2MC4A

The solution structure of the c-terminal domain of bldd from streptomyces coelicolor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
MEPPPKLVLDLERLATVPAEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAVASHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA binding protein
publication title The solution structure of the C-terminal domain of BldD from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2mc4A00
4OAYA 5KHDA 4OAZA 2MC4A
chains in the Genus database with same CATH superfamily
2I8DA 1FZPB 3DPUA 2LK2A 3ZQIA 3DU5A 4D5CA 1ETVA 2L02A 3R0JA 4EQQA 2V1NA 3H5NA 2K9SA 2P6SA 2Y48A 1IUFA 1LFPA 3BZCA 4N9IA 4XL9A 3TOAA 4PZJA 3K0LA 3F8NA 4GYIA 4EGYA 3BG3A 2WY8Q 1QZYA 5CJ9A 5C4JJ 1I3QJ 4MTDA 3ZQ7A 2FBIA 3OIPA 3TEDA 3BTJA 4HDUA 4Q4ZF 1CF7B 3C7JA 2M3AA 1VQ4I 1B6AA 1U3EM 5DV5A 1OISA 5ICCA 2M4GA 1YRNA 2AQEA 4K2EA 3J7AY 2Z99A 2P0WA 4BJTA 2IVMA 2ZMEB 4QSHA 3JTGA 2LC2A 1HQCA 1QVTA 2L9NA 4ABZA 1XSXA 4PJ0C 3FHNA 4YIFA 1JUSA 2KJCA 2B0LA 3QQAA 3VYRB 3K2AA 3I0TA 2OF7A 5H6QA 4XLHA 3VEPA 1F43A 1IDYA 1STZA 2PX9A 3AFHA 4XKWA 2QWWA 4XR6A 4OINF 4ENMA 3LSIA 1O7FA 3IH2A 4KA4A 2HDCA 2HZTA 4BEHA 4QPOA 2DOEA 1D0XA 4CA0A 2OQGA 4CHUA 4B4CA 4JP0A 2Y69H 4O5VA 4ZC3A 4EJOA 1I6HJ 4PJLA 2EV5A 2UXNA 5CYVA 1SVLA 1MMDA 2E5ZA 3OV8A 3CLQA 5KVRA 1RPWA 1UHSA 3FXOA 1MNMC 2CQXA 1SAUA 1FEXA 1HKTA 1SVMA 4S05A 2JRMA 3HZJA 4L0YB 2F5EA 3K4LA 2DA4A 3CO6C 3HRMA 4AU7A 2OC6A 1U5TC 2R5YA 1FOWA 4F91B 1R7JA 3OYAA 1KU2A 1J59A 1YJNI 2DT5A 1U9NA 3DBHB 5J40A 4I76A 4XSXF 1W7PA 4M3GA 5HDGA 3WTVC 3Q5FA 3I9V2 2GOXB 3BDDA 3GTPJ 3CD6I 4IOCF 4IO9F 3OYLA 2QGUA 4IF4A 1VQMI 2X48A 2Y31A 3K4MA 1IN4A 4B3XA 3HKZN 1MGTA 1TT5B 2CH0A 2CUFA 2IP2A 3DPLC 2PN6A 4G7OF 4FX4A 5EG0A 5KCMA 2LY9A 2G0EA 2L9VA 3FM5A 2VPLA 2K7LA 2L9SA 1OCTC 2STWA 5K7ZA 3M9AA 1OJLA 2ID6A 4A2UA 3WU2C 3SQNA 1Z91A 3S32A 1ON2A 4V2FA 3J7AO 4M72A 1KZHA 1XCVA 2H27A 3LA3A 1FP2A 3L7WA 2B7EA 2XV4S 2LRDA 4KN4X 3SEZA 2DK5A 2DK8A 2E1MB 4HQEA 4AIJA 2L54A 5LHIA 3I3LA 3NQOA 2OUMA 3JRGA 1JKPC 3GX4X 3CO7C 4G12A 1LDJA 1ZG1A 1QBJA 4PUSA 2EZLA 2XVCA 2EFWA 3EUHC 3LMMA 3OYJA 1T8IA 4RGUA 3MKYB 3KCCA 3KLNA 4B44A 4CSWA 5L3BA 2V6CA 4XRFA 3D5SC 2R7RA 1Z0XA 5F0FA 4UUSB 3A03A 1JKOC 3E6MA 2Y0SA 5DYMA 1RUOA 2LD5A 5M3FJ 2XF7A 3RKXA 2L0KA 3LSRA 3DXJF 3OYBA 1N78A 5LHGA 3PJRA 1ZK8A 1FYMA 2LOOA 3S3MA 2M1BA 4NC8A 5GP9A 2ECCA 4A0ZA 5D4RA 4UVAA 5E20A 1D8KA 5IOZA 2RN7A 2XAFA 1YW9A 4Q48A 5K7FA 2EB7A 1YIOA 4XN0A 2MA3A 1PUFB 3DEEA 3HXLA 2DFIA 2DN0A 1P9QC 3HGGA 3RTRA 1KYZA 4M3EA 1O3TA 4BY7J 2D1VA 2VL8A 4HNVA 1X1BA 1VQ8I 3AAFA 1FLIA 4BE0A 3WHBA 1Q1HA 3CUQC 4DYCA 1OCPA 1TNSA 2DXIA 2IBDA 5IP7J 3J81K 2WADA 3F6OA 5DUKA 4EJVA 5B1BH 4ITVA 3JRDA 4UXNA 1XX5A 4C30A 2BYVE 3CCLI 2W84A 1UELB 5B3SH 4H0EA 1TLHB 2M5WA 3BQZA 3HC7A 3TW6A 3EUAA 2QQBA 2LSOA 1MDMA 2DFEA 2PLYA 3V7RA 4A5MA 4AIKA 1EF4A 4BHBA 3EETA 1OYYA 4BU2A 5DCMB 4G9YA 1BM9A 4WWCA 2F5CA 2XSDC 2Z1DA 1FSEA 2VXDA 1MJBA 3D1NI 1NTCA 2X51A 2IAIA 2ZNYA 1B9NA 4IXAA 2CG4A 5D6FA 4IL6C 2KQRA 1FY7A 3AKZA 5J8FA 1K78A 4FE4A 1MJ9A 3BOQA 1IXCA 4W97A 2COBA 3WTTC 1IRXA 3PUFA 2YU9J 4CYDA 3HOWJ 2WWYA 4HX7A 5BQTA 1UG2A 2CUZA 3JCUC 1ZREA 3K4JA 3F22A 2HQ5A 4DQ2A 2HZDA 4RS8A 5HLIA 1SFUA 4HF2A 3OSGA 2STTA 4YG2F 2IGNA 3K10A 3K4CA 2DA2A 4KJZA 2DPDA 3AL0B 1ON1A 4QLCU 2DYRH 2VI6A 4P5OA 2R5ZB 3S14J 2LYCA 2X0LA 1G2HA 1BW5A 3HTUA 4EMSA 2C6YA 5FKMA 1YRNB 1SFOJ 2V4JC 5H2FC 5M5WJ 3A1YA 1SANA 4MQ9F 1TZLA 3M7GA 1KU9A 5HS9A 5IT3A 5D5VB 3DBRB 3S3NA 2P4WA 1NH3A 1GDTA 1IRFA 1Y56A 2A69F 4BY1J 4LB5A 2V1DA 1BI2A 2MLGA 5CVUA 3G1OA 3GZ6A 2W85A 2DODA 4I6ZA 4ZJZA 4EJWA 1HOMA 2WAEA 3H3UA 4GXOA 4UB8C 1AU7A 4MHGA 2E1MC 1XS9A 2FNPA 2NAZA 4XRSA 2BHZA 4PFPA 5F27A 4FETA 4HW0A 1J2XA 1BOAA 4NNJA 1W5SA 2HOTA 5B5EC 4HLYA 1K7AA 4IX7A 3BTIA 1JE8A 1ORKA 4IPAA 1FSHA 4XM3A 3EUKL 1S7AA 2DA7A 3M07A 1DGRM 4EM1A 2DA5A 2DJIA 3UNGC 3QODA 5K1YA 3J80K 3CDHA 4M3DA 2A05A 2PMZN 2JA8J 4RAYA 2XAJA 1KQ8A 4A0YA 2KZVA 3S1MJ 1T39A 4BHPA 3H3VK 2K5CA 3K1PA 3JRAA 1JT6A 3CMMA 3HG9A 4MFEA 5E1ZB 2HI3A 3U21A 2R5YB 5IP6A 2K9NA 3OYHA 4AUXA 2DT7B 2HKOA 4ON0A 1IRZA 1F36A 5F0HA 4A3KJ 4XONA 2BVMA 2KRCA 3CCMI 3GTJJ 2O7OA 1BR4A 2FBHA 3E97A 4DYRA 2XAGA 2V79A 3PM1A 2P8TA 4BDZA 2W25A 2ZNZA 3DTEA 1YITI 2E34A 5EG0B 1K4TA 3N97A 2NS7A 4EGZA 1G3TA 2K40A 4O3MA 2E7XA 2VBWA 1IAWA 5K5RA 3HB9A 1D3YA 3GFMA 4I98B 2O0YA 5J6XA 2FXAA 4BH9A 1AA7A 2YUSA 4IHSA 1JUMA 2O3FA 3BR2A 1IRGA 3C3WA 1EA3A 3V8JA 2M34A 3ZPLA 3GTMJ 2H8WA 4C2MJ 1V5GA 2CSOA 2MW8A 4R79A 1ETYA 5EF6A 1IC8A 1AKHA 5E3OA 5FLXK 3LFUA 1BC7C 9ANTA 2MGQA 2RV8A 2Z2SB 3R4KA 4E7ZA 2P7CB 1X3UA 2KRHA 3C2BA 1SD4A 3WTWC 1WH5A 1LJ9A 1QNTA 2DFHA 3MCZA 4EV0A 4NDLA 2KMUA 1OR7A 5HS8A 1XSDA 2ZJPF 3K69A 3RZOJ 3CF5F 2V1XA 5IT9Z 2BOLA 5IY5H 2DMNA 3IH4A 2UUZA 4DYQA 1OLTA 1S7OA 1RRJA 1O4XA 1D1BA 3JTHA 4XOPA 4GO1A 2IEKA 2O03A 3S1RJ 2OTLI 2QSGX 5GAHJ 5FGMA 3E7LA 4WXDA 1I6XA 2M0CA 1GXPA 2RGVA 1MSFC 2LTPA 3GEZA 1G4DA 3Q3SA 2OQRA 2FEZA 2X1CA 3CUQA 2WBMA 1IN5A 5D5UB 2KIFA 2W48A 1ETWA 4AM3A 4DNCA 2QM3A 4IJAA 2COMA 3BPVA 1WRJA 3NAUA 3BZKA 1MBEA 2JUGA 3OOUA 1Z7UA 3QYBA 1EV7A 1C0WA 5DD8A 3H36A 3VYTB 4F7ZA 1J09A 2VE8A 4OIOF 5F64A 4RB2C 4Q47A 3I55I 3MWMA 1ENHA 4D1QA 2PFBA 3BC8A 3DU6A 3OSFA 2VC0A 1LUJB 3TKYA 4LG3A 3LSMA 2DAOA 4OMZA 3ELKA 4B48A 1JTXA 3FM3A 3B6AA 3M1EA 4G7HF 1Y0NA 4J01A 1G3SA 4BUPA 4HPQA 5H20A 4RGXA 2P5LC 3TBIA 1ZGAA 1HKSA 1E17A 3DBLB 4BHCA 2V26A 5A2QZ 4XQFA 4FQGA 2O6GE 1MMSA 2DMQA 5K7HA 2B9SA 3KETA 1S6LA 2RNJA 1HSJA 2A68F 3H0GJ 3TDZC 1J9IA 2M4KA 2PEXA 5DM6F 3CCVI 2XGDA 5JFRA 3DTKA 5FB2A 2CV1A 4Q5SF 2HS5A 1B9MA 2PMUA 3ABLH 4A3FJ 2J5PA 2F4IA 5C4XJ 1RC9A 1FWZA 1X1DA 3HRUA 4XLCA 5E3MA 3IH3A 1K78B 3Q0WA 3S16J 4BS9A 3EYYA 1OYIA 1ONVA 2NXNB 3TQNA 1AOYA 3JREA 1T6SA 4N9HA 3F8FA 4AD9A 4DOZA 2HVRA 2KP6A 4OU0A 1XGMA 5BS6A 2Y0MA 4XLFA 2JSCA 4LD5A 2DOFA 4M9XA 4HG2A 1Y0UA 2QQ9A 1IW7F 2H6CA 3MN2A 3ZQFA 3WGIA 2JTVA 2DFFA 5DS9A 1XTAA 2L2OA 3NRVA 4KNYA 1HW5A 2XASA 4N0BA 2R7SA 4HNUA 2NOJB 1QGPA 3KPHA 4HF0A 1QPIA 4IHXA 4CYCA 2M7AA 3MEXA 2Y9ZA 2XF6A 1XD7A 5E1WA 4UVBA 3MAJA 1UHWA 5D5XB 3V4GA 4NHJA 2XB5A 4WCGA 3SZTA 3GVAA 2EZKA 3HUGA 4YFXF 2AS5F 4E70A 2ZBKA 3B73A 2ICWG 1DUXC 2DQLA 1ODDA 5D8LB 4MGRA 4F92B 3HIFA 2QBYA 3G1MA 3DFGA 5LFAA 4NQWB 1MNEA 1R22A 1U5TB 3AG4H 2DT6A 3KZYA 2BY3A 3CZ6A 1GVJA 1R1VA 4PDKA 1A31A 3ZQQA 3A02A 2KPMA 1DQUA 3BLYA 1PDNC 2W7NA 5E79C 1O7LA 3HL2A 1K4SA 1G59A 2LFBA 2XAHA 1UCRA 2L7KA 5FRNA 2HOSA 2LNBA 1U0JA 2FOKA 5L3GA 4ESJA 4UUVA 1TBXA 1WGXA 2DLLA 1JGSA 2ZJRF 1PJRA 1XDSA 3DKXA 5CVRA 2P81A 1RKWA 1FPQA 2ACJA 4D7MA 1YI2I 2HGCA 3CP8A 2JZYA 5D5WB 3OL3A 4L9NA 3K2ZA 3KYDB 2DA1A 2VJ4A 2NVYJ 5ED4A 3S2WA 2ZFWA 1UFMA 3J7YJ 4MQVA 4XLAA 3VDXA 5F1JA 5KNLA 1TWHJ 3W3CA 1HKQA 3I59A 2FE3A 3BZ6A 4UHTA 4KDPA 4A5NA 2NOGA 4BACA 1R5ID 3BROA 1U6GA 4ANJA 2JWTA 3LFKA 3SDBA 5H6RA 1TL8A 1Y8QB 3KP2A 3A0BC 4I7HA 4FX0A 4MLOA 4JBAA 2LVSA 3GW2A 3SHFA 2DU9A 3F6VA 4FT8A 4M9ZA 5FKNA 1HC8A 3VWBA 4I0BA 3U1KA 3IKVA 4DZJA 4KN7X 2NVXJ 2X4HA 2HVQA 2EIKH 3WG7H 4X6AJ 2K3FA 3G1LA 4HX8A 2KIUA 3MFKA 1S3JA 2K9MA 3OYIA 2ELJA 3GMEA 3OYEA 3CCRI 2L01A 3ZQLA 3RJPA 2MLKA 2KFDA 1S29A 3JSOA 4BAYA 3L1PA 2DTZA 1O3SA 2VT2A 3E0JB 4LLNA 2CWEA 2JUCA 4M3FA 3RYRA 3CMYA 4BYYA 4HDVA 4BXFA 1SMTA 3HOTA 1IUYA 4EVIA 4S0HB 5HDNA 1ZG5A 3I53A 5GPCA 3CUQB 1BI0A 3VYUB 1MBGA 2IGOA 5CQEA 2ZXJA 4F3QA 1ZN2A 1LPQA 1FJLA 4IOAF 1V3FA 4YEJA 1SD7A 2AXTC 2VJJA 2VB6A 3W2VA 2E60A 1E0EA 1GUUA 2CW7A 2HYGD 4PCQA 3FF5A 2OZ6A 3QPTA 