2F5FA 1WJ5A 3GF2A 3U1DA 4B43A 5LGNA 5DM7F 5LFAA 1GV5A 3K70D 5HLGA 2JMWA 4A3IJ 1JKQC 2V1DA 4CCLA 3I58A 1MBFA 3ULQB 2K85A 2QM3A 2UXNA 5J47A 3T0YA 2W25A 4BEHA 5EJCA 4E7HA 2L2OA 2ZFUA 1X1AA 2NVTJ 2VQHA 1CGPA 3CP8A 3V7SA 3MEXA 1K78B 1T95A 3E6DA 1TNSA 4IL6C 4MIMA 2KKOA 4A69C 1WI9A 5GADJ 2R5ZB 1U9OA 3ABKH 3LOCA 3L2UA 2V26A 3CO7C 1N78A 4DOZA 4XM3A 1GXPA 4S05A 4LMYA 3QRFF 2DYSH 1IN5A 2YX4A 1LEBA 2KISA 1VI0A 1YG2A 4O5VA 3DV8A 2RV8A 4G12A 3FXOA 2QSGX 5DUKA 3FK7A 2YS9A 1I1GA 3R0AA 2LSOA 2VE8A 3LAJA 4MNUA 5IY5H 2K86A 3K1NA 4M72A 2KDZA 4IRGA 2QBYB 2DMPA 4PJJA 1MKMA 5DCMA 2AO9A 3LA3A 3OSGA 2MA3A 2MC3A 1J09A 1X1CA 1LKXA 3ZQFA 1L3LA 2MSYA 5ICFA 1T8IA 2RQQA 3DLAA 3MCZA 1P92A 3FWEA 1ZRCA 3GLXA 1KU7A 1ZGJA 4LG0B 5D6EA 2Z1DA 3KP5A 3IWZA 2WC2A 1FYMA 1Y56A 1WSUA 2R7DA 3NEUA 1HSJA 2XB5A 2MG4A 2GAUA 3BG3A 2VPLA 2K9SA 2W1OA 1B9MA 2FSWA 1Z9CA 5JFRA 4ZYDA 1Z3YA 3OIPA 1FNNA 2ETHA 4OU0A 1LDKB 1Z6RA 2G9WA 2HWVA 2HQ5A 2IXSA 4ZYHA 2H09A 2M3AA 2XIGA 2A68F 4M3FA 4BQOA 2MYSA 4PGHA 2YR2A 2E36A 3Q9SA 2IP2A 3K70C 1PUEE 4HSRA 5FKMA 1ZG5A 4BQQA 2HQAA 3K4LA 4EEFG 2OD5A 3KP3A 3V8JA 3A01A 3BR5A 2R7VA 3CF2A 2WV1A 2MH2A 1MSEC 4ON0A 4NQWA 5B66C 2XSDC 2KPMA 1F9NA 2CFOA 4B4CA 3GX4X 2G7UA 4D7MA 3KEQA 2ID6A 3OYCA 3OL3A 2BHZA 2BY0A 1J0RA 2KFDA 2VXZA 1NG6A 2QQBA 2W00A 3B6AA 4YIFA 3WTZA 1X58A 2DA4A 1EA3A 3FXMA 4F3QA 1HKTA 2HDWA 3DP7A 4IZZA 1K78A 4M71A 2NOJB 3BR2A 5CQGA 2R93J 3AL0C 1Y39A 5LRSA 1O3TA 1YX5A 3M8FA 3FM3A 2RQPA 2VQCA 1BR1A 2QSFX 1HQCA 1MMDA 1BL0A 2LDUA 1VQ4I 3COAC 4EJWA 3A02A 3M8JA 4MFEA 3QYBA 3TDZC 3JTGA 3KLOA 1KYZA 4G6DA 2ZSIB 2JK3A 2AQFA 3ZQIA 2E7WA 4ZTJA 1YW8A 3WHBA 2P4WA 5JHFA 1VZ0A 1YI2I 1HKSA 2FEZA 2FF4A 3OOPA 4B3AA 2XB0X 2K9NA 2KIQA 2XASA 2A6TA 2JRMA 2DDAA 4GXOA 2IA2A 3JRBA 4A2UA 4A3DJ 2CJJA 1FZPB 5FKKA 1DP3A 1MNEA 3GFLA 3CUQA 2R0QC 5E8IA 1J2XA 2UXXA 3O2PE 4F52A 1FP2A 4XK4A 2BZTA 1FBUA 3BZKA 4U7BA 3FKJA 3BWGA 2A07F 1SAUA
chains in the Genus database with same CATH topology
3K4KA 2Q2EB 1X1BA 4YEJA 3BLYA 4II2A 3OS2A 4B3XA 3VSLA 3HOSA 2E1MC 1T0FC 3AL0B 2VASA 2KZVA 3BG7A 3UR3C 1MMGA 3OYHA 3RTRA 1KONA 1NG7A 2VJ5A 4E7KA 3OR2C 1PJRA 2DT6A 4J01A 4HG2A 4B47A 2KDOA 2ZXHA 3SZGA 2V6EA 3OL4A 3RPUD 3DTIA 3OIQA 2X85A 2IGMA 3DEEA 4F91B 4ZYAA 2CUZA 4BEHB 2R7RA 2IGNA 2V4JC 1D1CA 4FASD 4XNFA 4E7SA 4BXFA 1MMAA 2CW8A 2K9MA 3E1SA 2HU9A 4C9YA 4PSXA 3PNYA 2VXDA 2L9SA 1WJCA 3PSFA 5KCMA 4XKBA 4XKWA 3AFHA 1WJDA 4DJAA 4IQJA 4XLHA 4E7ZA 1OLTA 3H9GA 1LFPA 4XONA 3S3NA 4BACA 4CZCA 2CUJA 4BGDA 4HNUA 3IAS2 3M1CA 3H35A 2Y0SA 2WADA 1WFXA 3OYJA 3QYEA 1TZLA 2HPMA 2WY7Q 3BG6A 2R4GA 1G8XA 3VYTB 4CA0A 1D0XA 2R7UA 3RCOA 3A4CA 3S8PA 3OYNA 3HL2A 3OYAA 4BL0B 2KRCA 3TMOA 3ZCOA 2OV7A 2L7KA 5FRMA 4ZTFA 5HVQC 2MC4A 3NWTA 4NQWB 2M7AA 3PFYA 3HOTA 3K4NA 3I3LA 3L2WA 2O5RA 2PMZA 4ZDOA 2MABA 2ELJA 3OYDA 3OYLA 4G6TB 3H5AA 4LIVA 3FHNA 3VYSB 3OYBA 2A5WA 4F93B 1IRXA 2UWMA 2L5QA 3CMMA 3G2BA 1PYVA 3A1YA 3K6GA 2R7QA 4C2TA 3OS0A 1D0YA 1W36C 1R6RA 4Y3OA 5CPRB 3V42A 3NWSA 3H0DA 4BDZA 5FRNA 3HUGB 4XN3A 2LY2A 5LD2C 4ITVA 1V5FA 1Z7LA 3LSGA 3PJRA 1MNDA 1D1BA 4XR6A 2XF7A 3H9JA 3W3CA 4PUSA 3VWBA 3FBNB 2X6WA 3F9KA 3MD2A 3K10A 3PNTA 3LSHA 3SEZA 4XMYA 3OYGA 1ZELA 2Q1ZB 3PSIA 4YELA 1FMVA 2P0WA 3EUAA 4B48A 1DQUA 3D5SC 2X1EA 1MMNA 2JA2A 3CJQB 1QHHD 1JI8A 3L2QA 3CJRB 2CV2A 1E0EA 3OYEA 4E7IA 2LOOA 3BC8A 4CCKA 1UG0A 2LBFB 3TL4X 2F5VA 4YRVA 2F6CA 4C30A 3DWLE 3CESA 1X4PA 1HA8A 2BW3A 4NNJA 3VDXA 1BOBA 2KL4A 1X4OA 3J7AY 2DCEA 4Y33A 1P9QC 3GBGA 3HKZA 4HSTA 2LRDA 3ZRGA 2E5ZA 1WJFA 4D1QA 4PK4A 2IS6A 4F92B 4RMNA 2R7TA 4XKVA 2PJRB 2CMPA 2PJRA 4NC7A 2E1MB 2VLAA 3VYRB 3DU5A 4NUBA 4CH7A 4E6KG 1G59A 2VB6A 2LG4A 4MLOA 1MW7A 4BJTA 2CS3A 4KJZA 4LG3A 3DQVC 2VKHA 4AU7A 2Z16A 4JOMA 4F55A 4C2UA 1ERDA 3AKZA 4IKFA 4CUGA 2KHMA 2K5CA 2W4SA 1UAAA 1Z3XA 4IX7A 4BE2A 2HVSA 1V5EA 2IGOA 2DOAA 2MFZA 2WA0A 3KX2A 3W2WA 4BU2A 2VJ4A 2GOXB 1X19A 2BVLA 2QKMB 3PNVA 3S93A 2XF5A 2V7FA 3D5LA 2DXIA 4X0GA 1LVKA 2WAFA 4HRIA 2X6YA 4PFPA 2IS1A 1V5GA 4N4NB 4XLEA 3KEYA 3E0JB 3QODA 2OUMA 2VJJA 3SYTA 2LBFA 2Z2SB 2XAUA 2X6XA 2LY1A 1N75A 4BJ5C 3HPGA 2K9LA 4ANJA 1AA7A 2V1NA 3DPLC 3ZGKA 3N05A 4II3A 1BR4A 3LSIA 4R79A 2X1DA 4HPQA 3RQ4A 2WBMA 4ZJZA 3U21A 4IQ4A 2JSPA 4ZDLA 4B44A 2CV1A 1D0ZA 3D5RC 4DBQA 2X51A 2VKDA 2ZXIA 2XSJC 2I8DA 4BUPA 2HNHA 3I9V2 3OOUA 3HXLA 3ZQQA 2BOLA 3EUKL 2LREA 3W2VA 4E4HA 2ZSHB 4P5OA 2BW3B 5HLTA 4XLFA 2IGKA 4QPQA 5FROA 4H4KC 2FUG2 2KRHA 1SFKA 1QHGA 3IP4B 2XF6A 2RREA 2LYCA 2VQLA 1GLNA 3L2VA 4RLFA 4GRIA 4XLCA 3OS1A 4CCOA 4KITB 3IUOA 2W82A 4AVZA 4PJMA 3S3MA 3PUBA 2R7OA 4U87A 2R7SA 3EPZA 2XDVA 4CCJA 1D1AA 4PJLA 1WJAA 4KISA 4PJNA 2AQEA 3MKYB 3L2RA 4RM3A 5HNFA 3PL8A 2M0MA 3C2HA 1WJ5A 3HPHA 4B43A 2M7BA 1YX3A 5LFAA 3IAM2 4ZC3A 3K70D 4QPOA 4CCLA 3LFUA 3OMYA 4BEHA 2JUGA 3OYKA 4E7HA 2L2OA 2ZFUA 4XL9A 3C2GA 4KT6A 4ZDPA 1X1AA 2VQHA 2GOMA 3S32A 1TT0A 3CP8A 4BE1A 2HVQA 1T95A 3OWTA 3K4JA 1QU3A 2JVGA 4XLAA 4RLQA 3LL7A 4HEA2 2V26A 3L2UA 4CCNA 1N78A 3S3OA 4DOZA 3DKYA 2L9NA 4XM3A 3SDBA 1FMWA 3H9QA 3MMYB 4DGWB 2WB1A 2WAQA 2BVMA 3DPUA 3OYMA 4FETA 2HPIA 3EUHC 2CH0A 1U0JA 4EATA 2W7NA 4CSWA 2M4GA 4BQNA 3ZXSA 4RM2A 5KNLA 4E7LA 2HZDA 2KQRA 4PJJA 2UV1A 2LC2A 3CZ6A 3DKXA 4P1WA 4Y4RA 4BS9A 2JVHA 3MKZA 2IS4A 