2MC5A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by -factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 45L
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Protein binding
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc5A00
2MC6A 2MC5A
chains in the Genus database with same CATH superfamily
2EE8A 4LF5E 3T1HE 2MKNA 2DIXA 1UN6B 2EOMA 2EM7A 2YPNA 1X6EA 1JK1A 3BIDA 1YYKA 2VRDA 1YPNA 4JI4E 2MDGA 4DV3E 5AC5A 2HC5A 4JI1E 1P47A 2YTDA 1A1GA 4KHPE 1XMQE 2V8QB 2L33A 4DV6E 2YRMA 4M2ZA 2YZTA 1A1IA 1L4SA 4ZYGA 2YTFA 2M7QA 1T4NA 1HNWE 2L6MA 4DV5E 2EM0A 2V87A 4P78A 4DR1E 2EPOA 3LLHA 1TF3A 4WYQB 2EM4A 2JPAA 2YTOA 4BMJA 4LFAE 2JYAA 2EMLA 3MHHC 4F9CB 1N34E 2EPUA 1XNQE 4MLQA 1FKAE 2RS6A 2R76A 4O5GA 2I9IA 5A6BD 5F3WA 3TQMA 2F4VE 3C4BA 2N8XA 2YTGA 3ADGA 2LTSA 2YSOA 3J7Yp 3DJWA 2EPZA 2K4VA 3KZYA 1WXRA 4RHBB 1A1JA 3ADLA 4O43A 3F6HA 2LV2A 2RQLA 1PDAA 3C6KA 4R2RA 1IBLE 2NUFA 4M30A 2UUAE 2YWQA 2LUQA 2EN1A 4HTGA 4ZYEA 5LMNE 4DV0E 1IBKE 2LMZA 3EPHA 2WCC3 4LF8E 3ZOQB 4DV2E 3HQ1A 2CSHA 4O4KA 2JR1A 5TSEA 4B3SE 4JI6E 2BBGA 2KONA 4DV7E 1A1FA 4JI5E 2MC6A 2Q8UA 2EOQA 2LBSB 4JI7E 2YRHA 2JXPA 5AC4A 4L5NC 1X48A 4YY3E 2R1FA 4F6MA 2DLKA 4DV1E 5LLQA 1XNRE 3VK6A 2EPPA 4I8OA 2RSMA 1A1LA 2ADRA 1T4OA 4OX9E 2YTNA 2LVHA 2JWOA 1A1HA 2EMXA 2JOBA 1AH5A 2LJHA 5KL6A 4K0KE 4AQYE 5CFFE 2UXCE 1PJQA 2WZOA 1A1KA 2YTJA 4MLVA 4LU9A 1B69A 1N36E 2LE2A 1YYWA 1HNZE 4JI0E 2M9AA 5AE2A 4NZVA 4TUIA 3VYYA 3ADIA 2EOHA 2B9DA 3BBGA 1TF6A 4LF7E 4BS9A 5AE3A 1N33E 3HPSA 1T39A 2DMYA 2N3HA 4LTYA 4Q35B 2EMWA 1X49A 4M9VC 3T1YE 2NUGA 2EMZA 2YTEA 3AV0A 2EJ4A 3FIGA 2UXBE 2EPMX 5AE1A 2EPKX 3QG5C 2E72A 3K6QA 1ZAAC 4DV4E 2EOOA 3C4TA 1ZU1A 2VF1A 2YU8A 5A6BA 4IS1C 1BBOA 1GTKA 3HPZA 4JI8E 2NABA 3RMPA 3VHTB 2RPCA 1IMUA 2MC5A 2EP3A 2CTDA 3JAMC 2YTPA 1SFEA 2LCEA 1DGCA 2CT1A 3J81C 2EMIA 2LO3A 5ADZA 2E5LE 1RQ0A 4NXME 2EMBA 3OMLA 5KL4A 1WHNA 2HJJA 4Q28A 1KYQA 5LMUE 4LFCE 4JV5E 3J80C 2EM8A 3IWCA 4RH8A 2VQEE 2YU5A 4B3ME 2GHFA 4GZNC 2V85A 5IV8B 1J5EE 1FJGE 4ZYDA 1UBDC 2YSPA 5IXMB 4DUYE 3HTXA 2I13A 2LRSA 3M99B 4BC7A 2V86A 2NA2A 4GKJE 4WXCA 3THNA 2EPAA 4X64E 4N4RB 2EOJA 2EQ1A 2MDRA 5A2QC 1PJTA 5AASA 2EL5A 2ODRC 4BCAA 1J26A 3EPLA 1TN9A 1I94E 2EN3A 2EM2A 2WBTA 2L3CA 2FTXB 2ELZA 2WBUA 3THOB 1QU6A 2A25A 4LF9E 2B7VA 2CPNA 1YUJA 2EPRA 1KJKA 4R2QA 4KWYA 1MGTA 2K7IA 3F6GA 4WFTA 2EL6A 3BGHA 2ENAA 2ODRD 3C6MA 1ZBQA 3IWBA 1X3CA 1DI2A 4BHCA 4X65E 2L8TA 2J7JA 1YUIA 2EN4A 2ELYA 2L2MA 2D9HA 2LUPB 2EOSA 2B3TB 