2Q2EB 4ASNA 5AIQA 2L7MP 4AIDA 1UG0A 2DW4A 3HOVJ 4UB6C 4IZZA 2G7UA 4ZDOA 1QPMA 2R7FA 4A6EA 5FKLA 4GCVA 4ZYGA 3HYIA 4PSXA 2UXXA 2QEXI 3DWLE 2EZIA 4IHVA 2FMYA 4YFNF 2EINH 2HNHA 3T0YA 1LQ1A 1Z21A 2Y9YA 2MC4A 3CUOA 1LB2A 1DU6A 4XICA 3TO7A 3CCQI 2R0QC 4CH7A 2BHYA 2L7FP 1SEUA 3H5RA 4OMYA 1XMXA 4F55A 5GTIC 3PNTA 2BVLA 1E2XA 3L2RA 1YX3A 1WJAA 3KYCB 5JLWA 2IA1A 2GBYA 2GIVA 5E3LA 2M30A 2IGKA 2I10A 1EKEA 4U0WA 4L9TA 2DA3A 5EGOA 1UJ8A 3BQYA 2QA4I 4HOBA 1VQ7I 3PIPF 3IP4B 3MMYB 2BXYA 3NWSA 2VT3A 3DEUA 2P5VA 2ZJQF 1B72A 2JSPA 3LQQA 4M6XA 2RDPA 2A07F 1TQMA 1T98A 3RSNA 2MG4A 4I02A 3ZQHA 1XGNA 4JOMA 5E8GA 1PP8F 5F0CA 4XKCA 1W7PD 1VTNC 1I39A 3U1DA 2VQCA 2PQ8A 3LSKA 4O6JA 3GCMA 5L3DA 2Z9OA 3LAJA 3ULQB 2EV6A 2R7WA 4U87A 4CYCB 2W57A 3GF2A 4XORA 2LBFA 3SDGA 4BBRJ 4CCJA 4AWXB 4JQFA 4U7DA 2GWRA 2P6TA 1J7KA 2JA2A 4N4OB 4LLGF 1TTYA 1AWCA 1GT0C 3HUGB 4Z2YA 4HSTA 3W6KB 3D5LA 2ZO4A 3T8TA 2IS1A 2WA0A 3MZ8A 3H9QA 4Y4RA 4A3GJ 5LGNA 3BR6A 2QBYB 3EPZA 3HEFA 3CJQB 2K3PA 1ETQA 4QIWN 3FXKA 1OR7C 3K4KA 1JHFA 2X6OA 3L2UA 4KT5C 3KX2A 1BI1A 2IA2A 2XC7A 3CP2A 1QVUA 3KP5A 1I5ZA 1HXDA 4JX6A 2R7TA 3FDYA 4WXHA 1OFCX 3BG6A 2ME6A 5KHDA 1X1CA 2DJNA 2RNGA 3CLOA 1A5JA 3O3KA 1RI7A 1HW2A 1R4NB 3CF2A 2XKOA 1UZCA 1ZR2A 1R1TA 2EBIA 3CQZJ 4I0AA 3DLAA 1NG6A 5B66C 3VSKA 5JHFA 1SFXA 2L4MA 4BQAA 2B63J 2BY1A 3PFYA 3ABKH 3RPUA 5HLGA 4PGGA 1Y8RB 1WWXA 3LL7A 5LRRA 1T08B 2V7FA 4R8HA 3U2RA 1LE8B 3QAHA 3S3OA 3V7SA 1FX7A 3DV8A 2X1DA 3ISPA 3KE2A 2QVOA 1MBHA 1N25A 4C3IJ 1MMGA 1BN5A 1SC7A 3BR0A 5E18F 1JI8A 2VKEA 3QYFA 3M8EA 1F5TA 1YFHA 3K6GA 2JMWA 2KIQA 5FD6A 4LMYA 1Z3YA 1OPCA 2H1KA 3FK6A 1Z6TA 2F2EA 4JYKA 3RPUD 5IYCJ 1V54H 2ZFUA 5BMZA 2YX7A 5FLMJ 1WCMJ 4G8XA 4KMFA 2EFNA 2TDXA 4RM3A 3FMSA 3IL2A 2HR3A 2H94A 3V7CA 1QQIA 4FCYA 1ITYA 3KIOA 3IRRA 4HX4A 3UR3C 2PMHA 4NB5A 3BP8A 4BKXA 4HAMA 1BIBA 3OYDA 2VQLA 2H1LA 3S2DJ 3BCBA 2X6WA 1IJWC 3CCYA 5BPDA 3QU3A 2MC3A 4WF2A 4CGZA 1HDDC 3E5XA 1U9OA 2YPRA 5CPRB 2L7ZA 1N77A 2CQKA 2HDDA 2EH3A 3L2VA 1ZLKA 2OZUA 2PI0A 2KL4A 1B8IA 2M7BA 2DYSH 3LQRA 1ZARA 2EQRA 3K1NA 3VOEA 3E3VA 2E35A 3HHGA 5DDGA 2VASA 4LK1F 1K61A 2CFXA 3HOUJ 1IN7A 5CVVA 1YE9A 1T95A 1KQ0A 1EH6A 2XAUA 1R1UA 3QWLA 2EV0A 4E7HA 2XB0X 3FXRA 4LFUA 4CDGA 4Y13A 4LGWA 1M1EB 3H9JA 3ZMDA 1PP7U 3BJAA 1ULYA 2TCTA 2OJED 1LEAA 4W1UA 2FBKA 4IQ4A 2HQRA 4BEHB 2R7QA 1PVEA 4RM2A 1T0FA 3MQ0A 2HYJA 2D1HA 4UV9A 3P9IA 1YQAA 1L0OC 2BY0A 4I09A 1TNTA 1JXSA 2VPRA 1MNDA 5FFZA 3L2CA 1YO5C 3ZR8X 3BTLA 4NUBA 4ZZLA 2VKVA 3MKLA 2GOMA 1A36A 1EH7A 2BV6A 3X2QH 4BE2A 1NG7A 1RKTA 3OMYA 1F1ZA 3GTGJ 4RLQA 3I64A 3ERED 3JRCA 1Y1WJ 1AHDP 1G6NA 4KISA 1W5TA 3WE2A 4I01A 3Q0VA 3P9KA 4U88A 1XCBA 2XPUA 1X58A 3ZMVA 1W0TA 2DO7A 3Q9VA 1W7PB 4L9VA 3TP3A 2W00A 1QZEA 3IC7A 3JR9A 2EA2A 1BW6A 3TOBA 2K9LA 2G7HA 3K7AJ 4OIRF 2A6HF 1FOYA 2HQNA 2MBFA 5EGOB 4A6DA 5J4YA 3SFZA 3BWGA 1T33A 5LEJA 1LVKA 1YTYA 2LP0A 3OWTA 5J8CA 3QOEA 1Y39A 2L5QA 1B72B 3ZN0A 1NK3P 1YS7A 2ISZA 4WXCA 3IWFA 2R7XA 2HU9A 2N8GA 3GLLA 1R6RA 1APLC 1IZ1A 1S5LC 1WKMA 3OYKA 3H9GA 1OCOH 1YS6A 1VF9A 1R5GA 2YS9A 2FU4A 2JRTA 3LA7A 3OS0A 1V5FA 3LWFA 4AIHA 4P9UA 2MABA 2GA2A 2WC2A 3GWZA 1K6OA 5JR3A 3V8KA 5FJ8J 4DZPA 4CCKA 4UVCA 5ICFA 2LBFB 4B47A 1Y6IA 5TISC 2VKHA 1B59A 1UAAA 1JTYA 1Z05A 2ETHA 1YX5A 1V55H 2GXAA 5E3NA 4FE7A 1BA5A 4MEXF 1DGWY 5C44J 1GLNA 4II3A 3KLOA 2DDAA 1XGSA 1RR7A 1OKRA 2ESNA 3OIQA 2K4JA 1TWGJ 3W6JB 4ENNA 2R4GA 5D8KB 1E3HA 2M0MA 2M45A 3DQVC 3EQLF 2HDWA 3PL8A 3FMQA 1USSA 3TMOA 2VE9A 4PJNA 4IQJA 1A35A 2K02A 3LA2A 1U2WA 4HLXA 3KFWX 3PNVA 3QU6A 1LVAA 1MBFA 1ERDA 3HSEA 1JJ6C 4RBOA 5IYBJ 2QYOA 1YHQI 2D5VA 2HVSA 3PO2J 4L5IA 4OWRB 1Z6RA 5F6FA 2LREA 4KUMA 4RB3C 1MW7A 2BY2A 2M8EA 1FTTA 1WJEA 2Y2ZA 1ZRCA 4ZYHA 4EATA 4OIPF 2DI3A 2QZ8A 2QSHX 3IAM2 1CF7A 2PBIA 2Z3YA 1W0UA 1O3QA 2EA4A 3BPXA 3H35A 4XLPF 3ONQA 4BE1A 2HYFA 4AYBA 1EH8A 5HOOA 1ZGWA 1A04A 1Z9CA 3F8BA 1S7EA 2VBZA 3JAMK 3GFIA 1PYVA 1TQPA 2IS2A 1K79A 4GYGA 1G8XA 2DMUA 1TWFJ 5TGTA 1MDMB 2E36A 5ICEA 1CGPA 1ZG3A 2HKXA 4X1EA 3W2WA 3H0DA 1YG2A 3WHCA 3E5UA 3V8LA 3H92A 2EFQA 2MYSA 2MD0A 2X1EA 2W82A 1MKMA 3PNYA 2QQAA 2EWNA 3ZMSA 2F4OB 2V9PA 5C3EJ 1X1AA 2R93J 4G6QA 2HXIA 5J1RA 4Z6YA 3TW7A 4IHWA 1HA8A 1BR2A 2VBYA 5F1RA 4G6DA 3CCUI 3TO6A 4BQNA 5IP9J 4L5EA 1W4MA 5ERIA 1D5VA 1OCRH 2JPCA 2ZCWA 2O61A 1FIPA 1D1AA 2A5YB 3B02A 3AG3H 4YELA 2GZWA 4DBQA 2DCEA 5GTHC 3CCJI 2ADUA 2RQPA 2LMDA 4OAZA 2M2EA 2V1UA 5ILUA 1SD5A 3CCEI 2EPFA 3BR3A 4J19A 2A6TA 1P4WA 1HDPA 4M74A 3FBIB 1LFBA 1OMIA 1BR1A 4MNUA 1IG7A 2IS4A 1HSTA 1P4XA 4FISA 5DD4A 5HLTA 3GFJA 1W36D 3S2HJ 1GV5A 5EZGA 2VJIA 5E8IA 4RB1A 3LSTA 3DLLF 2NNNA 3E6CC 4E7IA 3BG5A 4KITB 1A6IA 2EIMH 3SJMA 3K9TA 3QP6A 4XK4A 1FYKA 1I27A 3QYEA 4G94A 1BL0A 2QCOA 3ZMZA 3CJRB 2F48A 3H3ZA 2VUMJ 1OCZH 3IKTA 3JW4A 2EJRA 4N4NB 2LKSA 4BXUA 2MD5A 1X3ZB 3TGNA 5A2QK 2HTJA 2PJPA 1I3AA 4XOTA 5GAGJ 2JA6J 4FASD 2HPIA 3ZMUA 2KDZA 1G3YA 1PUEE 2FOWA 2NVUB 1VQ6I 1TQIA 3F23A 5KK1A 3HOSA 3BJ6A 5J1YA 2KRFA 3ERMA 2K85A 2KISA 3K4BA 4MTEA 4ZYEA 2D2WA 2VOPA 1ZGJA 3KP3A 3VFZA 1R00A 3FXLA 3T5XA 4UUTA 3EDPA 4HSRA 5J47A 2XF5A 1ETOA 4F93B 4V2GA 1CQTA 1H9GA 4R1HA 1REPC 3HRTA 4L9JA 4UUSA 1ZH5A 1SFEA 3GZNB 3I5UA 1WQ2A 1JUPA 1JKRC 3G4SI 3REOA 3W6VA 4CO8A 2VQHA 3H1CA 5HS7A 3T8RA 2Z5UA 4CZZA 3M3YJ 2K27A 1B1BA 4EM2A 1VQ9I 3MKZA 1MIJA 3R0AA 3SZGA 1DPRA 3EYIA 1ZTRA 4A3EJ 4M71A 5JHUA 2OTJI 3VB2A 1P7IA 2ZSHB 2XDVA 4Y3OA 4BQOA 5K5QA 5J4VA 1UHMA 2ISYA 3KP6A 1OYWA 1W1WE 1J75A 3LSHA 2AO9A 3HJEA 4EM0B 3MZYA 1RETA 2OCEA 3OL4A 4A3JJ 1FOXA 4XNFA 3BG9A 2Q1ZB 1L3LA 4DIQA 2ESHA 4A3MJ 1AKHB 2GQQA 3DTIA 3QPSA 4A12A 2GXGA 3F0CA 2A6EF 4LG0A 2DQRA 1HLVA 1WJCA 2ZXIA 4ZYDA 1YW7A 2VN2A 4HYEA 2H8RA 2ELHA 1JGGA 4PJMA 2UZKA 1VI0A 3FXUA 1GHCA 2XAQA 1TW3A 2EIJH 5DCMA 4E7LA 4ZTJA 1X4PA 3LSJA 2XIGA 4E7KA 4XRMA 2WB1A 1IDZA 1WPKA 3BTCA 3NARA 1QZZA 1ZAOA 1IO2A 5HLHA 3ECHA 2CGPA 3GUDA 2Y30A 4NC6A 3WTZA 4WK8F 2ELKA 5GPAA 2HQAA 1E3PA 3S8PA 3DPTA 2Y75A 3WGHA 3OYNA 1ZRFA 1QHGA 2HOEA 2QQ8A 5HODA 1XGOA 3CTAA 1D1CA 1MSEC 4QTRA 2LG4A 1WZ2A 1QU3A 1WHUA 2XGEA 4MIMA 2XGXA 4B09A 4A3DJ 4RAGA 4GDFA 2GAUA 4U0YA 2HPMA 4HF1A 1J5YA 2CQ7A 1IGNA 2MH9A 3OY9A 2Z33A 1MMAA 2R5ZA 3WGGA 2KLOA 1LNWA 2LKPA 4KFCA 2YX4A 1BJAA 3RZDJ 5L3CA 2ID3A 4GRIA 1FBUA 1KGSA 2FD5A 3OYFA 2QLZA 1X2NA 3N05A 1RUNA 5LRSA 1LFUP 5AIPA 1T0FC 4EJUA 3HDDA 1JHHA 3C1DA 1JJ8C 3IUOA 4I2OA 4IRIA 4ENKA 2WV1A 4OOIA 1ZRDA 5HNHA 3IWZA 5ILSA 4IVNA 1ZR4A 4RGSA 1D5YA 2CUEA 4IHTA 1GXQA 3DF8A 1QA6A 2O9LA 2EILH 3V42A 3G71I 1VQOI 1KU7A 4IRHA 4KIFA 2CO5A 4HBLA 2XGCA 5F04A 2E7WA 3ABTA 2IRFG 1ZLJA 4XSZF 2DPUA 2F5FA 3ZOBA 1MD0A 4A69C 1WH7A 2IW5A 4E7JA 1DPUA 4XIDA 3RCOA 3VYSB 3FK7A 2CJJA 3L00A 2DA6A 3LOCA 1VFCA 4HNTA 4RB0A 4ZZDA 3M1CA 2E2IJ 4PK4A 3CC7I 4CCOA 2UWMA 2FX0A 4TV7A 2E5NA 1IXSB 3IHUA 5HDKA 4M3BA 1WFXA 2E2JJ 2HOAA 2GIZA 4HV6A 2O8XA 3VPRA 3RDIA 4Y17A 1OCCH 5EDNA 1RR8C 1SMYF 1U8RA 1S8NA 5JI6A 2L3DA 2MFZA 2CV0A 3DKWA 1XSVA 3F72A 4YFKF 5DTDA 3QPLA 4JK1X 4XKVA 2VC1A 3HHHA 2PJRA 1LDKB 3M8FA 3C2GA 3S93A 3J81Z 4D0PA 1Z7LA 1Z3XA 2BBYA 2VBXA 2XSJC 1FT9A 3GTOJ 2QSFX 2LY1A 5BPIA 2M8GX 5LBQA 3KEQA 1N75A 2A3SA 5CLSA 2F5DA 3GTLJ 3L2WA 3HBLA 2R7ZJ 4G6TB 1FTZA 4HV5A 2DMPA 1QRYA 4KICA 3I54A 3P5JA 3S17J 2ZJ2A 3B6CA 1GVDA 2H09A 3RIRA 2JVHA 3I4MJ 4PGHA 1RNLA 2IS6A 1ZKGA 4BBSJ 1T56A 1VQKI 2FF4A 2XRLA 2IXSA 3UKGA 5EEGA 1JT0A 1R71A 4HRIA 1R36A 1D8JA 3ZCOA 3CC4I 1O57A 3ABMH 2DMTA 1O3RA 3I58A 3RKYA 3CMAI 2ZSIB 3GTQJ 3G2BA 2D45A 1QHHD 3GO5A 1BIAA 3OIOA 3HSRA 2NNYA 3M4OJ 4KT6A 3TP0A 3S1NJ 2E71A 2ZC2A 3L09A 3I56I 3DCFA 4LOCA 3E6BA 3A01A 1ZHFA 4PSWA 3FXMA 4L0ZB 1D0ZA 4H4KC 3PIOF 1UB9A 1W5CC 1X3WB 2QF7A 4I99C 2E1CA 1KQ9A 5KAFC 3WE3A 1KU3A 2VONA 4OAYA 3I59B 2M87A 3K70D 4CZCA 2CYYA 1XMAA 2V9VA 4Y33A 2FMLA 3G6EI 2JA7J 2ZMEC 1BJZA 4ESFA 2WAQN 4A3IJ 1R9TJ 2L9RA 3O8HA 3D5RC 3IAS2 2W1OA 2WAFA 2O5RA 1VQLI 5DUIA 4YIIA 2RAEA 1XG1A 1YW8A 5B1AH 1VQNI 2G9WA 1R4MB 3JRIA 5JVGF 1P2FA 3F8CA 2WTEA 3MZHA 3BY6A 3HRSA 4LG0B 4P1WA 3CCSI 2J5OA 1U78A 4KYWA 3GZ5A 4S04A 4QPQA 3KZZA 4XMYA 4UV8A 4U0VA 4XKBA 4JX4A 1F9NA 2AXLA 5J3LA 2K9QA 1MJAA 5IPAA 2NS0A 1Q1VA 4RDUA 3MKWB 1W36C 3HGYA 3OOPA 2IPQX 1X1PA 3R60A 3FIWA 4AYBN 3ZXSA 4AC0A 5F08A 5LEKA 2X9DA 2DBBA 2XUBA 4FTHA 1XC5A 2PG4A 3J80Z 3TO9A 4HEA2 1VQPI 3TL4X 5GAEJ 2CV2A 5DCFA 3PO3J 4MFDA 1U8BA 2IJLA 5FD5A 3HOZJ 2CFOA 5K5OA 4P55A 3QRFF 2QKMB 3PQJA 3I4NJ 3Q0UA 2JPBA 5E17F 1S9HA 2E19A 3PUBA 3ROUA 4EJTA 3PFIA 3R61A 3T1BA 2ECBA 4BJ5C 2XROA 2VXZA 1SD6A 4MO7A 3JSPA 1F4KA 4LIVA 4BL0B 1TWCJ 2JVGA 1P7JA 5LHHA 2KJBA 3PSFA 2CU7A 4B8XA 3R6SA 2GM4A 1BBYA 2CQNA 5EJCA 4LJZF 5E1XA 5GADJ 2FA5A 5KAIC 1HW1A 3RKWA 4LB6B 1LDDA 2VJ5A 2HTSA 2KHMA 1WJFA 1X2MA 1MZBA 4ZH4F 5BOXA 1X19A 3HKZA 5L3EA 5IYDJ 2OBPA 3GYHX 3WTSC 4RAZA 2CQQA 1SFKA 4RLFA 5EEAA 1BC8C 3CMEI 1VNDA 3C2HA 2RKHA 1TT0A 4Y52J 3KYLA 2FJ1A 4RA2A 5FLXZ 2RQQA 5DEQA 2HEOA 3BJOA 3QPHA 3FBNB 4A3BJ 3FMRA 3VODA 2GLOA 2DTRA 3JRFA 4BNCA 2XPVA 4NQWA 1U5TA 1FNNA 1NHAA 2NVTJ 3ZP5A 1Z1DA 2HWVA 2MSYA 1KYWA 3W2AA 2XRNA 4D9JA 1A6QA 4V19K 2EK5A 4P96A 5FFXA 1Z67A 4A3CJ 1RZ4A 4B1RA 4KIGA 3FX3A 3P9CA 2L4AA 3Q9SA 3CESA 2V6EA 3FKJA 1WJ5A 2EFPA 2KT0A 2IT0A 4C9YA 1FP1D 1E3OC 1LEBA 2MH2A 2TRTA 1FIAA 4IRGA 4F52A 5JVTA 1R5HA 2OV7A 5LGUA 2BW3A 4XLEA 2QKLB 3E1SA 2XPWA 4HA8A 4LK0F 1XMKA 2BXZA 3SEQA 4CUGA 1VZ0A 1USTA 5D6EA 5D4SA 4ZTFA 2ME0A 1V4RA 2PJRB 4KIBA 5CKTA 1I50J 4M6VA 1SAXA 1MBKA 1X4OA 5FROA 3GBGA 4GFBA 1IN6A 3KZIC 1H0MA 1R49A 5L3FA 3FISA 3FWEA 2OU2A 2Z16A 1FMVA 1S72I 2RC4A 2LY2A 1TP4A 1EJ9A 1MMNA 3HSFA 2Q0OA 2EZHA 3MVPA 2YU3A 4UY8I 2Q8KA 3IRQA 4E6KG 3JAMZ 2XHKA 5M5YJ 1G3WA 3O6BB 4YRVA 3EUHA 2UV1A 2R92J 4GGGA 1WI9A 5EYRA 4YIRX 4B3AA 2A61A 3OR1C 3L2QA 3ESWB 2HXOA 5IOYA 2BGCA 1FC3A 3SXYA 3WTYC 1IV6A 2WAQA 4RAFA 3KP7A 2FSWA 4ZDPA 4C3JJ 1K83J 2OAZA 1IV8A 3IV5A 4CCLA 1ETKA 3ZGKA 2FNAA 2LF8A 3RPQA 4X0GA 4LITA 2NRAC 3CJNA 5LLQA 3ASNH 4D7NA 1FBQA 1FMWA 4OIQF 3HPGA 3ZQGA 1TC3C 1KA8A 4ZDLA 3GTKJ 3S1QJ 2QENA 3FXQA 4ETSA 4U7BA 3WODF 2CW8A 3RI4A 2VQGA 1I1SA 3DKYA 3ZMTA 3CJTB 1FOKA 4MEYF 1DDNA 2NYXA 4XBFA 2ZB9A 3G3ZA 3F21A 4UNOA 2GA1A 3A01B 1ETXA 1R58A 5DM7F 2ZXWH 1YYVA 2ZMEA 4CCNA 4C2UA 3JRHA 4M73A 3AL0C 2BEOA 3HOXJ 4ESBA 2WB1N 4A3LJ 4E4HA 4JX5A 5EEHA 5FO5A 3NEUA 2FQ4A 3DEWA 2ZXHA 2F5VA 3N4MA 2EFOA 3G73A 3JRBA 2Q2EA 3ASOH 1TWAJ 2X85A 1ZYRF 1T38A 5ICGA 5IT9K 1YOVB 1K6YA 3LSGA 2VLAA 2DOAA 3C18A 5LD2C 4NC7A 2CUJA 2AHQA 4P9FA 4C2TA 4A0XA 1FBSA 3RYPA 4DW6A 2CMPA 2IGMA 2P7VB 3OR2C 3CC2I 1FYLA 4BXXJ 1D0YA 2W24A 5TRDA 1I1GA 1MH4A 3DP7A 3QP5A 3D0SA 4BGDA 3CDIA 4E7SA 1WSUA 1ZELA 2O8KA 4D5FA 1RIOH 2LDUA 2ZKZA 5FKKA 2LKXA 4DBRA 4II2A 3FKIJ 1BOBA 2JK3A 3A4CA 5FKOA 2F4MB 2NVQJ 2A5WA 2E1OA 3F3XA 1POGA 1XB4A 4M9SA 3NWTA 5AONA 1SVOA 2NS8A 3E6DA 4CXFA 3A0HC 3OYCA 1B8IB 4Y15A 2KDOA 1P6RA 1YLFA 3ZRGA 5FRMA 1RESA 4IEJA 2OPTA 5CVJA 5TJJA 3HM5A 3S15J 1WJDA 3RKQA 2K4BA 1T2KA 2WY7Q 3RQ4A 1JKQC 3BCAA 1IXRC 2FQ3A 2QUFA 3BT9A 1XDUA 2WV0A 1WVRA 2I5UA 2PMZA 4CCMA 2YR2A 3KEYA 6PAXA 3LAPA 1P4AA 2YSRA 1J0RA 3I71A 4DGWB 3U9GA 4XLNF 2OA4A 3O8GA 1WI3A 4RMNA 4A93J 2X6YA 2CRGA 4L5JA 1NK2P 1ZQ3P 1IN8A 4AVPA 2V9KA 5CVIA 3PQKA 1DU0A 3KP4A 3P7NA 3BR5A 5M5XJ 3J7ZI 1UMQA 3H5AA 2KIMA 4LIUA 1YJWI 1HBXG 1HCRA 3A2KA 1R23A 3VSLA 1Z77A 2FUG2 2FRHA 2DDBA 2R7OA 3SYTA 3GXOA 3OYGA 1OQYA 4ZYAA 4J00A 3ABUA 2IA0A 3OS2A 5FLVA 2CW0F 3HPHA 3O2PE 3COAC 4QWQA 4HZFA 1MBJA 2LF7A 5CQGA 4LLLA 2JT1A 3OYMA 2W4SA 4AVZA 2LH9A 1YJ9I 1QO0D 2GXBA 1BI3A 4L18B 2KZGA 5LGTA 1XPXA 3HTSB 2VKDA 3AG1H 3CDLA 3M8JA 3PSIA 1Y1VJ 1WJBA 3WG9A 4EEFG 4IHYA 1YIJI 4XRSG 3TDUC 4HQMA 2R7DA 5J1UA 2VOOA 1IF1A 2E1NA 3HOYJ 2KKOA 2LR8A 3K70C 2R7VA 3FXJA 3E5QA 2K86A 1TW2A 4BJ6C 4ENJA 5HVQC 2E2HJ 2BE5F 5BNGA 2CS3A 1PUFA 4Y7NJ 3OS1A 3LNQA 3BG7A 1H89C 3GFLA 3SZPA 2F6CA 2X6XA 3ECOA 1KONA 5HNFA 2JN6A 2RVCA 3FZVA 2RREA 3WU1B 1B4AA 3MD2A 3FHZA 4WX9A 1XN7A 1ACIA 2LLKA 3ZN1A 4RGRA 3WTXC 4KMUX 4PJJA 4BDYA 1VQ5I 2HFHA 2H6BA 4M6YA 2BW3B 4CICA 3L9FA 5EZHA 1MH3A 2JJ7A 1LKXA 2BZTA 2P5KA 1H8AC 3K4NA 3QOPA 3F9KA 1LE8A 5M3MJ 2JQ7A 2Y0SN 3SFIA 2VIXA 4DJAA 2OD5A 4XN3A 3WU0A 5JLXA 1H88C 4C3HJ 3F8MA 4G7ZF 1P92A 1V5EA 2AQFA 2R7UA 2OCCH 3ZQCA 4B43A 3ML6A 2R3SA 3KEOA 1HF0A 4PFOA 4IKFA 3BR1A 1GV2A 1DP7P 3WTUC 4FHTA 2XKPA 2JA5J 3GLXA 4BQQA 4NBQA 5ILVA 3K1MA 2VODA 1DP3A 3AG2H 3RQIA 2M9HA 1H9TA 3I4PA 3LSPA
chains in the Genus database with same CATH topology
2I8DA 3DPUA 3DU5A 2IXSA 2F4IA 4HRIA 1X1DA 2V1NA 4XLCA 3ZCOA 3H5NA 2W00A 4BS9A 1LFPA 4XL9A 2CV1A 2ZSIB 2K9LA 3G2BA 1QHHD 2HVRA 2WY8Q 4DOZA 4KT6A 2KP6A 3OIPA 4XLFA 4PSWA 2M3AA 1LVKA 1D0ZA 4H4KC 3OWTA 4HG2A 3QOEA 2L5QA 2M4GA 2AQEA 3J7AY 4BJTA 2P0WA 2L2OA 2R7XA 2HU9A 4OAYA 1R6RA 2LC2A 2R7SA 2L9NA 4HNUA 2NOJB 4CZCA 3OYKA 3FHNA 3K70D 3H9GA 4Y33A 3VYRB 2M7AA 3OS0A 4XLHA 3D5RC 3IAS2 4XKWA 1V5FA 3AFHA 2XF6A 4XR6A 2W1OA 2MABA 2WAFA 2O5RA 3LSIA 4CCKA 4BEHA 2LBFB 4B47A 1Y6IA 4QPOA 2VKHA 1UAAA 1D0XA 4CA0A 1YX5A 4P1WA 4ZC3A 1DGWY 1GLNA 4II3A 4QPQA 4PJLA 4XMYA 1MMDA 2E5ZA 4XKBA 4F92B 3OIQA 2R4GA 2M0MA 1SAUA 5LFAA 3DQVC 4NQWB 1MNEA 1W36C 3MKWB 2HDWA 2DT6A 3PL8A 3TMOA 4PJNA 3CZ6A 4IQJA 3K4LA 3ZQQA 3ZXSA 2KPMA 4AU7A 1DQUA 2OC6A 3BLYA 2W7NA 3PNVA 3HL2A 1ERDA 1G59A 4HEA2 4F91B 2L7KA 3OYAA 5FRNA 3TL4X 1U0JA 2CV2A 2HVSA 4OWRB 2CFOA 3I9V2 2GOXB 2LREA 3OYLA 1MW7A 1PJRA 3K4MA 3DKXA 4B3XA 1WJEA 2QKMB 2CH0A 3DPLC 1S9HA 4EATA 3PUBA 3CP8A 3IAM2 3OL3A 5KCMA 4BJ5C 2VJ4A 2VXZA 3H35A 2VPLA 2L9SA 3ONQA 4AYBA 4BE1A 5HOOA 4LIVA 4BL0B 4XLAA 3VDXA 5KNLA 1PYVA 2JVGA 3W3CA 2IS2A 3PSFA 3S32A 1G8XA 4BACA 5TGTA 2VJ5A 2LRDA 3W2WA 2KHMA 3SEZA 2E1MB 1WJFA 4ANJA 3H0DA 3SDBA 1X19A 3HKZA 2MYSA 3I3LA 2OUMA 2MD0A 2X1EA 4MLOA 2W82A 1SFKA 3PNYA 4RLFA 3C2HA 4PUSA 1X1AA 1TT0A 3EUHC 3LMMA 3OYJA 3VWBA 3KYLA 3MKYB 2RQQA 4B44A 4CSWA 1HA8A 2R7RA 3D5SC 1BR2A 2HVQA 3FBNB 2Y0SA 2XF7A 4BQNA 2K9MA 3OYIA 3OYBA 1N78A 1D1AA 2ELJA 3PJRA 4YELA 3OYEA 4DBQA 2DCEA 3W2AA 2LOOA 3S3MA 4NC8A 4D9JA 3E0JB 4OAZA 2A6TA 4BXFA 3CESA 3HOTA 2V6EA 3FBIB 3FKJA 4XN0A 1WJ5A 3DEEA 1BR1A 2IS4A 4C9YA 3HXLA 5HLTA 1P9QC 1W36D 3RTRA 3VYUB 2IGOA 2VJIA 5CQEA 2VL8A 4F3QA 1X1BA 4F52A 4E7IA 2OV7A 4KITB 4BE0A 2DXIA 4YEJA 2BW3A 4XLEA 2QKLB 2VJJA 2WADA 3E1SA 2VB6A 3QYEA 3W2VA 2E60A 1E0EA 3CJRB 2CW7A 3SEQA 4ITVA 4CUGA 1VZ0A 4C30A 2Q2EB 4ZTFA 2PJRB 4N4NB 1UG0A 5CKTA 1X4OA 1UELB 3GBGA 5FROA 4XOTA 4IZZA 4FASD 2HPIA 3HC7A 2Z16A 1FMVA 4ZDOA 3EUAA 2LY2A 1MMNA 3HOSA 4PSXA 4BU2A 3K4BA 4E6KG 3DWLE 4YRVA 2Z1DA 2UV1A 2VXDA 3L2QA 3OR1C 2HNHA 2X51A 1Z21A 2WAQA 2MC4A 4HSRA 2XF5A 4ZDPA 4F93B 2KQRA 4CH7A 3H5RA 3AKZA 4CCLA 3ZGKA 4F55A 3PNTA 2BVLA 4X0GA 3L2RA 1YX3A 4LITA 1WJAA 1IRXA 1FMWA 2VQHA 3HPGA 4ZDLA 2IGKA 4U7BA 2CUZA 2CW8A 3MKZA 3K4JA 2VQGA 3DKYA 3SZGA 2HZDA 3IP4B 3MMYB 2IGNA 3K10A 3K4CA 3NWSA 4KJZA 3AL0B 2ZSHB 2JSPA 2XDVA 4Y3OA 4P5OA 3RSNA 2LYCA 4BQOA 4CCNA 4C2UA 2V4JC 3AL0C 3A1YA 3LSHA 4JOMA 4XKCA 1TZLA 3S3NA 4E4HA 1Y56A 2VQCA 3OL4A 3LSKA 4XNFA 2ZXHA 2F5VA 2Q1ZB 4U87A 2R7WA 4DIQA 4XORA 3DTIA 4ZJZA 2LBFA 