3DTEA 3QOEA 1DGRM 1DGWY 1J09A 2XC7A 1X1CA 1LKXA 2CW7A 4E7JA 2RQQA 3DLAA 2R7WA 3LSMA 1WJEA 3H5RA 1UELB 3FBIB 2Z1DA 4PSWA 3TBIA 3A2KA 3CP2A 4OAZA 1Y56A 3ZR8X 1Y6IA 4BE0A 3BCAA 2VPLA 3H5NA 2W1OA 3RSNA 3KYLA 2K3PA 1Z3YA 3OIPA 2V9KA 2X1CA 3LMMA 1LDKB 3QYFA 1W36D 1Z21A 2IXSA 5TGTA 2M3AA 2OC6A 4AYBA 4BQOA 2MYSA 3ONQA 2KP6A 3SEQA 3K70C 3VSKA 3OYFA 4HSRA 4BQQA 1N77A 2HQAA 3K4LA 4N4OB 4DIQA 2KLOA 4NC8A 2MD0A 2RNGA 4XOPA 4XORA 2R7VA 3CF2A 3DPTA 1YE9A 3K4MA 5CKTA 3OR1C 4JQFA 4J00A 2DT7B 2KPMA 2CFOA 2E5NA 2VIXA 1OR7C 3OYCA 2WAEA 3OL3A 3DTKA 2WY8Q 4OAYA 5KHDA 3HG9A 2VXZA 3DU6A 1NG6A 1X1DA 2W00A 2HVRA 3OY9A 3MKWB 1EA3A 4F3QA 4XN0A 2HDWA 4IZZA 2VL8A 5CQEA 2NOJB 3AL0C 5CQGA 2VQGA 3LSKA 2R7XA 1YX5A 3K4CA 4BDYA 2UUZA 2VQCA 1BR1A 1S9HA 2KMUA 4OWRB 3W2AA 1MMDA 3FDYA 1BR2A 3HC7A 2M4KA 3M8JA 2CV0A 2IS2A 3QYBA 3UNGC 2VJIA 2ZSIB 4XOTA 4PFOA 2AQFA 3OYIA 4ZTJA 2DJIA 5JHFA 3BCBA 1VZ0A 5HNHA 2E60A 4CCMA 2QKLB 4XQFA 3K4BA 2A6TA 4HNTA 2LH9A 4DBRA 4LITA 3VYUB 5HOOA 4XKCA 1DP3A 1MNEA 1K6YA 1WJBA 4LIUA 4F52A 4BJ6C 4D9JA 4U7BA 3FKJA 1SAUA 2F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAZ A;  5KHD A;  2MC4 A;  4OAY A; 
#chains in the Genus database with same CATH topology
 2MD5 A;  3RKW A;  1X1B A;  4LG0 A;  4YEJ A;  3S15 J;  1R71 A;  4B3X A;  1FIA A;  3HOS A;  2DYR H;  3WHC A;  3S1Q J;  5DD4 A;  3WG7 H;  3EET A;  1I6H J;  3UR3 C;  1IXC A;  1JUP A;  5IYB J;  5GAE J;  3F8B A;  1S7E A;  4GYI A;  1V54 H;  1I50 J;  5J8F A;  2DT6 A;  4NDL A;  4Z6Y A;  2D2W A;  4M9S A;  4NC6 A;  3B73 A;  3S14 J;  2QZ8 A;  3OL4 A;  3RPU D;  2ISZ A;  4HA8 A;  2JZY A;  2CUZ A;  2IGN A;  1D1C A;  4AD9 A;  4HLY A;  4BXU A;  2Y30 A;  2EQR A;  3LST A;  2HOA A;  4C9Y A;  3CDH A;  2VXD A;  2ZJR F;  2Y31 A;  3BZC A;  1P4X A;  3RPQ A;  2E2I J;  2JT1 A;  2VOP A;  3ZMS A;  1LFB A;  4IRH A;  5HS8 A;  3FIS A;  4BAC A;  3S3N A;  1W5S A;  3HDD A;  1RNL A;  1WFX A;  2EJR A;  3OYJ A;  1TZL A;  1XGS A;  2HPM A;  2WY7 Q;  5JHU A;  3RCO A;  3S8P A;  3HL2 A;  2DW4 A;  2ZXW H;  1ETV A;  3TMO A;  1HXD A;  2LD5 A;  1B72 B;  1AKH A;  2TCT A;  4BBS J;  2E35 A;  4PJ0 C;  1XG1 A;  5FRM A;  4RDU A;  4AUX A;  5K7Z A;  3GLL A;  1TW2 A;  2A05 A;  3LSR A;  3PFY A;  3OIO A;  3L2W A;  3HGY A;  5JLX A;  2PMZ A;  2HTJ A;  2M45 A;  3ECH A;  2Y69 H;  3G1O A;  4DNC A;  2MAB A;  3FXQ A;  1T6S A;  3IH2 A;  3OYD A;  3OYL A;  4LIV A;  3BJ6 A;  3FHN A;  2HZT A;  4D5C A;  3OYB A;  2L5Q A;  3FX3 A;  1TQP A;  5HS7 A;  4ZH4 F;  1RZ4 A;  3G2B A;  4IO9 F;  3A1Y A;  1AOY A;  3OS0 A;  4LD5 A;  2EV6 A;  4AM3 A;  3I55 I;  1U2W A;  2QGU A;  1JE8 A;  1HDP A;  5GTH C;  2L7M P;  3I5U A;  2VOD A;  4MQV A;  1BI0 A;  5FRN A;  3HUG A;  4XN3 A;  1HW2 A;  2LY2 A;  5LD2 C;  4DW6 A;  3LSG A;  3PJR A;  1MND A;  2PMH A;  1D1B A;  2QCO A;  1OCO H;  3FXL A;  3H9J A;  3W3C A;  3HYI A;  2IRF G;  3FBN B;  4IOA F;  4ABZ A;  3PNT A;  5CLS A;  4PGG A;  3BPV A;  3I4P A;  4XMY A;  4Y52 J;  1PDN C;  2DA3 A;  5IPA A;  3JRI A;  4YEL A;  5LGU A;  4B48 A;  4AIK A;  1YYV A;  1MSF C;  1AHD P;  3I71 A;  5EZG A;  1QHH D;  3CJR B;  2O3F A;  1VTN C;  2E19 A;  2DU9 A;  1QQI A;  2DDB A;  2F5V A;  4YRV A;  5F08 A;  3Q3S A;  2CFX A;  5JVG F;  5C4X J;  3CJT B;  4XIC A;  3H92 A;  3VDX A;  5JLW A;  2DOF A;  2QF7 A;  1IO2 A;  3ZQG A;  3TP3 A;  4A3F J;  2OZ6 A;  2QQ9 A;  1J9I A;  2BEO A;  3CQZ J;  4U88 A;  3BOQ A;  2R5Y A;  4HST A;  3ZRG A;  2XGE A;  5AON A;  2DPD A;  2IS6 A;  1SVL A;  4RMN A;  2E34 A;  1ETY A;  3C3W A;  4XKV A;  5BPI A;  2ME0 A;  3SFZ A;  3QOP A;  1ON2 A;  2V1X A;  4HOB A;  4M6X A;  2CRG A;  3E97 A;  1RI7 A;  2VB6 A;  5C4J J;  3L1P A;  1MBJ A;  5F0F A;  1JXS A;  3PUF A;  4BJT A;  4JP0 A;  4R8H A;  5IT3 A;  2CYY A;  4RAG A;  3LA2 A;  1NHA A;  4KJZ A;  2VKH A;  1Y1W J;  2BXY A;  3FM5 A;  4XRS A;  1B8I B;  3WGG A;  3WE3 A;  3CJN A;  4G7H F;  2W4S A;  2H27 A;  1Z77 A;  2HVS A;  3L2C A;  4C3I J;  2IGO A;  5F0C A;  1OMI A;  1HST A;  1Z05 A;  2GXB A;  3FIW A;  3E6M A;  3BDD A;  2HYF A;  5GP9 A;  1X19 A;  1JUM A;  1U9N A;  4A0X A;  2BGC A;  2XF5 A;  3DKW A;  1S3J A;  1MBH A;  2F48 A;  4X0G A;  1P2F A;  2XGD A;  2M87 A;  5E79 C;  4HRI A;  1RIO H;  5E1X A;  3LWF A;  3NAR A;  4PZJ A;  4BHB A;  1V5G A;  2A6E F;  2DK8 A;  3QOD A;  4D5F A;  2D1V A;  2R7F A;  4A0Z A;  2K4J A;  4YIR X;  2XAU A;  4DZJ A;  4QSH A;  3F8M A;  4RB1 A;  1LE8 B;  4UV8 A;  2Z5U A;  4Q5S F;  4ESF A;  4BJ5 C;  1ZN2 A;  1ONV A;  1AA7 A;  1Y0U A;  2JWT A;  3LSI A;  3JSP A;  3GZN B;  3U21 A;  2CQ7 A;  4ZYE A;  2JSP A;  1XMX A;  2RDP A;  5ICC A;  1GVJ A;  2VC1 A;  4HQE A;  3TQN A;  3HTU A;  2STT A;  3K2Z A;  4Y13 A;  3JAM Z;  2X51 A;  4G9Y A;  2ZXI A;  3CMA I;  1XDS A;  4MO7 A;  4M73 A;  1FOK A;  3QP5 A;  1IUY A;  1ZLJ A;  4M3D A;  2BOL A;  2LRE A;  3W2V A;  1D8J A;  1XX5 A;  2HXI A;  1HBX G;  1FLI A;  2Q8K A;  2E1O A;  4LFU A;  3F72 A;  3ZN1 A;  2VN2 A;  1MDM B;  2IA1 A;  4QPQ A;  4UUT A;  2VPR A;  4FIS A;  1Y8R B;  2ZNZ A;  1SFK A;  3IP4 B;  5J8C A;  2RRE A;  3QWL A;  1OYW A;  5HLH A;  1GLN A;  2DFI A;  2XKO A;  5D5U B;  1AWC A;  1U5T B;  3HIF A;  3V8L A;  4LB6 B;  4XLC A;  2RNJ A;  5EYR A;  4CCO A;  2HYJ A;  3IHU A;  2O61 A;  3KCC A;  4AVZ A;  4PDK A;  2XAF A;  3S3M A;  3PUB A;  2H94 A;  2X48 A;  4EJT A;  3ZQ7 A;  1MBE A;  2XAJ A;  3HOU J;  2JPC A;  2LK2 A;  3KIO A;  3RYR A;  2LTP A;  2ECC A;  1HOM A;  5HNF A;  2X4H A;  5BQT A;  1POG A;  2M0M A;  3HPH A;  2LKP A;  3IAM 2;  5J6X A;  1HLV A;  5EGO A;  2BHY A;  4QPO A;  3OMY A;  1ZG1 A;  1Z0X A;  2ZFW A;  4RGU A;  1A36 A;  3GUD A;  4M9Z A;  4XL9 A;  1VQ5 I;  1CF7 B;  2GIV A;  2V6C A;  3P9C A;  3S32 A;  5LEK A;  2IT0 A;  5IYD J;  1W7P B;  2OBP A;  3W6V A;  4HDV A;  1SVO A;  2JVG A;  3T8R A;  5LHG A;  5DUI A;  4RLQ A;  4OIQ F;  2IJL A;  4HEA 2;  1T38 A;  4CCN A;  2CSO A;  3ZQH A;  1LEA A;  1I3Q J;  2CO5 A;  3SDB A;  1FMW A;  3ABL H;  1BBY A;  2JA6 J;  1YS6 A;  3G71 I;  2LP0 A;  2WB1 A;  2WAQ A;  1PVE A;  1TP4 A;  2MGQ A;  4Y17 A;  4EAT A;  2Q2E A;  2CH0 A;  1U0J A;  2VC0 A;  4CSW A;  3ZXS A;  4EV0 A;  3E6C C;  2EIJ H;  4RM2 A;  1E3H A;  5KNL A;  1QZZ A;  4LJZ F;  2DA1 A;  2R3S A;  2W57 A;  3S1M J;  3HRT A;  5BMZ A;  1F1Z A;  2UV1 A;  2D45 A;  3HZJ A;  1D5V A;  2JVH A;  3MKZ A;  1T0F A;  2Q0O A;  3DTE A;  1HC8 A;  1DGR M;  2EFW A;  1UB9 A;  1ZKG A;  3CCR I;  2CW7 A;  2L3D A;  4HV5 A;  1K7A A;  2P81 A;  4BHC A;  1BJA A;  1IV6 A;  4LLL A;  1P4W A;  3WGI A;  3LSM A;  3H5R A;  2LVS A;  1G6N A;  1FYL A;  3FBI B;  4PSW A;  3TBI A;  4OIR F;  1FOW A;  3CP2 A;  1SAN A;  2L9V A;  4RB0 A;  1EV7 A;  3ZP5 A;  3L00 A;  4BE0 A;  3WU2 C;  3BCA A;  2HOT A;  1TW3 A;  3H5N A;  2LR8 A;  1ORK A;  4AIH A;  3J7A O;  3HSR A;  1X3Z B;  3VEP A;  2XKP A;  3TP0 A;  3CC7 I;  2V9K A;  2P7C B;  2HDD A;  1FJL A;  1IAW A;  1Z21 A;  4WXC A;  2PBI A;  2Y0M A;  2P5K A;  5BPD A;  5TGT A;  3G1M A;  4NB5 A;  2OC6 A;  1Y8Q B;  2M30 A;  3ONQ A;  4JK1 X;  2OQR A;  3OYF A;  1FBQ A;  2MBF A;  4N4O B;  2QQ8 A;  1K6O A;  2FNP A;  2RNG A;  3GW2 A;  4L9N A;  4XRS G;  4XOR A;  1MZB A;  1YE9 A;  2W84 A;  3WG9 A;  3K4M A;  4WK8 F;  4JQF A;  1GUU A;  3AG3 H;  3PQK A;  2LMD A;  2HI3 A;  3K69 A;  2E5N A;  4HDU A;  4DYC A;  3GTJ J;  2OCC H;  1TQI A;  3H3V K;  2MW8 A;  1OKR A;  3DEU A;  1OR7 C;  4U0W A;  3KZY A;  4XBF A;  2DQL A;  3ROU A;  2HVR A;  2XPV A;  1MIJ A;  3HJE A;  4XN0 A;  4BY7 J;  3PIP F;  3BPX A;  4EMS A;  4W1U A;  5CQE A;  4FX0 A;  2IEK A;  5K5O A;  3LSK A;  2L4M A;  3K4C A;  4BAY A;  1CQT A;  5LGT A;  4BDY A;  2EB7 A;  1OJL A;  2PMU A;  2EFQ A;  4OWR B;  3JW4 A;  4XID A;  3QPS A;  1JT0 A;  1KQ0 A;  2RN7 A;  2TRT A;  5J1Y A;  1TWH J;  4IPA A;  4Z2Y A;  2M4K A;  2CV0 A;  1S6L A;  3HM5 A;  5K7F A;  4XOT A;  3OYI A;  2O0Y A;  2GXG A;  2F4M B;  2DJI A;  2EA4 A;  3GME A;  5L3F A;  3O6B B;  2E60 A;  4CCM A;  2H6B A;  5J40 A;  4B09 A;  4XQF A;  5L3B A;  4MEX F;  2TDX A;  1PUF A;  1WH5 A;  4DBR A;  5IP9 J;  3ASN H;  1XPX A;  1P6R A;  2HQR A;  4Y15 A;  5FFX A;  3V7C A;  1SD7 A;  2NNY A;  1RUO A;  4LIU A;  3A0B C;  2DJN A;  4D9J A;  2DOD A;  2K4B A;  2KT0 A;  4F7Z A;  5HOD A;  3QP6 A;  4KIF A;  3BR1 A;  5ICE A;  3K4K A;  3ESW B;  4II2 A;  1O4X A;  3WTU C;  4P96 A;  5CJ9 A;  4RGR A;  1BIA A;  1SAX A;  3EYI A;  1JT6 A;  5TRD A;  4RAZ A;  3HOW J;  4L0Y B;  4D0P A;  5M5W J;  3P5J A;  1LFU P;  2VAS A;  3RI4 A;  5E17 F;  5EEA A;  2DBB A;  2P6S A;  1VQL I;  1ZRE A;  3SZP A;  2V9V A;  3RTR A;  1KON A;  3C18 A;  3ERE D;  1S72 I;  3O8G A;  2AHQ A;  2KIU A;  2NVQ J;  1PJR A;  4A6D A;  2BY2 A;  4HG2 A;  6PAX A;  4B47 A;  1V3F A;  5IOZ A;  2ZXH A;  4GDF A;  4QIW N;  1KYW A;  3SZG A;  1RKW A;  1APL C;  3DTI A;  2X85 A;  5LRR A;  4EGZ A;  1ZTR A;  4F91 B;  1GV2 A;  2R7R A;  2QLZ A;  3E5U A;  5BOX A;  4E7S A;  4BXF A;  4WF2 A;  2CW8 A;  1BI2 A;  4KNY A;  4A5M A;  1A6Q A;  2KIM A;  2HU9 A;  4EGY A;  3ML6 A;  1BJZ A;  1YJN I;  4M6V A;  5DCF A;  5ILS A;  5JR3 A;  1I3A A;  2L9S A;  3EDP A;  5FKL A;  5KCM A;  4XKB A;  3PO2 J;  1G3T A;  5LHH A;  2XAH A;  1QPI A;  5EDN A;  4IQJ A;  1BW6 A;  1EH7 A;  3IWF A;  3QQA A;  2Y2Z A;  3M8E A;  2X0L A;  5LHI A;  1ZRF A;  2HDC A;  4CXF A;  3IAS 2;  5C3E J;  4IRI A;  3H35 A;  3FXU A;  2Y0S A;  1W5T A;  2DFE A;  3T5X A;  4HX7 A;  3ZMZ A;  2BYV E;  4CA0 A;  1JGG A;  3ABT A;  2Y75 A;  5F27 A;  1D0X A;  3N97 A;  3OYN A;  3CC2 I;  1X1P A;  2PMZ N;  3OYA A;  2F5E A;  4M74 A;  5E3N A;  3A03 A;  2JN6 A;  2ID3 A;  1TTY A;  2MC4 A;  3C1D A;  3GZ5 A;  3QU3 A;  1OFC X;  3S2W A;  2M7A A;  3ZMU A;  3I3L A;  2O5R A;  3D0S A;  2GWR A;  2HR3 A;  1REP C;  4G8X A;  4ZDO A;  2ELJ A;  2EA2 A;  2X9D A;  4M3E A;  2A5W A;  4F93 B;  1IRX A;  1W1W E;  3FXK A;  2DN0 A;  3CMM A;  3VPR A;  4AWX B;  2CUF A;  1PYV A;  2ESH A;  2R7Q A;  5GAG J;  3TOB A;  2FA5 A;  2NVX J;  2K40 A;  1O3S A;  2ELK A;  1R6R A;  2NOG A;  4Y3O A;  4RBO A;  5CPR B;  3V42 A;  2ZME B;  1ETQ A;  3RKY A;  4ASN A;  1YIJ I;  1XN7 A;  4XR6 A;  4M6Y A;  4L18 B;  3JSO A;  5D8K B;  2P5L C;  3MD2 A;  2XRN A;  4AC0 A;  3LSH A;  2G7H A;  2CQN A;  1FOX A;  3SEZ A;  3OYG A;  3TED A;  2DOE A;  1G2H A;  3FMS A;  1I39 A;  2FU4 A;  4ENK A;  2JJ7 A;  2PLY A;  3WOD F;  2E2J J;  5B3S H;  5EZH A;  3ERM A;  2XV4 S;  1RKT A;  2ECB A;  3D5S C;  1VF9 A;  2JA2 A;  3CJQ B;  5DCM B;  3L2Q A;  1MMS A;  1Z6T A;  