2WAEA 2X85A 4CCJA 2E1MC 4JQFA 2JA2A 4N4OB 1WJCA 1K6YA 4PFPA 4FETA 3LSGA 2VLAA 2DOAA 2ZXIA 3HUGB 4NNJA 5LD2C 4NC7A 2CUJA 4HSTA 3D5LA 4PJMA 2IS1A 2WA0A 4IX7A 4C2TA 3H9QA 2CMPA 4Y4RA 4XM3A 3EUKL 4E7LA 2IGMA 3OR2C 1DGRM 1X4PA 2DJIA 4ZTJA 3UNGC 1D0YA 3QODA 3EPZA 3CJQB 2K3PA 4E7KA 2WB1A 1OR7C 4BGDA 4E7SA 3K4KA 1ZELA 2KZVA 3L2UA 2K5CA 4DBRA 3KX2A 4II2A 1BOBA 3CMMA 3HG9A 3A4CA 2XC7A 2A5WA 3CP2A 3U21A 2HQAA 3S8PA 3OYNA 3DPTA 3NWTA 1QHGA 3OYHA 3OYCA 2DT7B 2R7TA 3FDYA 1D1CA 3BG6A 2KDOA 2LG4A 3ZRGA 5KHDA 5FRMA 1X1CA 1QU3A 2RNGA 4XONA 2BVMA 2KRCA 1WJDA 3CF2A 1BR4A 2HPMA 3DLAA 2WY7Q 3RQ4A 1NG6A 3BCAA 3VSKA 5JHFA 4BDZA 3DTEA 3PFYA 2PMZA 4CCMA 3KEYA 3OY9A 1MMAA 4DGWB 3LL7A 2KLOA 2V7FA 4RMNA 3S3OA 2X6YA 1AA7A 2X1DA 2V9KA 4GRIA 1EA3A 3OYFA 3N05A 1MMGA 3H5AA 4LIUA 3A2KA 1V5GA 1T0FC 3VSLA 2FUG2 4R79A 1JI8A 2R7OA 3QYFA 3IUOA 3K6GA 3LFUA 3SYTA 3OYGA 4ZYAA 4J00A 2Z2SB 4E7ZA 5HNHA 1Z3YA 3OS2A 2KRHA 3HPHA 3RPUD 2ZFUA 5CQGA 3OYMA 2W4SA 3V42A 2KMUA 4AVZA 2LH9A 4RM3A 2VKDA 3UR3C 2BOLA 3M8JA 3PSIA 1WJBA 2UUZA 1OLTA 4E7JA 3OYDA 1D1BA 2VQLA 3BCBA 4XOPA 2X6WA 3RCOA 3VYSB 3K70C 2R7VA 5CPRB 4BJ6C 1N77A 4HNTA 5HVQC 3L2VA 3M1CA 2CS3A 4PK4A 2KL4A 4CCOA 2UWMA 2M7BA 2E5NA 2X1CA 3OS1A 3BG7A 2WBMA 1WFXA 2VASA 1YE9A 2F6CA 2X6XA 1KONA 5HNFA 1T95A 2JUGA 2RREA 2XAUA 3OOUA 3QYBA 3MD2A 2MFZA 2CV0A 4E7HA 4PJJA 3VYTB 4BDYA 1J09A 2BW3B 3H9JA 4D1QA 1LKXA 4XKVA 3BC8A 3K4NA 3DU6A 2PJRA 3F9KA 4LG3A 3LSMA 4IQ4A 1LDKB 4BEHB 2R7QA 2VIXA 4RM2A 4B48A 4DJAA 3C2GA 3S93A 4XN3A 1Z7LA 1Z3XA 4J01A 4BUPA 4HPQA 2XSJC 1V5EA 2AQFA 2R7UA 4B43A 3TBIA 2LY1A 4IKFA 4PFOA 1MNDA 1N75A 2V26A 3ZR8X 4NUBA 3L2WA 4XQFA 4G6TB 2GOMA 4BE2A 4BQQA 1NG7A 3OMYA 1DP3A 2M4KA 2JVHA 4RLQA 4KISA 3DTKA 2IS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAY A;  5KHD A;  4OAZ A;  2MC4 A; 
#chains in the Genus database with same CATH topology
 2I8D A;  1FZP B;  3DPU A;  2LK2 A;  3ZQI A;  3DU5 A;  4D5C A;  1ETV A;  2L02 A;  3R0J A;  4EQQ A;  2V1N A;  3H5N A;  2K9S A;  2P6S A;  2Y48 A;  1IUF A;  1LFP A;  3BZC A;  4N9I A;  4XL9 A;  3TOA A;  4PZJ A;  3K0L A;  3F8N A;  4GYI A;  4EGY A;  3BG3 A;  2WY8 Q;  1QZY A;  5CJ9 A;  5C4J J;  1I3Q J;  4MTD A;  3ZQ7 A;  2FBI A;  3OIP A;  3TED A;  3BTJ A;  4HDU A;  4Q4Z F;  1CF7 B;  3C7J A;  2M3A A;  1VQ4 I;  1B6A A;  1U3E M;  5DV5 A;  1OIS A;  5ICC A;  2M4G A;  1YRN A;  2AQE A;  4K2E A;  3J7A Y;  2Z99 A;  2P0W A;  4BJT A;  2IVM A;  2ZME B;  4QSH A;  3JTG A;  2LC2 A;  1HQC A;  1QVT A;  2L9N A;  4ABZ A;  1XSX A;  4PJ0 C;  3FHN A;  4YIF A;  1JUS A;  2KJC A;  2B0L A;  3QQA A;  3VYR B;  3K2A A;  3I0T A;  2OF7 A;  5H6Q A;  4XLH A;  3VEP A;  1F43 A;  1IDY A;  1STZ A;  2PX9 A;  3AFH A;  4XKW A;  2QWW A;  4XR6 A;  4OIN F;  4ENM A;  3LSI A;  1O7F A;  3IH2 A;  4KA4 A;  2HDC A;  2HZT A;  4BEH A;  4QPO A;  2DOE A;  1D0X A;  4CA0 A;  2OQG A;  4CHU A;  4B4C A;  4JP0 A;  2Y69 H;  4O5V A;  4ZC3 A;  4EJO A;  1I6H J;  4PJL A;  2EV5 A;  2UXN A;  5CYV A;  1SVL A;  1MMD A;  2E5Z A;  3OV8 A;  3CLQ A;  5KVR A;  1RPW A;  1UHS A;  3FXO A;  1MNM C;  2CQX A;  1SAU A;  1FEX A;  1HKT A;  1SVM A;  4S05 A;  2JRM A;  3HZJ A;  4L0Y B;  2F5E A;  3K4L A;  2DA4 A;  3CO6 C;  3HRM A;  4AU7 A;  2OC6 A;  1U5T C;  2R5Y A;  1FOW A;  4F91 B;  1R7J A;  3OYA A;  1KU2 A;  1J59 A;  1YJN I;  2DT5 A;  1U9N A;  3DBH B;  5J40 A;  4I76 A;  4XSX F;  1W7P A;  4M3G A;  5HDG A;  3WTV C;  3Q5F A;  3I9V 2;  2GOX B;  3BDD A;  3GTP J;  3CD6 I;  4IOC F;  4IO9 F;  3OYL A;  2QGU A;  4IF4 A;  1VQM I;  2X48 A;  2Y31 A;  3K4M A;  1IN4 A;  4B3X A;  3HKZ N;  1MGT A;  1TT5 B;  2CH0 A;  2CUF A;  2IP2 A;  3DPL C;  2PN6 A;  4G7O F;  4FX4 A;  5EG0 A;  5KCM A;  2LY9 A;  2G0E A;  2L9V A;  3FM5 A;  2VPL A;  2K7L A;  2L9S A;  1OCT C;  2STW A;  5K7Z A;  3M9A A;  1OJL A;  2ID6 A;  4A2U A;  3WU2 C;  3SQN A;  1Z91 A;  3S32 A;  1ON2 A;  4V2F A;  3J7A O;  4M72 A;  1KZH A;  1XCV A;  2H27 A;  3LA3 A;  1FP2 A;  3L7W A;  2B7E A;  2XV4 S;  2LRD A;  4KN4 X;  3SEZ A;  2DK5 A;  2DK8 A;  2E1M B;  4HQE A;  4AIJ A;  2L54 A;  5LHI A;  3I3L A;  3NQO A;  2OUM A;  3JRG A;  1JKP C;  3GX4 X;  3CO7 C;  4G12 A;  1LDJ A;  1ZG1 A;  1QBJ A;  4PUS A;  2EZL A;  2XVC A;  2EFW A;  3EUH C;  3LMM A;  3OYJ A;  1T8I A;  4RGU A;  3MKY B;  3KCC A;  3KLN A;  4B44 A;  4CSW A;  5L3B A;  2V6C A;  4XRF A;  3D5S C;  2R7R A;  1Z0X A;  5F0F A;  4UUS B;  3A03 A;  1JKO C;  3E6M A;  2Y0S A;  5DYM A;  1RUO A;  2LD5 A;  5M3F J;  2XF7 A;  3RKX A;  2L0K A;  3LSR A;  3DXJ F;  3OYB A;  1N78 A;  5LHG A;  3PJR A;  1ZK8 A;  1FYM A;  2LOO A;  3S3M A;  2M1B A;  4NC8 A;  5GP9 A;  2ECC A;  4A0Z A;  5D4R A;  4UVA A;  5E20 A;  1D8K A;  5IOZ A;  2RN7 A;  2XAF A;  1YW9 A;  4Q48 A;  5K7F A;  2EB7 A;  1YIO A;  4XN0 A;  2MA3 A;  1PUF B;  3DEE A;  3HXL A;  2DFI A;  2DN0 A;  1P9Q C;  3HGG A;  3RTR A;  1KYZ A;  4M3E A;  1O3T A;  4BY7 J;  2D1V A;  2VL8 A;  4HNV A;  1X1B A;  1VQ8 I;  3AAF A;  1FLI A;  4BE0 A;  3WHB A;  1Q1H A;  3CUQ C;  4DYC A;  1OCP A;  1TNS A;  2DXI A;  2IBD A;  5IP7 J;  3J81 K;  2WAD A;  3F6O A;  5DUK A;  4EJV A;  5B1B H;  4ITV A;  3JRD A;  4UXN A;  1XX5 A;  4C30 A;  2BYV E;  3CCL I;  2W84 A;  1UEL B;  5B3S H;  4H0E A;  1TLH B;  2M5W A;  3BQZ A;  3HC7 A;  3TW6 A;  3EUA A;  2QQB A;  2LSO A;  1MDM A;  2DFE A;  2PLY A;  3V7R A;  4A5M A;  4AIK A;  1EF4 A;  4BHB A;  3EET A;  1OYY A;  4BU2 A;  5DCM B;  4G9Y A;  1BM9 A;  4WWC A;  2F5C A;  2XSD C;  2Z1D A;  1FSE A;  2VXD A;  1MJB A;  3D1N I;  1NTC A;  2X51 A;  2IAI A;  2ZNY A;  1B9N A;  4IXA A;  2CG4 A;  5D6F A;  4IL6 C;  2KQR A;  1FY7 A;  3AKZ A;  5J8F A;  1K78 A;  4FE4 A;  1MJ9 A;  3BOQ A;  1IXC A;  4W97 A;  2COB A;  3WTT C;  1IRX A;  3PUF A;  2YU9 J;  4CYD A;  3HOW J;  2WWY A;  4HX7 A;  5BQT A;  1UG2 A;  2CUZ A;  3JCU C;  1ZRE A;  3K4J A;  3F22 A;  2HQ5 A;  4DQ2 A;  2HZD A;  4RS8 A;  5HLI A;  1SFU A;  4HF2 A;  3OSG A;  2STT A;  4YG2 F;  2IGN A;  3K10 A;  3K4C A;  2DA2 A;  4KJZ A;  2DPD A;  3AL0 B;  1ON1 A;  4QLC U;  2DYR H;  2VI6 A;  4P5O A;  2R5Z B;  3S14 J;  2LYC A;  2X0L A;  1G2H A;  1BW5 A;  3HTU A;  4EMS A;  2C6Y A;  5FKM A;  1YRN B;  1SFO J;  2V4J C;  5H2F C;  5M5W J;  3A1Y A;  1SAN A;  4MQ9 F;  1TZL A;  3M7G A;  1KU9 A;  5HS9 A;  5IT3 A;  5D5V B;  3DBR B;  3S3N A;  2P4W A;  1NH3 A;  1GDT A;  1IRF A;  1Y56 A;  2A69 F;  4BY1 J;  4LB5 A;  2V1D A;  1BI2 A;  2MLG A;  5CVU A;  3G1O A;  3GZ6 A;  2W85 A;  2DOD A;  4I6Z A;  4ZJZ A;  4EJW A;  1HOM A;  2WAE A;  3H3U A;  4GXO A;  4UB8 C;  1AU7 A;  4MHG A;  2E1M C;  1XS9 A;  2FNP A;  2NAZ A;  4XRS A;  2BHZ A;  4PFP A;  5F27 A;  4FET A;  4HW0 A;  1J2X A;  1BOA A;  4NNJ A;  1W5S A;  2HOT A;  5B5E C;  4HLY A;  1K7A A;  4IX7 A;  3BTI A;  1JE8 A;  1ORK A;  4IPA A;  1FSH A;  4XM3 A;  3EUK L;  1S7A A;  2DA7 A;  3M07 A;  1DGR M;  4EM1 A;  2DA5 A;  2DJI A;  3UNG C;  3QOD A;  5K1Y A;  3J80 K;  3CDH A;  4M3D A;  2A05 A;  2PMZ N;  2JA8 J;  4RAY A;  2XAJ A;  1KQ8 A;  4A0Y A;  2KZV A;  3S1M J;  1T39 A;  4BHP A;  3H3V K;  2K5C A;  3K1P A;  3JRA A;  1JT6 A;  3CMM A;  3HG9 A;  4MFE A;  5E1Z B;  2HI3 A;  3U21 A;  2R5Y B;  5IP6 A;  2K9N A;  3OYH A;  4AUX A;  2DT7 B;  2HKO A;  4ON0 A;  1IRZ A;  1F36 A;  5F0H A;  4A3K J;  4XON A;  2BVM A;  2KRC A;  3CCM I;  3GTJ J;  2O7O A;  1BR4 A;  2FBH A;  3E97 A;  4DYR A;  2XAG A;  2V79 A;  3PM1 A;  2P8T A;  4BDZ A;  2W25 A;  2ZNZ A;  3DTE A;  1YIT I;  2E34 A;  5EG0 