3D1N I;  2CV2 A;  3GTK J;  3OYE A;  4I7H A;  4IEJ A;  3Q0V A;  2Y9Y A;  2BE5 F;  4QTR A;  3LAP A;  2IPQ X;  1UG0 A;  2K02 A;  2LBF B;  3TL4 X;  3P9K A;  3MFK A;  3CES A;  1X4P A;  4BH9 A;  1B72 A;  1YO5 C;  2BW3 A;  4NNJ A;  3WTT C;  2L54 A;  3GFI A;  1H89 C;  1U3E M;  2O03 A;  1X4O A;  4Y33 A;  1P9Q C;  4MEY F;  1LNW A;  3ISP A;  3EYY A;  2ICW G;  3CTA A;  1D8K A;  1Q1V A;  2LFB A;  1QZY A;  3GBG A;  1ACI A;  1QNT A;  1JJ8 C;  1ZRD A;  1KU3 A;  4D1Q A;  4PK4 A;  4H0E A;  4FX4 A;  2I10 A;  3LFK A;  3WTX C;  3CLO A;  1FSE A;  3HTS B;  2CMP A;  1Z67 A;  4NC7 A;  3CCJ I;  1J5Y A;  2L01 A;  1NTC A;  1UHS A;  4GFB A;  3F23 A;  3G4S I;  4OOI A;  2WB1 N;  4GGG A;  1V4R A;  3KEO A;  3SZT A;  2PFB A;  4CYC B;  1MW7 A;  3FKI J;  5D5X B;  3DQV C;  3RZD J;  1X2N A;  2Z16 A;  4JOM A;  1ERD A;  1N25 A;  4C2U A;  2WV0 A;  3AKZ A;  1M1E B;  3GTG J;  2KHM A;  2O7O A;  3CF5 F;  4IX7 A;  5FLM J;  1GVD A;  4A3M J;  4RA2 A;  2MFZ A;  3KX2 A;  1LDD A;  1DDN A;  1BW5 A;  2M2E A;  2EPF A;  1VQK I;  4Q48 A;  2NS0 A;  2O6G E;  3PNV A;  3J80 K;  3S93 A;  2V7F A;  2DXI A;  1ETK A;  4OMY A;  1OYY A;  1IC8 A;  1LVK A;  2X6Y A;  3W6K B;  3JRE A;  2A3S A;  5FD6 A;  1RR7 A;  2IS1 A;  3IKV A;  1WVR A;  3I4M J;  2FMY A;  3E0J B;  4U0V A;  2OCE A;  2ZO4 A;  1U8B A;  2VJJ A;  4I0A A;  4XRM A;  3HOY J;  2JA8 J;  3MVP A;  2X6X A;  2LY1 A;  1Q1H A;  1KU2 A;  1N75 A;  2K9L A;  3MN2 A;  3ABU A;  1BN5 A;  3FXJ A;  1IJW C;  1EF4 A;  2RKH A;  4FE4 A;  5D6F A;  2X1D A;  3GFJ A;  4HPQ A;  4AIJ A;  3RQ4 A;  2WBM A;  4A3L J;  3KZZ A;  4ZDL A;  1ETX A;  1XMK A;  2ZJQ F;  2CV1 A;  3F22 A;  4V2F A;  5E3L A;  2COB A;  4DBQ A;  2VKD A;  1XCB A;  3P9I A;  2G0E A;  4BUP A;  4BKX A;  3OOU A;  1ZH5 A;  3NAU A;  3CDI A;  1Y1V J;  4RGS A;  3EUK L;  1R58 A;  1V55 H;  4EVI A;  2QWW A;  5M5X J;  3QPL A;  2ZSH B;  2FML A;  3BJO A;  4XLF A;  5E3M A;  5C44 J;  4N0B A;  2JUC A;  2E71 A;  3E6B A;  5IP6 A;  2GLO A;  1YS7 A;  3ABM H;  1S8N A;  2KRH A;  3ZQC A;  3N4M A;  1QHG A;  3BG5 A;  3LA7 A;  3J7Y J;  1L0O C;  2A6H F;  4A3J J;  4ENN A;  2JSC A;  4HBL A;  3WGH A;  4YG2 F;  4RLF A;  5HDK A;  4ENM A;  3KP6 A;  1HDD C;  3SXY A;  3DLL F;  1B4A A;  5A2Q Z;  4UY8 I;  4RB3 C;  3EPZ A;  1IRF A;  2XDV A;  4CCJ A;  1S29 A;  3DBR B;  1EJ9 A;  3WU1 B;  4FQG A;  3KET A;  4KIS A;  3CCY A;  3U9G A;  2AQE A;  3L2R A;  5ILU A;  1G3Y A;  4I98 B;  4JX4 A;  3NQO A;  3QU6 A;  3U2R A;  1P7I A;  1QPM A;  2VUM J;  1Z7U A;  3C2H A;  4XLP F;  4RB2 C;  1YX3 A;  1DU6 A;  2D1H A;  2V1U A;  3GYH X;  1XC5 A;  3LFU A;  5IOY A;  4CYC A;  1A5J A;  4KT6 A;  1W7P A;  1MH4 A;  1JTX A;  2PQ8 A;  3KP4 A;  4ZDP A;  1G4D A;  2GOM A;  4I2O A;  1PUF B;  1SFE A;  4MGR A;  2I5U A;  5H6R A;  3JRG A;  1IN4 A;  2M8G X;  4HV6 A;  3OWT A;  2PX9 A;  3HB9 A;  1IW7 F;  1QO0 D;  4LLG F;  1QZE A;  3K4J A;  1QU3 A;  3SHF A;  2F5D A;  3LL7 A;  3IKT A;  3PO3 J;  2JA5 J;  2KZG A;  2VOO A;  1YIT I;  3H9Q A;  3MMY B;  1A35 A;  2DFH A;  3WE2 A;  1YFH A;  2PEX A;  3WTS C;  2EWN A;  2BVM A;  5AIQ A;  1O7F A;  3ZQL A;  4FET A;  2HPI A;  3EUH C;  2W7N A;  4FT8 A;  1H9T A;  2M4G A;  4LGW A;  4BQN A;  1FTZ A;  1O57 A;  5HDN A;  2R92 J;  3T1B A;  3DF8 A;  4WCG A;  5JI6 A;  4E7L A;  1JKO C;  4BNC A;  2HZD A;  2BXZ A;  4KUM A;  1STZ A;  1UHM A;  2FBK A;  2YSR A;  4P1W A;  2IS4 A;  2PI0 A;  2XC7 A;  2FXA A;  4MTD A;  2OTL I;  4M9X A;  3BG9 A;  3CCQ I;  1IF1 A;  1MJB A;  3HSE A;  5F64 A;  3NRV A;  1HCR A;  1FEX A;  4I6Z A;  5K5R A;  4KMU X;  2CGP A;  4C3J J;  3ZR8 X;  1ZR2 A;  1Y6I A;  2O8X A;  5FFZ A;  3ZMT A;  3IL2 A;  2GXA A;  1OQY A;  1WPK A;  4LB5 A;  2XPW A;  2XRL A;  3RSN A;  3CUQ B;  4A12 A;  4HF2 A;  3KZI C;  2K3P A;  3M9A A;  2X1C A;  3QYF A;  2RAE A;  1TL8 A;  3LSJ A;  1XGM A;  3TO9 A;  3BR6 A;  4AYB A;  1OCP A;  3JRC A;  3SFI A;  1K79 A;  4G7Z F;  3R60 A;  3SEQ A;  2VBZ A;  1ETO A;  2XGX A;  5E18 F;  5K7H A;  4DIQ A;  4ZZD A;  1T98 A;  2KLO A;  4NC8 A;  4U0Y A;  3K9T A;  2M5W A;  4HNV A;  5F1R A;  5CKT A;  3OR1 C;  2DT7 B;  1KZH A;  3F21 A;  5M3F J;  1SMY F;  4G7O F;  4L9J A;  4A0Y A;  2VT2 A;  1R5G A;  2VIX A;  2L9R A;  2P5V A;  2WAE A;  1D5Y A;  3MZ8 A;  5KHD A;  2BBY A;  5EG0 A;  1SC7 A;  2EIK H;  4FTH A;  1F5T A;  4N9I A;  3MKW B;  5EG0 B;  2QVO A;  5E1W A;  4I0B A;  3H3U A;  1E3O C;  1FOY A;  2VI6 A;  3HEF A;  2VL8 A;  4B8X A;  4S04 A;  3CCV I;  4FCY A;  3OSF A;  3ZN0 A;  2R7X A;  3O3K A;  2HS5 A;  4EM1 A;  1UJ8 A;  2DMQ A;  3MWM A;  3R61 A;  3FDY A;  3I59 A;  3HC7 A;  5FGM A;  2HTS A;  1PP8 F;  3S2D J;  2M0C A;  4HF0 A;  4UUV A;  2VJI A;  2YUS A;  2F5C A;  3I59 B;  3VFZ A;  4Y7N J;  4P9F A;  2FJ1 A;  3BCB A;  2CWE A;  3KYD B;  5HNH A;  5GPC A;  3E5Q A;  4EJO A;  1MBK A;  4KIB A;  2NVU B;  3I54 A;  4HNT A;  1R9T J;  4LIT A;  2HGC A;  1CF7 A;  1IGN A;  5HOO A;  2ZCW A;  2R5Y B;  3MZY A;  2B0L A;  4X6A J;  2P7V B;  1K6Y A;  1S5L C;  1WJB A;  1SD5 A;  1B1B A;  5EEG A;  2GA2 A;  3HOV J;  1FX7 A;  2HKX A;  1IDY A;  5D5V B;  4XLN F;  1SFO J;  2UZK A;  3HOX J;  3E7L A;  1OYI A;  2F4I A;  1MBG A;  2Q2E B;  2AS5 F;  2A61 A;  3S1N J;  1DPR A;  4DZP A;  3OS2 A;  