B;  1K4T A;  3N97 A;  2NS7 A;  4EGZ A;  1G3T A;  2K40 A;  4O3M A;  2E7X A;  2VBW A;  1IAW A;  5K5R A;  3HB9 A;  1D3Y A;  3GFM A;  4I98 B;  2O0Y A;  5J6X A;  2FXA A;  4BH9 A;  1AA7 A;  2YUS A;  4IHS A;  1JUM A;  2O3F A;  3BR2 A;  1IRG A;  3C3W A;  1EA3 A;  3V8J A;  2M34 A;  3ZPL A;  3GTM J;  2H8W A;  4C2M J;  1V5G A;  2CSO A;  2MW8 A;  4R79 A;  1ETY A;  5EF6 A;  1IC8 A;  1AKH A;  5E3O A;  5FLX K;  3LFU A;  1BC7 C;  9ANT A;  2MGQ A;  2RV8 A;  2Z2S B;  3R4K A;  4E7Z A;  2P7C B;  1X3U A;  2KRH A;  3C2B A;  1SD4 A;  3WTW C;  1WH5 A;  1LJ9 A;  1QNT A;  2DFH A;  3MCZ A;  4EV0 A;  4NDL A;  2KMU A;  1OR7 A;  5HS8 A;  1XSD A;  2ZJP F;  3K69 A;  3RZO J;  3CF5 F;  2V1X A;  5IT9 Z;  2BOL A;  5IY5 H;  2DMN A;  3IH4 A;  2UUZ A;  4DYQ A;  1OLT A;  1S7O A;  1RRJ A;  1O4X A;  1D1B A;  3JTH A;  4XOP A;  4GO1 A;  2IEK A;  2O03 A;  3S1R J;  2OTL I;  2QSG X;  5GAH J;  5FGM A;  3E7L A;  4WXD A;  1I6X A;  2M0C A;  1GXP A;  2RGV A;  1MSF C;  2LTP A;  3GEZ A;  1G4D A;  3Q3S A;  2OQR A;  2FEZ A;  2X1C A;  3CUQ A;  2WBM A;  1IN5 A;  5D5U B;  2KIF A;  2W48 A;  1ETW A;  4AM3 A;  4DNC A;  2QM3 A;  4IJA A;  2COM A;  3BPV A;  1WRJ A;  3NAU A;  3BZK A;  1MBE A;  2JUG A;  3OOU A;  1Z7U A;  3QYB A;  1EV7 A;  1C0W A;  5DD8 A;  3H36 A;  3VYT B;  4F7Z A;  1J09 A;  2VE8 A;  4OIO F;  5F64 A;  4RB2 C;  4Q47 A;  3I55 I;  3MWM A;  1ENH A;  4D1Q A;  2PFB A;  3BC8 A;  3DU6 A;  3OSF A;  2VC0 A;  1LUJ B;  3TKY A;  4LG3 A;  3LSM A;  2DAO A;  4OMZ A;  3ELK A;  4B48 A;  1JTX A;  3FM3 A;  3B6A A;  3M1E A;  4G7H F;  1Y0N A;  4J01 A;  1G3S A;  4BUP A;  4HPQ A;  5H20 A;  4RGX A;  2P5L C;  3TBI A;  1ZGA A;  1HKS A;  1E17 A;  3DBL B;  4BHC A;  2V26 A;  5A2Q Z;  4XQF A;  4FQG A;  2O6G E;  1MMS A;  2DMQ A;  5K7H A;  2B9S A;  3KET A;  1S6L A;  2RNJ A;  1HSJ A;  2A68 F;  3H0G J;  3TDZ C;  1J9I A;  2M4K A;  2PEX A;  5DM6 F;  3CCV I;  2XGD A;  5JFR A;  3DTK A;  5FB2 A;  2CV1 A;  4Q5S F;  2HS5 A;  1B9M A;  2PMU A;  3ABL H;  4A3F J;  2J5P A;  2F4I A;  5C4X J;  1RC9 A;  1FWZ A;  1X1D A;  3HRU A;  4XLC A;  5E3M A;  3IH3 A;  1K78 B;  3Q0W A;  3S16 J;  4BS9 A;  3EYY A;  1OYI A;  1ONV A;  2NXN B;  3TQN A;  1AOY A;  3JRE A;  1T6S A;  4N9H A;  3F8F A;  4AD9 A;  4DOZ A;  2HVR A;  2KP6 A;  4OU0 A;  1XGM A;  5BS6 A;  2Y0M A;  4XLF A;  2JSC A;  4LD5 A;  2DOF A;  4M9X A;  4HG2 A;  1Y0U A;  2QQ9 A;  1IW7 F;  2H6C A;  3MN2 A;  3ZQF A;  3WGI A;  2JTV A;  2DFF A;  5DS9 A;  1XTA A;  2L2O A;  3NRV A;  4KNY A;  1HW5 A;  2XAS A;  4N0B A;  2R7S A;  4HNU A;  2NOJ B;  1QGP A;  3KPH A;  4HF0 A;  1QPI A;  4IHX A;  4CYC A;  2M7A A;  3MEX A;  2Y9Z A;  2XF6 A;  1XD7 A;  5E1W A;  4UVB A;  3MAJ A;  1UHW A;  5D5X B;  3V4G A;  4NHJ A;  2XB5 A;  4WCG A;  3SZT A;  3GVA A;  2EZK A;  3HUG A;  4YFX F;  2AS5 F;  4E70 A;  2ZBK A;  3B73 A;  2ICW G;  1DUX C;  2DQL A;  1ODD A;  5D8L B;  4MGR A;  4F92 B;  3HIF A;  2QBY A;  3G1M A;  3DFG A;  5LFA A;  4NQW B;  1MNE A;  1R22 A;  1U5T B;  3AG4 H;  2DT6 A;  3KZY A;  2BY3 A;  3CZ6 A;  1GVJ A;  1R1V A;  4PDK A;  1A31 A;  3ZQQ A;  3A02 A;  2KPM A;  1DQU A;  3BLY A;  1PDN C;  2W7N A;  5E79 C;  1O7L A;  3HL2 A;  1K4S A;  1G59 A;  2LFB A;  2XAH A;  1UCR A;  2L7K A;  5FRN A;  2HOS A;  2LNB A;  1U0J A;  2FOK A;  5L3G A;  4ESJ A;  4UUV A;  1TBX A;  1WGX A;  2DLL A;  1JGS A;  2ZJR F;  1PJR A;  1XDS A;  3DKX A;  5CVR A;  2P81 A;  1RKW A;  1FPQ A;  2ACJ A;  4D7M A;  1YI2 I;  2HGC A;  3CP8 A;  2JZY A;  5D5W B;  3OL3 A;  4L9N A;  3K2Z A;  3KYD B;  2DA1 A;  2VJ4 A;  2NVY J;  5ED4 A;  3S2W A;  2ZFW A;  1UFM A;  3J7Y J;  4MQV A;  4XLA A;  3VDX A;  5F1J A;  5KNL A;  1TWH J;  3W3C A;  1HKQ A;  3I59 A;  2FE3 A;  3BZ6 A;  4UHT A;  4KDP A;  4A5N A;  2NOG A;  4BAC A;  1R5I D;  3BRO A;  1U6G A;  4ANJ A;  2JWT A;  3LFK A;  3SDB A;  5H6R A;  1TL8 A;  1Y8Q B;  3KP2 A;  3A0B C;  4I7H A;  4FX0 A;  4MLO A;  4JBA A;  2LVS A;  3GW2 A;  3SHF A;  2DU9 A;  3F6V A;  4FT8 A;  4M9Z A;  5FKN A;  1HC8 A;  3VWB A;  4I0B A;  3U1K A;  3IKV A;  4DZJ A;  4KN7 X;  2NVX J;  2X4H A;  2HVQ A;  2EIK H;  3WG7 H;  4X6A J;  2K3F A;  3G1L A;  4HX8 A;  2KIU A;  3MFK A;  1S3J A;  2K9M A;  3OYI A;  2ELJ A;  3GME A;  3OYE A;  3CCR I;  2L01 A;  3ZQL A;  3RJP A;  2MLK A;  2KFD A;  1S29 A;  3JSO A;  4BAY A;  3L1P A;  2DTZ A;  1O3S A;  2VT2 A;  3E0J B;  4LLN A;  2CWE A;  2JUC A;  4M3F A;  3RYR A;  3CMY A;  4BYY A;  4HDV A;  4BXF A;  1SMT A;  3HOT A;  1IUY A;  4EVI A;  4S0H B;  5HDN A;  1ZG5 A;  3I53 A;  5GPC A;  3CUQ B;  1BI0 A;  3VYU B;  1MBG A;  2IGO A;  5CQE A;  2ZXJ A;  4F3Q A;  1ZN2 A;  1LPQ A;  1FJL A;  4IOA F;  1V3F A;  4YEJ A;  1SD7 A;  2AXT C;  2VJJ A;  2VB6 A;  3W2V A;  2E60 A;  1E0E A;  1GUU A;  2CW7 A;  2HYG D;  4PCQ A;  3FF5 A;  2OZ6 A;  3QPT A;  2Q2E B;  4ASN A;  5AIQ A;  2L7M P;  4AID A;  1UG0 A;  2DW4 A;  3HOV J;  4UB6 C;  4IZZ A;  2G7U A;  4ZDO A;  1QPM A;  2R7F A;  4A6E A;  5FKL A;  4GCV A;  4ZYG A;  3HYI A;  4PSX A;  2UXX A;  2QEX I;  3DWL E;  2EZI A;  4IHV A;  2FMY A;  4YFN F;  2EIN H;  2HNH A;  3T0Y A;  1LQ1 A;  1Z21 A;  2Y9Y A;  2MC4 A;  3CUO A;  1LB2 A;  1DU6 A;  4XIC A;  3TO7 A;  3CCQ I;  2R0Q C;  4CH7 A;  2BHY A;  2L7F P;  1SEU A;  3H5R A;  4OMY A;  1XMX A;  4F55 A;  5GTI C;  3PNT A;  2BVL A;  1E2X A;  3L2R A;  1YX3 A;  1WJA A;  3KYC B;  5JLW A;  2IA1 A;  2GBY A;  2GIV A;  5E3L A;  2M30 A;  2IGK A;  2I10 A;  1EKE A;  4U0W A;  4L9T A;  2DA3 A;  5EGO A;  1UJ8 A;  3BQY A;  2QA4 I;  4HOB A;  1VQ7 I;  3PIP F;  3IP4 B;  3MMY B;  2BXY A;  3NWS A;  2VT3 A;  3DEU A;  2P5V A;  2ZJQ F;  1B72 A;  2JSP A;  3LQQ A;  4M6X A;  2RDP A;  2A07 F;  1TQM A;  1T98 A;  3RSN A;  2MG4 A;  4I02 A;  3ZQH A;  1XGN A;  4JOM A;  5E8G A;  1PP8 F;  5F0C A;  4XKC A;  1W7P D;  1VTN C;  1I39 A;  3U1D A;  2VQC A;  2PQ8 A;  3LSK A;  4O6J A;  3GCM A;  5L3D A;  2Z9O A;  3LAJ A;  3ULQ B;  2EV6 A;  2R7W A;  4U87 A;  4CYC B;  2W57 A;  3GF2 A;  4XOR A;  2LBF A;  3SDG A;  4BBR J;  4CCJ A;  4AWX B;  4JQF A;  4U7D A;  2GWR A;  2P6T A;  1J7K A;  2JA2 A;  4N4O B;  4LLG F;  1TTY A;  1AWC A;  1GT0 C;  3HUG B;  4Z2Y A;  4HST A;  3W6K B;  3D5L A;  2ZO4 A;  3T8T A;  2IS1 A;  2WA0 A;  3MZ8 A;  3H9Q A;  4Y4R A;  4A3G J;  5LGN A;  3BR6 A;  2QBY B;  3EPZ A;  3HEF A;  3CJQ B;  2K3P A;  1ETQ A;  4QIW N;  3FXK A;  1OR7 C;  3K4K A;  1JHF A;  2X6O A;  3L2U A;  4KT5 C;  3KX2 A;  1BI1 A;  2IA2 A;  2XC7 A;  3CP2 A;  1QVU A;  3KP5 A;  1I5Z A;  1HXD A;  4JX6 A;  2R7T A;  3FDY A;  4WXH A;  1OFC X;  3BG6 A;  2ME6 A;  5KHD A;  1X1C A;  2DJN A;  2RNG A;  3CLO A;  1A5J A;  3O3K A;  1RI7 A;  1HW2 A;  1R4N B;  3CF2 A;  2XKO A;  1UZC A;  1ZR2 A;  1R1T A;  2EBI A;  3CQZ J;  4I0A A;  3DLA A;  1NG6 A;  5B66 C;  3VSK A;  5JHF A;  1SFX A;  2L4M A;  4BQA A;  2B63 J;  2BY1 A;  3PFY A;  3ABK H;  3RPU A;  5HLG A;  4PGG A;  1Y8R B;  1WWX A;  3LL7 A;  5LRR A;  1T08 B;  2V7F A;  4R8H A;  3U2R A;  1LE8 B;  3QAH A;  3S3O A;  3V7S A;  1FX7 A;  3DV8 A;  2X1D A;  3ISP A;  3KE2 A;  2QVO A;  1MBH A;  1N25 A;  4C3I J;  1MMG A;  1BN5 A;  1SC7 A;  3BR0 A;  5E18 F;  1JI8 A;  2VKE A;  3QYF A;  3M8E A;  1F5T A;  1YFH A;  3K6G A;  2JMW A;  2KIQ A;  5FD6 A;  4LMY A;  1Z3Y A;  1OPC A;  2H1K A;  3FK6 A;  1Z6T A;  2F2E A;  4JYK A;  3RPU D;  5IYC J;  1V54 H;  2ZFU A;  5BMZ A;  2YX7 A;  5FLM J;  1WCM J;  4G8X A;  4KMF A;  2EFN A;  2TDX A;  4RM3 A;  3FMS A;  3IL2 A;  2HR3 A;  2H94 A;  3V7C