3VSL A;  4KYW A;  2E1M C;  3ZMD A;  3HHH A;  1E17 A;  2GA1 A;  1JGS A;  1KQ8 A;  2YX7 A;  1YW9 A;  3BG7 A;  1MMG A;  2VBW A;  3OYH A;  3SDG A;  3ELK A;  1NG7 A;  2EFO A;  2VJ5 A;  4S0H B;  1HF0 A;  5DS9 A;  1VND A;  4G6Q A;  3CCM I;  2KDO A;  3F8C A;  1EH6 A;  4LK1 F;  3BY6 A;  2RGV A;  3P7N A;  3DEE A;  1YLF A;  4ZYA A;  3S16 J;  2V4J C;  4XNF A;  2CUE A;  4IJA A;  1MMA A;  2K9Q A;  2W24 A;  3E1S A;  5ILV A;  1EH8 A;  1H88 C;  2L0K A;  4BXX J;  3PSF A;  4HX8 A;  2FBH A;  3I64 A;  2E1N A;  4XKW A;  1R4N B;  4XLH A;  4GYG A;  3R0J A;  1OLT A;  4UB6 C;  4UUS A;  2K7L A;  3FF5 A;  1XMA A;  4CZC A;  2CUJ A;  2KIF A;  4HNU A;  2OPT A;  3RQI A;  1U78 A;  2ME6 A;  4KT5 C;  3KP7 A;  2DI3 A;  2K27 A;  2HXO A;  1ZHF A;  2OA4 A;  1F43 A;  3BG6 A;  3HRS A;  4JX5 A;  1SFU A;  3IRR A;  3GTM J;  2R7U A;  2KJC A;  3A4C A;  3FXR A;  2IA0 A;  1BI3 A;  4BL0 B;  2KRC A;  2CQQ A;  3GEZ A;  3CCE I;  4HAM A;  1XSV A;  2OV7 A;  2L7K A;  4CDG A;  1RPW A;  1R49 A;  4OIP F;  3TW6 A;  4ZTF A;  3A0H C;  2DT5 A;  2ZNY A;  3NWT A;  1FSH A;  2Z9O A;  4DYQ A;  4MQ9 F;  4R1H A;  3K4N A;  4A93 J;  3LNQ A;  3CDL A;  2R5Z A;  1VFC A;  1R36 A;  3UKG A;  2NAZ A;  3H5A A;  5EEH A;  1D3Y A;  2J5O A;  3K7A J;  1NK3 P;  5HS9 A;  1JUS A;  2VON A;  2H1L A;  3CC4 I;  2F2E A;  3K6G A;  2K3F A;  1G3S A;  1XD7 A;  4KFC A;  4EJU A;  1YRN A;  2QSH X;  1H8A C;  2EFN A;  5F04 A;  2DQR A;  5ERI A;  3NWS A;  1G3W A;  2ZME A;  2QA4 I;  2JPB A;  3MAJ A;  2VKV A;  1V5F A;  1LE8 A;  1KA8 A;  1U5T C;  2LLK A;  1VQ8 I;  2XF7 A;  5ICG A;  4IVN A;  4V2G A;  2QUF A;  3F9K A;  3GTL J;  2STW A;  3BTJ A;  4YII A;  1ZEL A;  1C0W A;  5DDG A;  2EIM H;  1FMV A;  2P0W A;  3EUA A;  1QA6 A;  5FLX K;  1LPQ A;  1R4M B;  2DFF A;  4N9H A;  2BV6 A;  1DQU A;  2X1E A;  1MD0 A;  4MHG A;  1MMN A;  3HHG A;  1E0E A;  3K0L A;  1XCV A;  1J7K A;  2XAG A;  4E7I A;  2NVY J;  2LOO A;  2ISY A;  2P6T A;  2J5P A;  4I76 A;  4YFX F;  5FB2 A;  1K83 J;  4UXN A;  1J75 A;  2F6C A;  1FY7 A;  3DWL E;  4B1R A;  4UHT A;  4UVC A;  2NYX A;  1UG2 A;  1RR8 C;  2FE3 A;  3G6E I;  2OTJ I;  3K1M A;  1LVA A;  3GZ6 A;  1XGO A;  3L9F A;  4IHT A;  2DAO A;  4EJV A;  1R1U A;  4HQM A;  4ENJ A;  3GTP J;  3HKZ A;  1UFM A;  5TJJ A;  2E5Z A;  1I5Z A;  4F92 B;  1JHH A;  2Z3Y A;  1K4S A;  2PJR B;  2PJR A;  2BY3 A;  4CIC A;  4KMF A;  3H36 A;  5AIP A;  2E1M B;  2CU7 A;  1TWA J;  1Z1D A;  3F8N A;  3FZV A;  3VYR B;  3JRA A;  3DU5 A;  3HRU A;  4CH7 A;  3DBL B;  1QBJ A;  1BI1 A;  1MH3 A;  2CS3 A;  3GWZ A;  2OAZ A;  2ZKZ A;  4LG3 A;  1IZ1 A;  4AU7 A;  4F55 A;  4IKF A;  4CUG A;  4W97 A;  2K5C A;  4IHS A;  1Z3X A;  3AG2 H;  4UB8 C;  4CYD A;  1SEU A;  2DOA A;  2WA0 A;  3W2W A;  2EK5 A;  2M8E A;  4Q47 A;  4BU2 A;  1GHC A;  4HF1 A;  3GTO J;  1IUF A;  4A3K J;  2QKM B;  1ENH A;  2EIL H;  3BTI A;  1WH7 A;  3F3X A;  1A31 A;  2IAI A;  3D5L A;  3CD6 I;  4RS8 A;  1U5T A;  1FC3 A;  1UST A;  1BOA A;  1TLH B;  4I99 C;  4XLE A;  2H8R A;  3KEY A;  1IRG A;  1QGP A;  1USS A;  3KP2 A;  2LBF A;  4BHP A;  3LQR A;  3FK6 A;  2OQG A;  3TKY A;  3OV8 A;  2PG4 A;  4IHX A;  4I02 A;  2DMN A;  3HPG A;  2GM4 A;  4ANJ A;  2HYG D;  2P8T A;  5LBQ A;  2V1N A;  4FE7 A;  2JQ7 A;  3ZGK A;  3N05 A;  4II3 A;  4A5N A;  5J1R A;  3F6O A;  4I01 A;  1TWG J;  4C2M J;  2DA6 A;  2KRF A;  4ZJZ A;  1JTY A;  3U1K A;  1F4K A;  1QRY A;  1WRJ A;  1ZGA A;  1QVT A;  4LLN A;  2ZXJ A;  5J1U A;  4UNO A;  1D0Z A;  2OU2 A;  3FMQ A;  1FT9 A;  3RKQ A;  2Y9Z A;  1UCR A;  1ZYR F;  2XSJ C;  2I8D A;  4IHV A;  2HNH A;  3EQL F;  3I9V 2;  3PQJ A;  4FHT A;  4YFK F;  5ED4 A;  5D4R A;  3QPH A;  2E7X A;  1K61 A;  3I4N J;  1U8R A;  1U6G A;  3TOA A;  2BW3 B;  4CHU A;  3IH3 A;  5HLT A;  1HW5 A;  2V9P A;  4H4K C;  4WX9 A;  4UVB A;  3BRO A;  2N8G A;  5JVT A;  2FUG 2;  4BY1 J;  5FLV A;  2XF6 A;  2LY9 A;  3ECO A;  3VOD A;  2VQL A;  1VQ9 I;  1HKQ A;  5GTI C;  4Q4Z F;  4GRI A;  2QEX I;  3M7G A;  4PCQ A;  3R4K A;  3S2H J;  2O8K A;  1VQM I;  1FYK A;  3ZOB A;  1OR7 A;  5CVR A;  3MQ0 A;  2R7S A;  2DTR A;  1D1A A;  5E3O A;  1SD6 A;  2B9S A;  4PJL A;  2VBY A;  3JRF A;  5F6F A;  4UUS B;  1BM9 A;  4HLX A;  1BC8 C;  2MLG A;  2M34 A;  1WHU A;  3M07 A;  4A3C J;  2HFH A;  3PL8 A;  5BNG A;  1W4M A;  1XB4 A;  2DLL A;  3FHZ A;  2M7B A;  4ZC3 A;  1O7L A;  2LKX A;  5DYM A;  5B5E C;  5IT9 Z;  1WQ2 A;  3HGG A;  2JUG A;  3OYK A;  3CMY A;  3C2G A;  4M3B A;  3O8H A;  1FWZ A;  1TT0 A;  3V8K A;  3J81 Z;  4BE1 A;  1ZG3 A;  2HVQ A;  3KE2 A;  1XGN A;  3M4O J;  1T33 A;  4A6E A;  2CG4 A;  2JTV A;  3RZO J;  2V79 A;  2EV5 A;  4XLA A;  1ZR4 A;  4ESB A;  1XSX A;  2D5V A;  2Y48 A;  3DFG A;  4JYK A;  2HEO A;  4TV7 A;  3S3O A;  3DKY A;  2L9N A;  4CZZ A;  2FOK A;  1MJA A;  2L7Z A;  1J59 A;  3L7W A;  1XDU A;  5E1Z B;  4DGW B;  5L3E A;  5D8L B;  3I53 A;  1AU7 A;  3DPU A;  3OYM A;  1H9G A;  1TWF J;  2GZW A;  2ZB9 A;  1IV8 A;  1X3W B;  4RAF A;  1R7J A;  1SVM A;  4L5J A;  4BYY A;  1SMT A;  3BR3 A;  2KQR A;  3REO A;  3B6C A;  1VQP I;  3DKX A;  2LC2 A;  3CZ6 A;  4Y4R A;  4BS9 A;  3LQQ A;  3DXJ F;  1JKR C;  2ZJP F;  3QOE A;  1DGW Y;  3QPT A;  3WU0 A;  3SJM A;  2XUB A;  4E7J A;  3VB2 A;  