A;  1QQI A;  4FCY A;  1ITY A;  3KIO A;  3IRR A;  4HX4 A;  3UR3 C;  2PMH A;  4NB5 A;  3BP8 A;  4BKX A;  4HAM A;  1BIB A;  3OYD A;  2VQL A;  2H1L A;  3S2D J;  3BCB A;  2X6W A;  1IJW C;  3CCY A;  5BPD A;  3QU3 A;  2MC3 A;  4WF2 A;  4CGZ A;  1HDD C;  3E5X A;  1U9O A;  2YPR A;  5CPR B;  2L7Z A;  1N77 A;  2CQK A;  2HDD A;  2EH3 A;  3L2V A;  1ZLK A;  2OZU A;  2PI0 A;  2KL4 A;  1B8I A;  2M7B A;  2DYS H;  3LQR A;  1ZAR A;  2EQR A;  3K1N A;  3VOE A;  3E3V A;  2E35 A;  3HHG A;  5DDG A;  2VAS A;  4LK1 F;  1K61 A;  2CFX A;  3HOU J;  1IN7 A;  5CVV A;  1YE9 A;  1T95 A;  1KQ0 A;  1EH6 A;  2XAU A;  1R1U A;  3QWL A;  2EV0 A;  4E7H A;  2XB0 X;  3FXR A;  4LFU A;  4CDG A;  4Y13 A;  4LGW A;  1M1E B;  3H9J A;  3ZMD A;  1PP7 U;  3BJA A;  1ULY A;  2TCT A;  2OJE D;  1LEA A;  4W1U A;  2FBK A;  4IQ4 A;  2HQR A;  4BEH B;  2R7Q A;  1PVE A;  4RM2 A;  1T0F A;  3MQ0 A;  2HYJ A;  2D1H A;  4UV9 A;  3P9I A;  1YQA A;  1L0O C;  2BY0 A;  4I09 A;  1TNT A;  1JXS A;  2VPR A;  1MND A;  5FFZ A;  3L2C A;  1YO5 C;  3ZR8 X;  3BTL A;  4NUB A;  4ZZL A;  2VKV A;  3MKL A;  2GOM A;  1A36 A;  1EH7 A;  2BV6 A;  3X2Q H;  4BE2 A;  1NG7 A;  1RKT A;  3OMY A;  1F1Z A;  3GTG J;  4RLQ A;  3I64 A;  3ERE D;  3JRC A;  1Y1W J;  1AHD P;  1G6N A;  4KIS A;  1W5T A;  3WE2 A;  4I01 A;  3Q0V A;  3P9K A;  4U88 A;  1XCB A;  2XPU A;  1X58 A;  3ZMV A;  1W0T A;  2DO7 A;  3Q9V A;  1W7P B;  4L9V A;  3TP3 A;  2W00 A;  1QZE A;  3IC7 A;  3JR9 A;  2EA2 A;  1BW6 A;  3TOB A;  2K9L A;  2G7H A;  3K7A J;  4OIR F;  2A6H F;  1FOY A;  2HQN A;  2MBF A;  5EGO B;  4A6D A;  5J4Y A;  3SFZ A;  3BWG A;  1T33 A;  5LEJ A;  1LVK A;  1YTY A;  2LP0 A;  3OWT A;  5J8C A;  3QOE A;  1Y39 A;  2L5Q A;  1B72 B;  3ZN0 A;  1NK3 P;  1YS7 A;  2ISZ A;  4WXC A;  3IWF A;  2R7X A;  2HU9 A;  2N8G A;  3GLL A;  1R6R A;  1APL C;  1IZ1 A;  1S5L C;  1WKM A;  3OYK A;  3H9G A;  1OCO H;  1YS6 A;  1VF9 A;  1R5G A;  2YS9 A;  2FU4 A;  2JRT A;  3LA7 A;  3OS0 A;  1V5F A;  3LWF A;  4AIH A;  4P9U A;  2MAB A;  2GA2 A;  2WC2 A;  3GWZ A;  1K6O A;  5JR3 A;  3V8K A;  5FJ8 J;  4DZP A;  4CCK A;  4UVC A;  5ICF A;  2LBF B;  4B47 A;  1Y6I A;  5TIS C;  2VKH A;  1B59 A;  1UAA A;  1JTY A;  1Z05 A;  2ETH A;  1YX5 A;  1V55 H;  2GXA A;  5E3N A;  4FE7 A;  1BA5 A;  4MEX F;  1DGW Y;  5C44 J;  1GLN A;  4II3 A;  3KLO A;  2DDA A;  1XGS A;  1RR7 A;  1OKR A;  2ESN A;  3OIQ A;  2K4J A;  1TWG J;  3W6J B;  4ENN A;  2R4G A;  5D8K B;  1E3H A;  2M0M A;  2M45 A;  3DQV C;  3EQL F;  2HDW A;  3PL8 A;  3FMQ A;  1USS A;  3TMO A;  2VE9 A;  4PJN A;  4IQJ A;  1A35 A;  2K02 A;  3LA2 A;  1U2W A;  4HLX A;  3KFW X;  3PNV A;  3QU6 A;  1LVA A;  1MBF A;  1ERD A;  3HSE A;  1JJ6 C;  4RBO A;  5IYB J;  2QYO A;  1YHQ I;  2D5V A;  2HVS A;  3PO2 J;  4L5I A;  4OWR B;  1Z6R A;  5F6F A;  2LRE A;  4KUM A;  4RB3 C;  1MW7 A;  2BY2 A;  2M8E A;  1FTT A;  1WJE A;  2Y2Z A;  1ZRC A;  4ZYH A;  4EAT A;  4OIP F;  2DI3 A;  2QZ8 A;  2QSH X;  3IAM 2;  1CF7 A;  2PBI A;  2Z3Y A;  1W0U A;  1O3Q A;  2EA4 A;  3BPX A;  3H35 A;  4XLP F;  3ONQ A;  4BE1 A;  2HYF A;  4AYB A;  1EH8 A;  5HOO A;  1ZGW A;  1A04 A;  1Z9C A;  3F8B A;  1S7E A;  2VBZ A;  3JAM K;  3GFI A;  1PYV A;  1TQP A;  2IS2 A;  1K79 A;  4GYG A;  1G8X A;  2DMU A;  1TWF J;  5TGT A;  1MDM B;  2E36 A;  5ICE A;  1CGP A;  1ZG3 A;  2HKX A;  4X1E A;  3W2W A;  3H0D A;  1YG2 A;  3WHC A;  3E5U A;  3V8L A;  3H92 A;  2EFQ A;  2MYS A;  2MD0 A;  2X1E A;  2W82 A;  1MKM A;  3PNY A;  2QQA A;  2EWN A;  3ZMS A;  2F4O B;  2V9P A;  5C3E J;  1X1A A;  2R93 J;  4G6Q A;  2HXI A;  5J1R A;  4Z6Y A;  3TW7 A;  4IHW A;  1HA8 A;  1BR2 A;  2VBY A;  5F1R A;  4G6D A;  3CCU I;  3TO6 A;  4BQN A;  5IP9 J;  4L5E A;  1W4M A;  5ERI A;  1D5V A;  1OCR H;  2JPC A;  2ZCW A;  2O61 A;  1FIP A;  1D1A A;  2A5Y B;  3B02 A;  3AG3 H;  4YEL A;  2GZW A;  4DBQ A;  2DCE A;  5GTH C;  3CCJ I;  2ADU A;  2RQP A;  2LMD A;  4OAZ A;  2M2E A;  2V1U A;  5ILU A;  1SD5 A;  3CCE I;  2EPF A;  3BR3 A;  4J19 A;  2A6T A;  1P4W A;  1HDP A;  4M74 A;  3FBI B;  1LFB A;  1OMI A;  1BR1 A;  4MNU A;  1IG7 A;  2IS4 A;  1HST A;  1P4X A;  4FIS A;  5DD4 A;  5HLT A;  3GFJ A;  1W36 D;  3S2H J;  1GV5 A;  5EZG A;  2VJI A;  5E8I A;  4RB1 A;  3LST A;  3DLL F;  2NNN A;  3E6C C;  4E7I A;  3BG5 A;  4KIT B;  1A6I A;  2EIM H;  3SJM A;  3K9T A;  3QP6 A;  4XK4 A;  1FYK A;  1I27 A;  3QYE A;  4G94 A;  1BL0 A;  2QCO A;  3ZMZ A;  3CJR B;  2F48 A;  3H3Z A;  2VUM J;  1OCZ H;  3IKT A;  3JW4 A;  2EJR A;  4N4N B;  2LKS A;  4BXU A;  2MD5 A;  1X3Z B;  3TGN A;  5A2Q K;  2HTJ A;  2PJP A;  1I3A A;  4XOT A;  5GAG J;  2JA6 J;  4FAS D;  2HPI A;  3ZMU A;  2KDZ A;  1G3Y A;  1PUE E;  2FOW A;  2NVU B;  1VQ6 I;  1TQI A;  3F23 A;  5KK1 A;  3HOS A;  3BJ6 A;  5J1Y A;  2KRF A;  3ERM A;  2K85 A;  2KIS A;  3K4B A;  4MTE A;  4ZYE A;  2D2W A;  2VOP A;  1ZGJ A;  3KP3 A;  3VFZ A;  1R00 A;  3FXL A;  3T5X A;  4UUT A;  3EDP A;  4HSR A;  5J47 A;  2XF5 A;  1ETO A;  4F93 B;  4V2G A;  1CQT A;  1H9G A;  4R1H A;  1REP C;  3HRT A;  4L9J A;  4UUS A;  1ZH5 A;  1SFE A;  3GZN B;  3I5U A;  1WQ2 A;  1JUP A;  1JKR C;  3G4S I;  3REO A;  3W6V A;  4CO8 A;  2VQH A;  3H1C A;  5HS7 A;  3T8R A;  2Z5U A;  4CZZ A;  3M3Y J;  2K27 A;  1B1B A;  4EM2 A;  1VQ9 I;  3MKZ A;  1MIJ A;  3R0A A;  3SZG A;  1DPR A;  3EYI A;  1ZTR A;  4A3E J;  4M71 A;  5JHU A;  2OTJ I;  3VB2 A;  1P7I A;  2ZSH B;  2XDV A;  4Y3O A;  4BQO A;  5K5Q A;  5J4V A;  1UHM A;  2ISY A;  3KP6 A;  1OYW A;  1W1W E;  1J75 A;  3LSH A;  2AO9 A;  3HJE A;  4EM0 B;  3MZY A;  1RET A;  2OCE A;  3OL4 A;  4A3J J;  1FOX A;  4XNF A;  3BG9 A;  2Q1Z B;  1L3L A;  4DIQ A;  2ESH A;  4A3M J;  1AKH B;  2GQQ A;  3DTI A;  3QPS A;  4A12 A;  2GXG A;  3F0C A;  2A6E F;  4LG0 A;  2DQR A;  1HLV A;  1WJC A;  2ZXI A;  4ZYD A;  1YW7 A;  2VN2 A;  4HYE A;  2H8R A;  2ELH A;  1JGG A;  4PJM A;  2UZK A;  1VI0 A;  3FXU A;  1GHC A;  2XAQ A;  1TW3 A;  2EIJ H;  5DCM A;  4E7L A;  4ZTJ A;  1X4P A;  3LSJ A;  2XIG A;  4E7K A;  4XRM A;  2WB1 A;  1IDZ A;  1WPK A;  3BTC A;  3NAR A;  1QZZ A;  1ZAO A;  1IO2 A;  5HLH A;  3ECH A;  2CGP A;  3GUD A;  2Y30 A;  4NC6 A;  3WTZ A;  4WK8 F;  2ELK A;  5GPA A;  2HQA A;  1E3P A;  3S8P A;  3DPT A;  2Y75 A;  3WGH A;  3OYN A;  1ZRF A;  1QHG A;  2HOE A;  2QQ8 A;  5HOD A;  1XGO A;  3CTA A;  1D1C A;  1MSE C;  4QTR A;  2LG4 A;  1WZ2 A;  1QU3 A;  1WHU A;  2XGE A;  4MIM A;  2XGX A;  4B09 A;  4A3D J;  4RAG A;  4GDF A;  2GAU A;  4U0Y A;  2HPM A;  4HF1 A;  1J5Y A;  2CQ7 A;  1IGN A;  2MH9 A;  3OY9 A;  2Z33 A;  1MMA A;  2R5Z A;  3WGG A;  2KLO A;  1LNW A;  2LKP A;  4KFC A;  2YX4 A;  1BJA A;  3RZD J;  5L3C A;  2ID3 A;  4GRI A;  1FBU A;  1KGS A;  2FD5 A;  3OYF A;  2QLZ A;  1X2N A;  3N05 A;  1RUN A;  5LRS A;  1LFU P;  5AIP A;  1T0F C;  4EJU A;  3HDD A;  1JHH A;  3C1D A;  1JJ8 C;  3IUO A;  4I2O A;  4IRI A;  4ENK A;  2WV1 A;  4OOI A;  1ZRD A;  5HNH A;  3IWZ A;  5ILS A;  4IVN A;  1ZR4 A;  4RGS A;  1D5Y A;  2CUE A;  4IHT A;  1GXQ A;  3DF8 A;  1QA6 A;  2O9L A;  2EIL H;  3V42 A;  3G71 I;  1VQO I;  1KU7 A;  4IRH A;  4KIF A;  2CO5 A;  4HBL A;  2XGC A;  5F04 A;  2E7W A;  3ABT A;  2IRF G;  1ZLJ A;  4XSZ F;  2DPU A;  2F5F A;  3ZOB A;  1MD0 A;  4A69 C;  1WH7 A;  2IW5 A;  4E7J A;  1DPU A;  4XID A;  3RCO A;  3VYS B;  3FK7 A;  2CJJ A;  3L00 A;  2DA6 A;  3LOC A;  1VFC A;  4HNT A;  4RB0 A;  4ZZD A;  3M1C A;  2E2I J;  4PK4 A;  3CC7 I;  4CCO A;  2UWM A;  2FX0 A;  4TV7 A;  2E5N A;  1IXS B;  3IHU A;  5HDK A;  4M3B A;  1WFX A;  2E2J J;  2HOA A;  2GIZ A;  4HV6 A;  2O8X A;  3VPR A;  3RDI A;  4Y17 A;  1OCC H;  5EDN A;  1RR8 C;  1SMY F;  1U8R A;  1S8N A;  5JI6 A;  2L3D A;  2MFZ A;  2CV0 A;  3DKW A;  1XSV A;  3F72 A;  4YFK F;  5DTD A;  3QPL A;  4JK1 X;  4XKV A;  2VC1 A;  3HHH A;  2PJR A;  1LDK B;  3M8F A;  3C2G A;  3S93 A;  3J81 Z;  4D0P A;  1Z7L A;  1Z3X A;  2BBY A;  2VBX A;  2XSJ C;  1FT9 A;  3GTO J;  2QSF X;  2LY1 A;  5BPI A;  2M8G X;  5LBQ A;  3KEQ A;  1N75 A;  2A3S A;  5CLS A;  2F5D A;  3GTL J;  3L2W A;  3HBL A;  2R7Z J;  4G6T B;  1FTZ A;  4HV5 A;  2DMP A;  1QRY A;  4KIC A;  3I54 A;  3P5J A;  3S17 J;  2ZJ2 A;  3B6C A;  1GVD A;  2H09 A;  3RIR A;  2JVH A;  3I4M J;  4PGH A;  1RNL A;  2IS6 A;  1ZKG A;  4BBS J;  1T56 A;  1VQK I;  2FF4 A;  2XRL A;  2IXS A;  3UKG A;  5EEG A;  1JT0 A;  1R71 A;  4HRI A;  1R36 A;  1D8J A;  3ZCO A;  3CC4 I;  1O57 A;  3ABM H;  2DMT A;  1O3R A;  3I58 A;  3RKY A;  3CMA I;  2ZSI B;  3GTQ J;  3G2B A;  2D45 A;  1QHH D;  3GO5 A;  1BIA A;  3OIO A;  3HSR A;  2NNY A;  3M4O J;  4KT6 A;  3TP0 A;  3S1N J;  2E71 A;  2ZC2 A;  3L09 A;  3I56 I;  3DCF A;  4LOC A;  3E6B A;  3A01 A;  1ZHF A;  4PSW A;  3FXM A;  4L0Z B;  1D0Z A;  4H4K C;  3PIO F;  1UB9 A;  1W5C C;  1X3W B;  2QF7 A;  4I99 C;  2E1C A;  1KQ9 A;  5KAF C;  3WE3 A;  1KU3 A;  2VON A;  4OAY A;  3I59 B;  2M87 A;  3K70 D;  4CZC A;  2CYY A;  1XMA A;  2V9V A;  4Y33 A;  2FML A;  3G6E I;  2JA7 J;  2ZME C;  1BJZ A;  4ESF A;  2WAQ N;  4A3I J;  1R9T J;  2L9R A;  3O8H A;  3D5R C;  3IAS 2;  2W1O A;  2WAF A;  2O5R A;  1VQL I;  5DUI A;  4YII A;  2RAE A;  1XG1 A;  1YW8 A;  5B1A H;  1VQN I;  2G9W A;  1R4M B;  3JRI A;  5JVG F;  1P2F A;  3F8C A;  2WTE A;  3MZH A;  3BY6 A;  3HRS A;  4LG0 B;  4P1W A;  3CCS I;  2J5O A;  1U78 A;  4KYW A;  3GZ5 A;  4S04 A;  4QPQ A;  3KZZ A;  4XMY A;  4UV8 A;  4U0V A;  4XKB A;  4JX4 A;  1F9N A;  2AXL A;  5J3L A;  2K9Q A;  1MJA A;  5IPA A;  2NS0 A;  1Q1V A;  4RDU A;  3MKW B;  1W36 C;  3HGY A;  3OOP A;  2IPQ X;  1X1P A;  3R60 A;  3FIW A;  4AYB N;  3ZXS A;  4AC0 A;  5F08 A;  5LEK A;  2X9D A;  2DBB A;  2XUB A;  4FTH A;  1XC5 A;  2PG4 A;  3J80 Z;  3TO9 A;  4HEA 2;  1VQP I;  3TL4 X;  5GAE J;  2CV2 A;  5DCF A;  3PO3 J;  4MFD A;  1U8B A;  2IJL A;  5FD5 A;  3HOZ J;  2CFO A;  5K5O A;  4P55 A;  3QRF F;  2QKM B;  3PQJ A;  3I4N J;  3Q0U A;  2JPB A;  5E17 F;  1S9H A;  2E19 A;  3PUB A;  3ROU A;  4EJT A;  3PFI A;  3R61 A;  3T1B A;  2ECB A;  4BJ5 C;  2XRO A;  2VXZ A;  1SD6 A;  4MO7 A;  3JSP A;  1F4K A;  4LIV A;  4BL0 B;  1TWC J;  2JVG A;  1P7J A;  5LHH A;  2KJB A;  3PSF A;  2CU7 A;  4B8X A;  3R6S A;  2GM4 A;  1BBY A;  2CQN A;  5EJC A;  4LJZ F;  5E1X A;  5GAD J;  2FA5 A;  5KAI C;  1HW1 A;  3RKW A;  4LB6 B;  1LDD A;  2VJ5 A;  2HTS A;  2KHM A;  1WJF A;  1X2M A;  1MZB A;  4ZH4 F;  5BOX A;  1X19 A;  3HKZ A;  5L3E A;  5IYD J;  2OBP A;  3GYH X;  3WTS C;  4RAZ A;  2CQQ A;  1SFK A;  4RLF A;  5EEA A;  1BC8 C;  3CME I;  1VND A;  3C2H A;  2RKH A;  1TT0 A;  4Y52 J;  3KYL A;  2FJ1 A;  4RA2 A;  5FLX Z;  2RQQ A;  5DEQ A;  2HEO A;  3BJO A;  3QPH A;  3FBN B;  4A3B J;  3FMR A;  3VOD A;  2GLO A;  2DTR A;  3JRF A;  4BNC A;  2XPV A;  4NQW A;  1U5T A;  1FNN A;  1NHA A;  2NVT J;  3ZP5 A;  1Z1D A;  2HWV A;  2MSY A;  1KYW A;  3W2A A;  2XRN A;  4D9J A;  1A6Q A;  4V19 K;  2EK5 A;  4P96 A;  5FFX A;  1Z67 A;  4A3C J;  1RZ4 A;  4B1R A;  4KIG A;  3FX3 A;  3P9C A;  2L4A A;  3Q9S A;  3CES A;  2V6E A;  3FKJ A;  1WJ5 A;  2EFP A;  2KT0 A;  2IT0 A;  4C9Y A;  1FP1 D;  1E3O C;  1LEB A;  2MH2 A;  2TRT A;  1FIA A;  4IRG A;  4F52 A;  5JVT A;  1R5H A;  2OV7 A;  5LGU A;  2BW3 A;  4XLE A;  2QKL B;  3E1S A;  2XPW A;  4HA8 A;  4LK0 F;  1XMK A;  2BXZ A;  3SEQ A;  4CUG A;  1VZ0 A;  1UST A;  5D6E A;  5D4S A;  4ZTF A;  2ME0 A;  1V4R A;  2PJR B;  4KIB A;  5CKT A;  1I50 J;  4M6V A;  1SAX A;  1MBK A;  1X4O A;  5FRO A;  3GBG A;  4GFB A;  1IN6 A;  3KZI C;  1H0M A;  1R49 A;  5L3F A;  3FIS A;  3FWE A;  2OU2 A;  2Z16 A;  1FMV A;  1S72 I;  2RC4 A;  2LY2 A;  1TP4 A;  1EJ9 A;  1MMN A;  3HSF A;  2Q0O A;  2EZH A;  3MVP A;  2YU3 A;  4UY8 I;  2Q8K A;  3IRQ A;  4E6K G;  3JAM Z;  2XHK A;  5M5Y J;  1G3W A;  3O6B B;  4YRV A;  3EUH A;  2UV1 A;  2R92 J;  4GGG A;  1WI9 A;  5EYR A;  4YIR X;  4B3A A;  2A61 A;  3OR1 C;  3L2Q A;  3ESW B;  2HXO A;  5IOY A;  2BGC A;  1FC3 A;  3SXY A;  3WTY C;  1IV6 A;  2WAQ A;  4RAF A;  3KP7 A;  2FSW A;  4ZDP A;  4C3J J;  1K83 J;  2OAZ A;  1IV8 A;  3IV5 A;  4CCL A;  1ETK A;  3ZGK A;  2FNA A;  2LF8 A;  3RPQ A;  4X0G A;  4LIT A;  2NRA C;  3CJN A;  5LLQ A;  3ASN H;  4D7N A;  1FBQ A;  1FMW A;  4OIQ F;  3HPG A;  3ZQG A;  1TC3 C;  1KA8 A;  4ZDL A;  3GTK J;  3S1Q J;  2QEN A;  3FXQ A;  4ETS A;  4U7B A;  3WOD F;  2CW8 A;  3RI4 A;  2VQG A;  1I1S A;  3DKY A;  3ZMT A;  3CJT B;  1FOK A;  4MEY F;  1DDN A;  2NYX A;  4XBF A;  2ZB9 A;  3G3Z A;  3F21 A;  4UNO A;  2GA1 A;  3A01 B;  1ETX A;  1R58 A;  5DM7 F;  2ZXW H;  1YYV A;  2ZME A;  4CCN A;  4C2U A;  3JRH A;  4M73 A;  3AL0 C;  2BEO A;  3HOX J;  4ESB A;  2WB1 N;  4A3L J;  4E4H A;  4JX5 A;  5EEH A;  5FO5 A;  3NEU A;  2FQ4 A;  3DEW A;  2ZXH A;  2F5V A;  3N4M A;  2EFO A;  3G73 A;  3JRB A;  2Q2E A;  3ASO H;  1TWA J;  2X85 A;  1ZYR F;  1T38 A;  5ICG A;  5IT9 K;  1YOV B;  1K6Y A;  3LSG A;  2VLA A;  2DOA A;  3C18 A;  5LD2 C;  4NC7 A;  2CUJ A;  2AHQ A;  4P9F A;  4C2T A;  4A0X A;  1FBS A;  3RYP A;  4DW6 A;  2CMP A;  2IGM A;  2P7V B;  3OR2 C;  3CC2 I;  1FYL A;  4BXX J;  1D0Y A;  2W24 A;  5TRD A;  1I1G A;  1MH4 A;  3DP7 A;  3QP5 A;  3D0S A;  4BGD A;  3CDI A;  4E7S A;  1WSU A;  1ZEL A;  2O8K A;  4D5F A;  1RIO H;  2LDU A;  2ZKZ A;  5FKK A;  2LKX A;  4DBR A;  4II2 A;  3FKI J;  1BOB A;  2JK3 A;  3A4C A;  5FKO A;  2F4M B;  2NVQ J;  2A5W A;  2E1O A;  3F3X A;  1POG A;  1XB4 A;  4M9S A;  3NWT A;  5AON A;  1SVO A;  2NS8 A;  3E6D A;  4CXF A;  3A0H C;  3OYC A;  1B8I B;  4Y15 A;  2KDO A;  1P6R A;  1YLF A;  3ZRG A;  5FRM A;  1RES A;  4IEJ A;  2OPT A;  5CVJ A;  5TJJ A;  3HM5 A;  3S15 J;  1WJD A;  3RKQ A;  2K4B A;  1T2K A;  2WY7 Q;  3RQ4 A;  1JKQ C;  3BCA A;  1IXR C;  2FQ3 A;  2QUF A;  3BT9 A;  1XDU A;  2WV0 A;  1WVR A;  2I5U A;  2PMZ A;  4CCM A;  2YR2 A;  3KEY A;  6PAX A;  3LAP A;  1P4A A;  2YSR A;  1J0R A;  3I71 A;  4DGW B;  3U9G A;  4XLN F;  2OA4 A;  3O8G A;  1WI3 A;  4RMN A;  4A93 J;  2X6Y A;  2CRG A;  4L5J A;  1NK2 P;  1ZQ3 P;  1IN8 A;  4AVP A;  2V9K A;  5CVI A;  3PQK A;  1DU0 A;  3KP4 A;  3P7N A;  3BR5 A;  5M5X J;  3J7Z I;  1UMQ A;  3H5A A;  2KIM A;  4LIU A;  1YJW I;  1HBX G;  1HCR A;  3A2K A;  1R23 A;  3VSL A;  1Z77 A;  2FUG 2;  2FRH A;  2DDB A;  2R7O A;  3SYT A;  3GXO A;  3OYG A;  1OQY A;  4ZYA A;  4J00 A;  3ABU A;  2IA0 A;  3OS2 A;  5FLV A;  2CW0 F;  3HPH A;  3O2P E;  3COA C;  4QWQ A;  4HZF A;  1MBJ A;  2LF7 A;  5CQG A;  4LLL A;  2JT1 A;  3OYM A;  2W4S A;  4AVZ A;  2LH9 A;  1YJ9 I;  1QO0 D;  2GXB A;  1BI3 A;  4L18 B;  2KZG A;  5LGT A;  1XPX A;  3HTS B;  2VKD A;  3AG1 H;  3CDL A;  3M8J A;  3PSI A;  1Y1V J;  1WJB A;  3WG9 A;  4EEF G;  4IHY A;  1YIJ I;  4XRS G;  3TDU C;  4HQM A;  2R7D A;  5J1U A;  2VOO A;  1IF1 A;  2E1N A;  3HOY J;  2KKO A;  2LR8 A;  3K70 C;  2R7V A;  3FXJ A;  3E5Q A;  2K86 A;  1TW2 A;  4BJ6 C;  4ENJ A;  5HVQ C;  2E2H J;  2BE5 F;  5BNG A;  2CS3 A;  1PUF A;  4Y7N J;  3OS1 A;  3LNQ A;  3BG7 A;  1H89 C;  3GFL A;  3SZP A;  2F6C A;  2X6X A;  3ECO A;  1KON A;  5HNF A;  2JN6 A;  2RVC A;  3FZV A;  2RRE A;  3WU1 B;  1B4A A;  3MD2 A;  3FHZ A;  4WX9 A;  1XN7 A;  1ACI A;  2LLK A;  3ZN1 A;  4RGR A;  3WTX C;  4KMU X;  4PJJ A;  4BDY A;  1VQ5 I;  2HFH A;  2H6B A;  4M6Y A;  2BW3 B;  4CIC A;  3L9F A;  5EZH A;  1MH3 A;  2JJ7 A;  1LKX A;  2BZT A;  2P5K A;  1H8A C;  3K4N A;  3QOP A;  3F9K A;  1LE8 A;  5M3M J;  2JQ7 A;  2Y0S N;  3SFI A;  2VIX A;  4DJA A;  2OD5 A;  4XN3 A;  3WU0 A;  5JLX A;  1H88 C;  4C3H J;  3F8M A;  4G7Z F;  1P92 A;  1V5E A;  2AQF A;  2R7U A;  2OCC H;  3ZQC A;  4B43 A;  3ML6 A;  2R3S A;  3KEO A;  1HF0 A;  4PFO A;  4IKF A;  3BR1 A;  1GV2 A;  1DP7 P;  3WTU C;  4FHT A;  2XKP A;  2JA5 J;  3GLX A;  4BQQ A;  4NBQ A;  5ILV A;  3K1M A;  2VOD A;  1DP3 A;  3AG2 H;  3RQI A;  2M9H A;  1H9T A;  3I4P A;  3LSP A; 