5K5Q A;  4CGZ A;  3WTY C;  1IXR C;  4RAY A;  5LEJ A;  2R7W A;  1LDJ A;  1VQ7 I;  1WCM J;  3S1R J;  3GXO A;  1WJE A;  2LF8 A;  2PN6 A;  1UEL B;  5H2F C;  3A2K A;  3PIO F;  4OAZ A;  3JRH A;  2JRT A;  5E8G A;  5L3C A;  2QYO A;  3KYL A;  1MNM C;  1X3U A;  2DK5 A;  3LMM A;  4JBA A;  3AG1 H;  1Y0N A;  5IYC J;  1KQ9 A;  1W36 D;  5DEQ A;  3H0G J;  2FRH A;  4HZF A;  5DV5 A;  3VOE A;  4QWQ A;  1FPQ A;  4LOC A;  5EF6 A;  2IBD A;  2KP6 A;  1LUJ B;  3VSK A;  1MJ9 A;  4ZZL A;  3K1P A;  3R6S A;  5EGO B;  1N77 A;  3HOZ J;  5CVI A;  3IC7 A;  3BP8 A;  2MD0 A;  4XOP A;  2VKE A;  3DPT A;  4J00 A;  3W6J B;  2HOS A;  2H6C A;  1YQA A;  1LJ9 A;  5KVR A;  3C7J A;  2DA5 A;  3CUQ C;  4OMZ A;  4KA4 A;  1R00 A;  2QEN A;  2IVM A;  3DTK A;  4BQA A;  2WY8 Q;  4OIN F;  4OAY A;  3HG9 A;  2Y0S N;  3DU6 A;  4EM0 B;  2B63 J;  1X1D A;  2KJB A;  2QBY A;  2M1B A;  1R5H A;  3OY9 A;  1UHW A;  3JTH A;  1LB2 A;  2OZU A;  1YJ9 I;  1ZK8 A;  5L3D A;  4CO8 A;  3KLN A;  1BA5 A;  3AAF A;  1B59 A;  2AXL A;  2Z33 A;  1I6X A;  2VQG A;  2YPR A;  1IXS B;  4C3H J;  2M9H A;  3HKZ N;  1XS9 A;  2UUZ A;  1WKM A;  2HQN A;  1JKP C;  2O9L A;  2FBI A;  1S9H A;  2KMU A;  2L7F P;  5D4S A;  3W2A A;  3S17 J;  3IH4 A;  5J4V A;  3ASO H;  1YJW I;  4NHJ A;  1BR2 A;  5FLX Z;  2IS2 A;  3UNG C;  2NRA C;  1ZAR A;  5J3L A;  3J81 K;  3F6V A;  1GXQ A;  4PFO A;  5DM6 F;  1W0U A;  3ZMV A;  2NXN B;  2FNA A;  2C6Y A;  2QKL B;  4IHW A;  3B02 A;  3K4B A;  3FMR A;  3CO6 C;  2XHK A;  1ZAO A;  3PFI A;  5KAI C;  2LH9 A;  4EM2 A;  1DUX C;  3VYU B;  2WWY A;  2EZL A;  1IN6 A;  2H8W A;  4XKC A;  4E70 A;  4P9U A;  2BY1 A;  5F1J A;  4ETS A;  3JR9 A;  1X2M A;  5H20 A;  4BJ6 C;  4AID A;  2GQQ A;  2ESN A;  3KYC B;  2ELH A;  3TO7 A;  5GPA A;  5A2Q K;  3GTQ J;  2EIN H;  3QAH A;  3BLY A;  3BT9 A;  5J4Y A;  1ETW A;  2EZI A;  1GT0 C;  2GIZ A;  3CLQ A;  2ACJ A;  1I1S A;  1VQ6 I;  1T0F C;  1TT5 B;  3BQY A;  5FD5 A;  3AL0 B;  1ZLK A;  4A3G J;  5B1B H;  2KZV A;  4KN7 X;  4IOC F;  1YIO A;  2EZK A;  1FBS A;  4I09 A;  4E7K A;  3OR2 C;  5FJ8 J;  5H6Q A;  4XSX F;  4J01 A;  4IF4 A;  3HRM A;  1IG7 A;  2FQ3 A;  4ZYG A;  2V6E A;  4AYB N;  3OIQ A;  2WTE A;  1XTA A;  4OIO F;  3BR0 A;  4J19 A;  2IGM A;  1ON1 A;  4LK0 F;  4O3M A;  4BEH B;  1IN7 A;  2VBX A;  4FAS D;  2R7Z J;  1ZGW A;  2K9M A;  3BTC A;  4L5I A;  4PSX A;  1ITY A;  3AG4 H;  3PNY A;  3E5X A;  2FQ4 A;  2LF7 A;  1OIS A;  5F0H A;  2DTZ A;  1WJC A;  4UV9 A;  3AFH A;  1K4T A;  1WJD A;  4DJA A;  1O3Q A;  4DYR A;  4E7Z A;  3H9G A;  3G73 A;  1LFP A;  4XON A;  1P7J A;  3TGN A;  5IT9 K;  3RPU A;  4A3B J;  4BGD A;  1XSD A;  1OPC A;  1JJ6 C;  2FD5 A;  4P55 A;  3M1C A;  4DQ2 A;  3KPH A;  1VQN I;  3F0C A;  2WAD A;  5M5Y J;  2JA7 J;  3QYE A;  4RGX A;  5DD8 A;  1S7A A;  2R4G A;  1G8X A;  3VYT B;  1R1V A;  4YFN F;  3K2A A;  2CQX A;  2DPU A;  1W5C C;  1B9N A;  2E1C A;  4L9T A;  3ZCO A;  1DU0 A;  3CCS I;  1IN8 A;  3J80 Z;  3I56 I;  5HVQ C;  3M3Y J;  3H1C A;  1IDZ A;  4MTE A;  1B8I A;  2LKS A;  4NQW B;  3BJA A;  1ZQ3 P;  1ODD A;  3HOT A;  4JX6 A;  3T8T A;  3RYP A;  3TW7 A;  5FKO A;  3E3V A;  3A01 B;  3Q5F A;  1WI3 A;  5B1A H;  3M1E A;  3TDU C;  1FTT A;  2NS7 A;  1YHQ I;  4XRF A;  4G6T B;  4L5E A;  1RUN A;  5D5W B;  3VYS B;  1R23 A;  1T08 B;  3EUH A;  4KN4 X;  5LLQ A;  2UWM A;  1YTY A;  4C2T A;  2ZBK A;  1D0Y A;  1MDM A;  1W36 C;  1A04 A;  4A3E J;  1EKE A;  2EBI A;  1A6I A;  3RKX A;  3J7Z I;  3H0D A;  4BDZ A;  3HUG B;  3DBH B;  4UVA A;  2CQK A;  4ITV A;  1O3R A;  1Z7L A;  5CVU A;  1NK2 P;  4WXH A;  1WWX A;  5KK1 A;  5E20 A;  5DTD A;  4PUS A;  3VWB A;  3CME I;  2B7E A;  2X6W A;  1FP1 D;  1VQO I;  1IRZ A;  2A69 F;  3K10 A;  4KIG A;  3BZ6 A;  3CCU I;  5TIS C;  4XSZ F;  1OCZ H;  2LNB A;  2Q1Z B;  3PSI A;  4G94 A;  3RIR A;  5IP7 J;  3Q0W A;  1WGX A;  3JCU C;  2MH9 A;  2DMT A;  1JI8 A;  2IW5 A;  3ZPL A;  1BC7 C;  2F4O B;  1JHF A;  3BC8 A;  1R5I D;  2COM A;  3G3Z A;  4CCK A;  2DA2 A;  2E2H J;  2XGC A;  3GO5 A;  3WTV C;  2HKO A;  2ZC2 A;  4C30 A;  1HA8 A;  5CYV A;  3H3Z A;  1KU9 A;  3C2B A;  2VT3 A;  1DPU A;  1BOB A;  4ESJ A;  3BTL A;  3DEW A;  4NBQ A;  4BBR J;  3PM1 A;  2W85 A;  2WAQ N;  2PJP A;  2NS8 A;  3CUO A;  2KL4 A;  2ZJ2 A;  2RVC A;  4M3G A;  3J7A Y;  1TQM A;  2DCE A;  1BIB A;  2XVC A;  2YU3 A;  2DO7 A;  3KFW X;  1T39 A;  1RC9 A;  2LRD A;  2ZME C;  4HW0 A;  1WJF A;  2EH3 A;  3HSF A;  5KAF C;  2R7T A;  2NNN A;  3SQN A;  1S7O A;  5L3G A;  3JAM K;  2VLA A;  3RJP A;  1T56 A;  1RET A;  3GCM A;  3DCF A;  5CVJ A;  4V19 K;  3JRD A;  2VE9 A;  2L4A A;  4NUB A;  1G59 A;  4E6K G;  4KDP A;  1F36 A;  4KIC A;  2LG4 A;  4MLO A;  3F8F A;  3Q0U A;  4EQQ A;  3HBL A;  1SD4 A;  4IXA A;  5HDG A;  2L02 A;  1UAA A;  4BE2 A;  9ANT A;  1V5E A;  2DA7 A;  2X6O A;  3G1L A;  1TWC J;  1H0M A;  2XAQ A;  1ULY A;  2ADU A;  1TNT A;  2VJ4 A;  2GOX B;  3I0T A;  2YU9 J;  3CCL I;  1SFX A;  2Z99 A;  2BVL A;  3LSP A;  1GDT A;  2MLK A;  2OF7 A;  5FKN A;  2XRO A;  5CVV A;  4WWC A;  4L0Z B;  1TC3 C;  2WAF A;  5FO5 A;  3MZH A;  4PFP A;  1RRJ A;  1FIP A;  4N4N B;  1UZC A;  4HYE A;  2OUM A;  1P4A A;  1RES A;  1I27 A;  2HOE A;  4HX4 A;  3SYT A;  3V7R A;  5BS6 A;  1WZ2 A;  2Z2S B;  2GBY A;  1QVU A;  2EZH A;  3DPL C;  1R1T A;  1BR4 A;  4R79 A;  1YOV B;  4IQ4 A;  5HLI A;  4B44 A;  3L09 A;  5GAH J;  4QLC U;  1HW1 A;  2FX0 A;  2H1K A;  2A5Y B;  1DP7 P;  3D5R C;  1UMQ A;  1E3P A;  3V4G A;  4X1E A;  3RDI A;  2AXT C;  1YW7 A;  4WXD A;  2EV0 A;  2DMU A;  3HXL A;  1T2K A;  3ZQQ A;  3Q9V A;  4O6J A;  5M3M J;  4D7N A;  3GFM A;  3IV5 A;  4E4H A;  1KGS A;  4P5O A;  3WTW C;  3MKL A;  1NH3 A;  1W7P D;  4GO1 A;  4GCV A;  3GVA A;  2IGK A;  1YRN B;  5FRO A;  1OCR H;  2XPU A;  4K2E A;  3TO6 A;  4IHY A;  1B6A A;  2CW0 F;  2LYC A;  3IRQ A;  1LQ1 A;  1OCT C;  3L2V A;  1Z91 A;  3OS1 A;  4AVP A;  1W0T A;  2FOW A;  2EFP A;  4KIT B;  4MFD A;  3IUO A;  1PP7 U;  2W82 A;  2RC4 A;  4L9V A;  4U7D A;  4PJM A;  4U87 A;  1E2X A;  2R7O A;  2QQA A;  1R22 A;  1MGT A;  3BQZ A;  1WJA A;  2OJE D;  4PJN A;  3MKY B;  1OCC H;  2W48 A;  4RM3 A;  3X2Q H;  5K1Y A;  1TBX A;  1AKH B;  2F5F A;  1WJ5 A;  3GF2 A;  3U1D A;  4B43 A;  5LGN A;  5DM7 F;  5LFA A;  1GV5 A;  3K70 D;  5HLG A;  2JMW A;  4A3I J;  1JKQ C;  2V1D A;  4CCL A;  3I58 A;  1MBF A;  3ULQ B;  2K85 A;  2QM3 A;  2UXN A;  5J47 A;  3T0Y A;  2W25 A;  4BEH A;  5EJC A;  4E7H A;  2L2O A;  2ZFU A;  1X1A A;  2NVT J;  2VQH A;  1CGP A;  3CP8 A;  3V7S A;  3MEX A;  1K78 B;  1T95 A;  3E6D A;  1TNS A;  4IL6 C;  4MIM A;  2KKO A;  4A69 C;  1WI9 A;  5GAD J;  2R5Z B;  1U9O A;  3ABK H;  3LOC A;  3L2U A;  2V26 A;  3CO7 C;  1N78 A;  4DOZ A;  4XM3 A;  1GXP A;  4S05 A;  4LMY A;  3QRF F;  2DYS H;  1IN5 A;  2YX4 A;  1LEB A;  2KIS A;  1VI0 A;  1YG2 A;  4O5V A;  3DV8 A;  2RV8 A;  4G12 A;  3FXO A;  2QSG X;  5DUK A;  3FK7 A;  2YS9 A;  1I1G A;  3R0A A;  2LSO A;  2VE8 A;  3LAJ A;  4MNU A;  5IY5 H;  2K86 A;  3K1N A;  4M72 A;  2KDZ A;  4IRG A;  2QBY B;  2DMP A;  4PJJ A;  1MKM A;  5DCM A;  2AO9 A;  3LA3 A;  3OSG A;  2MA3 A;  2MC3 A;  1J09 A;  1X1C A;  1LKX A;  3ZQF A;  1L3L A;  2MSY A;  5ICF A;  1T8I A;  2RQQ A;  3DLA A;  3MCZ A;  1P92 A;  3FWE A;  1ZRC A;  3GLX A;  1KU7 A;  1ZGJ A;  4LG0 B;  5D6E A;  2Z1D A;  3KP5 A;  3IWZ A;  2WC2 A;  1FYM A;  1Y56 A;  1WSU A;  2R7D A;  3NEU A;  1HSJ A;  2XB5 A;  2MG4 A;  2GAU A;  3BG3 A;  2VPL A;  2K9S A;  2W1O A;  1B9M A;  2FSW A;  1Z9C A;  5JFR A;  4ZYD A;  1Z3Y A;  3OIP A;  1FNN A;  2ETH A;  4OU0 A;  1LDK B;  1Z6R A;  2G9W A;  2HWV A;  2HQ5 A;  2IXS A;  4ZYH A;  2H09 A;  2M3A A;  2XIG A;  2A68 F;  4M3F A;  4BQO A;  2MYS A;  4PGH A;  2YR2 A;  2E36 A;  3Q9S A;  2IP2 A;  3K70 C;  1PUE E;  4HSR A;  5FKM A;  1ZG5 A;  4BQQ A;  2HQA A;  3K4L A;  4EEF G;  2OD5 A;  3KP3 A;  3V8J A;  3A01 A;  3BR5 A;  2R7V A;  3CF2 A;  2WV1 A;  2MH2 A;  1MSE C;  4ON0 A;  4NQW A;  5B66 C;  2XSD C;  2KPM A;  1F9N A;  2CFO A;  4B4C A;  3GX4 X;  2G7U A;  4D7M A;  3KEQ A;  2ID6 A;  3OYC A;  3OL3 A;  2BHZ A;  2BY0 A;  1J0R A;  2KFD A;  2VXZ A;  1NG6 A;  2QQB A;  2W00 A;  3B6A A;  4YIF A;  3WTZ A;  1X58 A;  2DA4 A;  1EA3 A;  3FXM A;  4F3Q A;  1HKT A;  2HDW A;  3DP7 A;  4IZZ A;  1K78 A;  4M71 A;  2NOJ B;  3BR2 A;  5CQG A;  2R93 J;  3AL0 C;  1Y39 A;  5LRS A;  1O3T A;  1YX5 A;  3M8F A;  3FM3 A;  2RQP A;  2VQC A;  1BR1 A;  2QSF X;  1HQC A;  1MMD A;  1BL0 A;  2LDU A;  1VQ4 I;  3COA C;  4EJW A;  3A02 A;  3M8J A;  4MFE A;  3QYB A;  3TDZ C;  3JTG A;  3KLO A;  1KYZ A;  4G6D A;  2ZSI B;  2JK3 A;  2AQF A;  3ZQI A;  2E7W A;  4ZTJ A;  1YW8 A;  3WHB A;  2P4W A;  5JHF A;  1VZ0 A;  1YI2 I;  1HKS A;  2FEZ A;  2FF4 A;  3OOP A;  4B3A A;  2XB0 X;  2K9N A;  2KIQ A;  2XAS A;  2A6T A;  2JRM A;  2DDA A;  4GXO A;  2IA2 A;  3JRB A;  4A2U A;  4A3D J;  2CJJ A;  1FZP B;  5FKK A;  1DP3 A;  1MNE A;  3GFL A;  3CUQ A;  2R0Q C;  5E8I A;  1J2X A;  2UXX A;  3O2P E;  4F52 A;  1FP2 A;  4XK4 A;  2BZT A;  1FBU A;  3BZK A;  4U7B A;  3FKJ A;  3BWG A;  2A07 F;  1SAU A; 
#chains in the Genus database with same CATH homology
 3K4K A;  2Q2E B;  1X1B A;  4YEJ A;  3BLY A;  4II2 A;  3OS2 A;  4B3X A;  3VSL A;  3HOS A;  2E1M C;  1T0F C;  3AL0 B;  2VAS A;  2KZV A;  3BG7 A;  3UR3 C;  1MMG A;  3OYH A;  3RTR A;  1KON A;  1NG7 A;  2VJ5 A;  4E7K A;  3OR2 C;  1PJR A;  2DT6 A;  4J01 A;  4HG2 A;  4B47 A;  2KDO A;  2ZXH A;  3SZG A;  2V6E A;  3OL4 A;  3RPU D;  3DTI A;  3OIQ A;  2X85 A;  2IGM A;  3DEE A;  4F91 B;  4ZYA A;  2CUZ A;  4BEH B;  2R7R A;  2IGN A;  2V4J C;  1D1C A;  4FAS D;  4XNF A;  4E7S A;  4BXF A;  1MMA A;  2CW8 A;  2K9M A;  3E1S A;  2HU9 A;  4C9Y A;  4PSX A;  3PNY A;  2VXD A;  2L9S A;  1WJC A;  3PSF A;  5KCM A;  4XKB A;  4XKW A;  3AFH A;  1WJD A;  4DJA A;  4IQJ A;  4XLH A;  4E7Z A;  1OLT A;  3H9G A;  1LFP A;  4XON A;  3S3N A;  4BAC A;  4CZC A;  2CUJ A;  4BGD A;  4HNU A;  3IAS 2;  3M1C A;  3H35 A;  2Y0S A;  2WAD A;  1WFX A;  3OYJ A;  3QYE A;  1TZL A;  2HPM A;  2WY7 Q;  3BG6 A;  2R4G A;  1G8X A;  3VYT B;  4CA0 A;  1D0X A;  2R7U A;  3RCO A;  3A4C A;  3S8P A;  3OYN A;  3HL2 A;  3OYA A;  4BL0 B;  2KRC A;  3TMO A;  3ZCO A;  2OV7 A;  2L7K A;  5FRM A;  4ZTF A;  5HVQ C;  2MC4 A;  3NWT A;  4NQW B;  2M7A A;  3PFY A;  3HOT A;  3K4N A;  3I3L A;  3L2W A;  2O5R A;  2PMZ A;  4ZDO A;  2MAB A;  2ELJ A;  3OYD A;  3OYL A;  4G6T B;  3H5A A;  4LIV A;  3FHN A;  3VYS B;  3OYB