#chains in the Genus database with same CATH homology
 2I8D A;  3DPU A;  3DU5 A;  2IXS A;  2F4I A;  4HRI A;  1X1D A;  2V1N A;  4XLC A;  3ZCO A;  3H5N A;  2W00 A;  4BS9 A;  1LFP A;  4XL9 A;  2CV1 A;  2ZSI B;  2K9L A;  3G2B A;  1QHH D;  2HVR A;  2WY8 Q;  4DOZ A;  4KT6 A;  2KP6 A;  3OIP A;  4XLF A;  4PSW A;  2M3A A;  1LVK A;  1D0Z A;  4H4K C;  3OWT A;  4HG2 A;  3QOE A;  2L5Q A;  2M4G A;  2AQE A;  3J7A Y;  4BJT A;  2P0W A;  2L2O A;  2R7X A;  2HU9 A;  4OAY A;  1R6R A;  2LC2 A;  2R7S A;  2L9N A;  4HNU A;  2NOJ B;  4CZC A;  3OYK A;  3FHN A;  3K70 D;  3H9G A;  4Y33 A;  3VYR B;  2M7A A;  3OS0 A;  4XLH A;  3D5R C;  3IAS 2;  4XKW A;  1V5F A;  3AFH A;  2XF6 A;  4XR6 A;  2W1O A;  2MAB A;  2WAF A;  2O5R A;  3LSI A;  4CCK A;  4BEH A;  2LBF B;  4B47 A;  1Y6I A;  4QPO A;  2VKH A;  1UAA A;  1D0X A;  4CA0 A;  1YX5 A;  4P1W A;  4ZC3 A;  1DGW Y;  1GLN A;  4II3 A;  4QPQ A;  4PJL A;  4XMY A;  1MMD A;  2E5Z A;  4XKB A;  4F92 B;  3OIQ A;  2R4G A;  2M0M A;  1SAU A;  5LFA A;  3DQV C;  4NQW B;  1MNE A;  1W36 C;  3MKW B;  2HDW A;  2DT6 A;  3PL8 A;  3TMO A;  4PJN A;  3CZ6 A;  4IQJ A;  3K4L A;  3ZQQ A;  3ZXS A;  2KPM A;  4AU7 A;  1DQU A;  2OC6 A;  3BLY A;  2W7N A;  3PNV A;  3HL2 A;  1ERD A;  1G59 A;  4HEA 2;  4F91 B;  2L7K A;  3OYA A;  5FRN A;  3TL4 X;  1U0J A;  2CV2 A;  2HVS A;  4OWR B;  2CFO A;  3I9V 2;  2GOX B;  2LRE A;  3OYL A;  1MW7 A;  1PJR A;  3K4M A;  3DKX A;  4B3X A;  1WJE A;  2QKM B;  2CH0 A;  3DPL C;  1S9H A;  4EAT A;  3PUB A;  3CP8 A;  3IAM 2;  3OL3 A;  5KCM A;  4BJ5 C;  2VJ4 A;  2VXZ A;  3H35 A;  2VPL A;  2L9S A;  3ONQ A;  4AYB A;  4BE1 A;  5HOO A;  4LIV A;  4BL0 B;  4XLA A;  3VDX A;  5KNL A;  1PYV A;  2JVG A;  3W3C A;  2IS2 A;  3PSF A;  3S32 A;  1G8X A;  4BAC A;  5TGT A;  2VJ5 A;  2LRD A;  3W2W A;  2KHM A;  3SEZ A;  2E1M B;  1WJF A;  4ANJ A;  3H0D A;  3SDB A;  1X19 A;  3HKZ A;  2MYS A;  3I3L A;  2OUM A;  2MD0 A;  2X1E A;  4MLO A;  2W82 A;  1SFK A;  3PNY A;  4RLF A;  3C2H A;  4PUS A;  1X1A A;  1TT0 A;  3EUH C;  3LMM A;  3OYJ A;  3VWB A;  3KYL A;  3MKY B;  2RQQ A;  4B44 A;  4CSW A;  1HA8 A;  2R7R A;  3D5S C;  1BR2 A;  2HVQ A;  3FBN B;  2Y0S A;  2XF7 A;  4BQN A;  2K9M A;  3OYI A;  3OYB A;  1N78 A;  1D1A A;  2ELJ A;  3PJR A;  4YEL A;  3OYE A;  4DBQ A;  2DCE A;  3W2A A;  2LOO A;  3S3M A;  4NC8 A;  4D9J A;  3E0J B;  4OAZ A;  2A6T A;  4BXF A;  3CES A;  3HOT A;  2V6E A;  3FBI B;  3FKJ A;  4XN0 A;  1WJ5 A;  3DEE A;  1BR1 A;  2IS4 A;  4C9Y A;  3HXL A;  5HLT A;  1P9Q C;  1W36 D;  3RTR A;  3VYU B;  2IGO A;  2VJI A;  5CQE A;  2VL8 A;  4F3Q A;  1X1B A;  4F52 A;  4E7I A;  2OV7 A;  4KIT B;  4BE0 A;  2DXI A;  4YEJ A;  2BW3 A;  4XLE A;  2QKL B;  2VJJ A;  2WAD A;  3E1S A;  2VB6 A;  3QYE A;  3W2V A;  2E60 A;  1E0E A;  3CJR B;  2CW7 A;  3SEQ A;  4ITV A;  4CUG A;  1VZ0 A;  4C30 A;  2Q2E B;  4ZTF A;  2PJR B;  4N4N B;  1UG0 A;  5CKT A;  1X4O A;  1UEL B;  3GBG A;  5FRO A;  4XOT A;  4IZZ A;  4FAS D;  2HPI A;  3HC7 A;  2Z16 A;  1FMV A;  4ZDO A;  3EUA A;  2LY2 A;  1MMN A;  3HOS A;  4PSX A;  4BU2 A;  3K4B A;  4E6K G;  3DWL E;  4YRV A;  2Z1D A;  2UV1 A;  2VXD A;  3L2Q A;  3OR1 C;  2HNH A;  2X51 A;  1Z21 A;  2WAQ A;  2MC4 A;  4HSR A;  2XF5 A;  4ZDP A;  4F93 B;  2KQR A;  4CH7 A;  3H5R A;  3AKZ A;  4CCL A;  3ZGK A;  4F55 A;  3PNT A;  2BVL A;  4X0G A;  3L2R A;  1YX3 A;  4LIT A;  1WJA A;  1IRX A;  1FMW A;  2VQH A;  3HPG A;  4ZDL A;  2IGK A;  4U7B A;  2CUZ A;  2CW8 A;  3MKZ A;  3K4J A;  2VQG A;  3DKY A;  3SZG A;  2HZD A;  3IP4 B;  3MMY B;  2IGN A;  3K10 A;  3K4C A;  3NWS A;  4KJZ A;  3AL0 B;  2ZSH B;  2JSP A;  2XDV A;  4Y3O A;  4P5O A;  3RSN A;  2LYC A;  4BQO A;  4CCN A;  4C2U A;  2V4J C;  3AL0 C;  3A1Y A;  3LSH A;  4JOM A;  4XKC A;  1TZL A;  3S3N A;  4E4H A;  1Y56 A;  2VQC A;  3OL4 A;  3LSK A;  4XNF A;  2ZXH A;  2F5V A;  2Q1Z B;  4U87 A;  2R7W A;  4DIQ A;  4XOR A;  3DTI A;  4ZJZ A;  2LBF A;  2WAE A;  2X85 A;  4CCJ A;  2E1M C;  4JQF A;  2JA2 A;  4N4O B;  1WJC A;  1K6Y A;  4PFP A;  4FET A;  3LSG A;  2VLA A;  2DOA A;  2ZXI A;  3HUG B;  4NNJ A;  5LD2 C;  4NC7 A;  2CUJ A;  4HST A;  3D5L A;  4PJM A;  2IS1 A;  2WA0 A;  4IX7 A;  4C2T A;  3H9Q A;  2CMP A;  4Y4R A;  4XM3 A;  3EUK L;  4E7L A;  2IGM A;  3OR2 C;  1DGR M;  1X4P A;  2DJI A;  4ZTJ A;  3UNG C;  1D0Y A;  3QOD A;  3EPZ A;  3CJQ B;  2K3P A;  4E7K A;  2WB1 A;  1OR7 C;  4BGD A;  4E7S A;  3K4K A;  1ZEL A;  2KZV A;  3L2U A;  2K5C A;  4DBR A;  3KX2 A;  4II2 A;  1BOB A;  3CMM A;  3HG9 A;  3A4C A;  2XC7 A;  2A5W A;  3CP2 A;  3U21 A;  2HQA A;  3S8P A;  3OYN A;  3DPT A;  3NWT A;  1QHG A;  3OYH A;  3OYC A;  2DT7 B;  2R7T A;  3FDY A;  1D1C A;  3BG6 A;  2KDO A;  2LG4 A;  3ZRG A;  5KHD A;  5FRM A;  1X1C A;  1QU3 A;  2RNG A;  4XON A;  2BVM A;  2KRC A;  1WJD A;  3CF2 A;  1BR4 A;  2HPM A;  3DLA A;  2WY7 Q;  3RQ4 A;  1NG6 A;  3BCA A;  3VSK A;  5JHF A;  4BDZ A;  3DTE A;  3PFY A;  2PMZ A;  4CCM A;  3KEY A;  3OY9 A;  1MMA A;  4DGW B;  3LL7 A;  2KLO A;  2V7F A;  4RMN A;  3S3O A;  2X6Y A;  1AA7 A;  2X1D A;  2V9K A;  4GRI A;  1EA3 A;  3OYF A;  3N05 A;  1MMG A;  3H5A A;  4LIU A;  3A2K A;  1V5G A;  1T0F C;  3VSL A;  2FUG 2;  4R79 A;  1JI8 A;  2R7O A;  3QYF A;  3IUO A;  3K6G A;  3LFU A;  3SYT A;  3OYG A;  4ZYA A;  4J00 A;  2Z2S B;  4E7Z A;  5HNH A;  1Z3Y A;  3OS2 A;  2KRH A;  3HPH A;  3RPU D;  2ZFU A;  5CQG A;  3OYM A;  2W4S A;  3V42 A;  2KMU A;  4AVZ A;  2LH9 A;  4RM3 A;  2VKD A;  3UR3 C;  2BOL A;  3M8J A;  3PSI A;  1WJB A;  2UUZ A;  1OLT A;  4E7J A;  3OYD A;  1D1B A;  2VQL A;  3BCB A;  4XOP A;  2X6W A;  3RCO A;  3VYS B;  3K70 C;  2R7V A;  5CPR B;  4BJ6 C;  1N77 A;  4HNT A;  5HVQ C;  3L2V A;  3M1C A;  2CS3 A;  4PK4 A;  2KL4 A;  4CCO A;  2UWM A;  2M7B A;  2E5N A;  2X1C A;  3OS1 A;  3BG7 A;  2WBM A;  1WFX A;  2VAS A;  1YE9 A;  2F6C A;  2X6X A;  1KON A;  5HNF A;  1T95 A;  2JUG A;  2RRE A;  2XAU A;  3OOU A;  3QYB A;  3MD2 A;  2MFZ A;  2CV0 A;  4E7H A;  4PJJ A;  3VYT B;  4BDY A;  1J09 A;  2BW3 B;  3H9J A;  4D1Q A;  1LKX A;  4XKV A;  3BC8 A;  3K4N A;  3DU6 A;  2PJR A;  3F9K A;  4LG3 A;  3LSM A;  4IQ4 A;  1LDK B;  4BEH B;  2R7Q A;  2VIX A;  4RM2 A;  4B48 A;  4DJA A;  3C2G A;  3S93 A;  4XN3 A;  1Z7L A;  1Z3X A;  4J01 A;  4BUP A;  4HPQ A;  2XSJ C;  1V5E A;  2AQF A;  2R7U A;  4B43 A;  3TBI A;  2LY1 A;  4IKF A;  4PFO A;  1MND A;  1N75 A;  2V26 A;  3ZR8 X;  4NUB A;  3L2W A;  4XQF A;  4G6T B;  2GOM A;  4BE2 A;  4BQQ A;  1NG7 A;  3OMY A;  1DP3 A;  2M4K A;  2JVH A;  4RLQ A;  4KIS A;  3DTK A;  2IS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...