A;  2A5W A;  4F93 B;  1IRX A;  2UWM A;  2L5Q A;  3CMM A;  3G2B A;  1PYV A;  3A1Y A;  3K6G A;  2R7Q A;  4C2T A;  3OS0 A;  1D0Y A;  1W36 C;  1R6R A;  4Y3O A;  5CPR B;  3V42 A;  3NWS A;  3H0D A;  4BDZ A;  5FRN A;  3HUG B;  4XN3 A;  2LY2 A;  5LD2 C;  4ITV A;  1V5F A;  1Z7L A;  3LSG A;  3PJR A;  1MND A;  1D1B A;  4XR6 A;  2XF7 A;  3H9J A;  3W3C A;  4PUS A;  3VWB A;  3FBN B;  2X6W A;  3F9K A;  3MD2 A;  3K10 A;  3PNT A;  3LSH A;  3SEZ A;  4XMY A;  3OYG A;  1ZEL A;  2Q1Z B;  3PSI A;  4YEL A;  1FMV A;  2P0W A;  3EUA A;  4B48 A;  1DQU A;  3D5S C;  2X1E A;  1MMN A;  2JA2 A;  3CJQ B;  1QHH D;  1JI8 A;  3L2Q A;  3CJR B;  2CV2 A;  1E0E A;  3OYE A;  4E7I A;  2LOO A;  3BC8 A;  4CCK A;  1UG0 A;  2LBF B;  3TL4 X;  2F5V A;  4YRV A;  2F6C A;  4C30 A;  3DWL E;  3CES A;  1X4P A;  1HA8 A;  2BW3 A;  4NNJ A;  3VDX A;  1BOB A;  2KL4 A;  1X4O A;  3J7A Y;  2DCE A;  4Y33 A;  1P9Q C;  3GBG A;  3HKZ A;  4HST A;  2LRD A;  3ZRG A;  2E5Z A;  1WJF A;  4D1Q A;  4PK4 A;  2IS6 A;  4F92 B;  4RMN A;  2R7T A;  4XKV A;  2PJR B;  2CMP A;  2PJR A;  4NC7 A;  2E1M B;  2VLA A;  3VYR B;  3DU5 A;  4NUB A;  4CH7 A;  4E6K G;  1G59 A;  2VB6 A;  2LG4 A;  4MLO A;  1MW7 A;  4BJT A;  2CS3 A;  4KJZ A;  4LG3 A;  3DQV C;  2VKH A;  4AU7 A;  2Z16 A;  4JOM A;  4F55 A;  4C2U A;  1ERD A;  3AKZ A;  4IKF A;  4CUG A;  2KHM A;  2K5C A;  2W4S A;  1UAA A;  1Z3X A;  4IX7 A;  4BE2 A;  2HVS A;  1V5E A;  2IGO A;  2DOA A;  2MFZ A;  2WA0 A;  3KX2 A;  3W2W A;  4BU2 A;  2VJ4 A;  2GOX B;  1X19 A;  2BVL A;  2QKM B;  3PNV A;  3S93 A;  2XF5 A;  2V7F A;  3D5L A;  2DXI A;  4X0G A;  1LVK A;  2WAF A;  4HRI A;  2X6Y A;  4PFP A;  2IS1 A;  1V5G A;  4N4N B;  4XLE A;  3KEY A;  3E0J B;  3QOD A;  2OUM A;  2VJJ A;  3SYT A;  2LBF A;  2Z2S B;  2XAU A;  2X6X A;  2LY1 A;  1N75 A;  4BJ5 C;  3HPG A;  2K9L A;  4ANJ A;  1AA7 A;  2V1N A;  3DPL C;  3ZGK A;  3N05 A;  4II3 A;  1BR4 A;  3LSI A;  4R79 A;  2X1D A;  4HPQ A;  3RQ4 A;  2WBM A;  4ZJZ A;  3U21 A;  4IQ4 A;  2JSP A;  4ZDL A;  4B44 A;  2CV1 A;  1D0Z A;  3D5R C;  4DBQ A;  2X51 A;  2VKD A;  2ZXI A;  2XSJ C;  2I8D A;  4BUP A;  2HNH A;  3I9V 2;  3OOU A;  3HXL A;  3ZQQ A;  2BOL A;  3EUK L;  2LRE A;  3W2V A;  4E4H A;  2ZSH B;  4P5O A;  2BW3 B;  5HLT A;  4XLF A;  2IGK A;  4QPQ A;  5FRO A;  4H4K C;  2FUG 2;  2KRH A;  1SFK A;  1QHG A;  3IP4 B;  2XF6 A;  2RRE A;  2LYC A;  2VQL A;  1GLN A;  3L2V A;  4RLF A;  4GRI A;  4XLC A;  3OS1 A;  4CCO A;  4KIT B;  3IUO A;  2W82 A;  4AVZ A;  4PJM A;  3S3M A;  3PUB A;  2R7O A;  4U87 A;  2R7S A;  3EPZ A;  2XDV A;  4CCJ A;  1D1A A;  4PJL A;  1WJA A;  4KIS A;  4PJN A;  2AQE A;  3MKY B;  3L2R A;  4RM3 A;  5HNF A;  3PL8 A;  2M0M A;  3C2H A;  1WJ5 A;  3HPH A;  4B43 A;  2M7B A;  1YX3 A;  5LFA A;  3IAM 2;  4ZC3 A;  3K70 D;  4QPO A;  4CCL A;  3LFU A;  3OMY A;  4BEH A;  2JUG A;  3OYK A;  4E7H A;  2L2O A;  2ZFU A;  4XL9 A;  3C2G A;  4KT6 A;  4ZDP A;  1X1A A;  2VQH A;  2GOM A;  3S32 A;  1TT0 A;  3CP8 A;  4BE1 A;  2HVQ A;  1T95 A;  3OWT A;  3K4J A;  1QU3 A;  2JVG A;  4XLA A;  4RLQ A;  3LL7 A;  4HEA 2;  2V26 A;  3L2U A;  4CCN A;  1N78 A;  3S3O A;  4DOZ A;  3DKY A;  2L9N A;  4XM3 A;  3SDB A;  1FMW A;  3H9Q A;  3MMY B;  4DGW B;  2WB1 A;  2WAQ A;  2BVM A;  3DPU A;  3OYM A;  4FET A;  2HPI A;  3EUH C;  2CH0 A;  1U0J A;  4EAT A;  2W7N A;  4CSW A;  2M4G A;  4BQN A;  3ZXS A;  4RM2 A;  5KNL A;  4E7L A;  2HZD A;  2KQR A;  4PJJ A;  2UV1 A;  2LC2 A;  3CZ6 A;  3DKX A;  4P1W A;  4Y4R A;  4BS9 A;  2JVH A;  3MKZ A;  2IS4 A;  3DTE A;  3QOE A;  1DGR M;  1DGW Y;  1J09 A;  2XC7 A;  1X1C A;  1LKX A;  2CW7 A;  4E7J A;  2RQQ A;  3DLA A;  2R7W A;  3LSM A;  1WJE A;  3H5R A;  1UEL B;  3FBI B;  2Z1D A;  4PSW A;  3TBI A;  3A2K A;  3CP2 A;  4OAZ A;  1Y56 A;  3ZR8 X;  1Y6I A;  4BE0 A;  3BCA A;  2VPL A;  3H5N A;  2W1O A;  3RSN A;  3KYL A;  2K3P A;  1Z3Y A;  3OIP A;  2V9K A;  2X1C A;  3LMM A;  1LDK B;  3QYF A;  1W36 D;  1Z21 A;  2IXS A;  5TGT A;  2M3A A;  2OC6 A;  4AYB A;  4BQO A;  2MYS A;  3ONQ A;  2KP6 A;  3SEQ A;  3K70 C;  3VSK A;  3OYF A;  4HSR A;  4BQQ A;  1N77 A;  2HQA A;  3K4L A;  4N4O B;  4DIQ A;  2KLO A;  4NC8 A;  2MD0 A;  2RNG A;  4XOP A;  4XOR A;  2R7V A;  3CF2 A;  3DPT A;  1YE9 A;  3K4M A;  5CKT A;  3OR1 C;  4JQF A;  4J00 A;  2DT7 B;  2KPM A;  2CFO A;  2E5N A;  2VIX A;  1OR7 C;  3OYC A;  2WAE A;  3OL3 A;  3DTK A;  2WY8 Q;  4OAY A;  5KHD A;  3HG9 A;  2VXZ A;  3DU6 A;  1NG6 A;  1X1D A;  2W00 A;  2HVR A;  3OY9 A;  3MKW B;  1EA3 A;  4F3Q A;  4XN0 A;  2HDW A;  4IZZ A;  2VL8 A;  5CQE A;  2NOJ B;  3AL0 C;  5CQG A;  2VQG A;  3LSK A;  2R7X A;  1YX5 A;  3K4C A;  4BDY A;  2UUZ A;  2VQC A;  1BR1 A;  1S9H A;  2KMU A;  4OWR B;  3W2A A;  1MMD A;  3FDY A;  1BR2 A;  3HC7 A;  2M4K A;  3M8J A;  2CV0 A;  2IS2 A;  3QYB A;  3UNG C;  2VJI A;  2ZSI B;  4XOT A;  4PFO A;  2AQF A;  3OYI A;  4ZTJ A;  2DJI A;  5JHF A;  3BCB A;  1VZ0 A;  5HNH A;  2E60 A;  4CCM A;  2QKL B;  4XQF A;  3K4B A;  2A6T A;  4HNT A;  2LH9 A;  4DBR A;  4LIT A;  3VYU B;  5HOO A;  4XKC A;  1DP3 A;  1MNE A;  1K6Y A;  1WJB A;  4LIU A;  4F52 A;  4BJ6 C;  4D9J A;  4U7B A;  3FKJ A;  1SAU A;  2F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...