1MEYC 2L2KB 4R2CA 2EN6A 5KL5A 1PJSA 1O0WA 1Z1BA 2GLIA 4R2EA 2M4IA 4WSPA 1UHZA 5DNYA 2DMIA 2EMAA 4R2PA 1QNTA 2DRPA 1G2DC 1YZ9A 2EPXA 1ZBTA 1SR9A 2FV4B 4WPYA 2LT7A 1DQ3A 5A6AA 3VYXA 4TUGA 1HNXE 4NHRA 1YSAC 2BB8A 3IWDA 2B7TA 2VQFE 2EM9A 2FGGA 2V88A 5KL7A 3MHSC 1EH7A 2EOXA 5BR8E 2KHXA 1RC7A 2LTRA 2YTIA 4R03A 1UILA 2EZ6A 1GQEA 1NEIA 3KZZA 4DR3E 1HR0E 1IQOA 3UK3C 2EMYA 1EH6A 2RSIA 4X62E 2WBSA 2UU9E 2IHR1 4R2AA 2RTXA 3EQ1A 5IT9C 4LFBE 4BHBA 1EKZA 5A69A 2PRTA 5KL2A 1N3GA 3L00A 1X6HA 1X5WA 4DMIA 3LMLA 1T38A 4ZYHA 2EOZA 3MSWA 1BB8A 2EOIA 2EQ0A 1LLMC 3AUZA 2DSYA 2DB2A 5A6KA 2EOYA 4JI2E 3EPKA 4DR7E 2F8BA 2M1SA 2V83A 2YRKA 2HHHE 1X6FA 3JU0A 2ENHA 3JTZA 1F2IG 4B3RE 4M0VA 2EORA 2EL4A 1WJPA 2YTQA 3ECRA 3H09A 2L3JA 1XMOE 4WXDA 1STUA 2EM6A 1IBME 2H36X 2JVAA 2LJUA 4DR6E 1EH8A 4F54A 3P1XA 1YFHA 4WX9A 1WRJA 3EPJA 2JOXA 4L8NA 4X66E 4KZSA 5A6JA 2EOFA 2L2NA 2EM5A 5IWAE 2UUCE 4JYAE 2EMCA 4J8ZA 4IJDA 2UUBE 1GZ6A 2HGHA 2EQ3A 4GKKE 2G7HA 3BF2A 5FLXC 3ADJA 5LL6R 1BBGA 2L92A 1WHQA 2EMHA 2GPIA 1ZR9A 4NXNE 4R2DA 3DF6A 2DGCA 4DUZE 2EPNA 4YHHE 2EN2A 4LF4E 2JY9A 4DR4E 1RMDA 2NUEA 4WSGA 2KOUA 2N3GA 1X47A 2EOEA 1T4LB 4DR2E 2YT4A 4R8OA 2VE7C 4BBYA 2JP9A 1AAYA 3OTOE 4DR5E 1G2FC 5T6JA 4O24A 2EM3A 4OOGC 3J7AG 2MKDA 5KL3A 4DKKA 3KWRA 4GEQB 4R2SA 3HXLA 2EMGA 2V89A 4F9AB 2E1MA 4B3TE 4BC9A 1JK2A 4F2JC 2EWLA 1PKPA 2EN8A 4X9JA 2EMFA 2UXDE 2EMKA 4JI3E 4LF6E 2EN7A 4F6NA 2DLQA 1IQSA 1NCSA 4F9BB 1N32E 2ENCA 4X8WA 1YYOA 2EPLX 4FK5C 2RS7A 4HEIA 2EPCA 2ZM6E 4P7DA
chains in the Genus database with same CATH topology
2DB2A 2JWOA 2LRSA 4BC7A 4JI2E 2JOBA 2LJHA 4LF5E 2V86A 2F8BA 2M1SA 2NA2A 2V83A 4AQYE 5CFFE 3T1HE 2HHHE 4K0KE 2UXCE 2DIXA 2WZOA 4GKJE 4LU9A 4X64E 1N36E 2LE2A 1YYWA 1HNZE 1YYKA 4JI0E 2MDRA 3JU0A 5AE2A 5A2QC 3JTZA 4JI4E 4DV3E 5AASA 4TUIA 3VYYA 3ADIA 4B3RE 4M0VA 2NUFA 2ODRC 4BCAA 2B9DA 1J26A 4JI1E 3H09A 1I94E 2L3JA 1XMOE 1STUA 1IBME 2H36X 2JVAA 4DR6E 4LF7E 2L3CA 4F54A 3P1XA 4KHPE 1XMQE 2FTXB 2V8QB 4BS9A 2L33A 5AE3A 4DV6E 1N33E 3HPSA 2YZTA 2DMYA 4M2ZA 1QU6A 2JOXA 4L8NA 4X66E 4KZSA 2N3HA 4LTYA 2M7QA 1T4NA 1HNWE 2L2NA 2L6MA 4DV5E 1X49A 5IWAE 2V87A 4LF9E 4P78A 4DR1E 2B7VA 2CPNA 3LLHA 2UUCE 4JYAE 3T1YE 3AUZA 3VYXA 2NUGA 4WYQB 3AV0A 4J8ZA 2UUBE 3FIGA 2UXBE 1GZ6A 3F6GA 4WFTA 5AE1A 2ODRD 4BMJA 4LFAE 1ZBQA 3IWBA 4GKKE 2G7HA 5FLXC 1DI2A 4X65E 3ADJA 3K6QA 5LL6R 2L8TA 4F9CB 1N34E 2L92A 4DV4E 1XNQE 1FKAE 3C4TA 1WHQA 2VF1A 2RS6A 4NXNE 2L2MA 5F3WA 2F4VE 3DF6A 4DUZE 2LUPB 3HPZA 2B3TB 4JI8E 4YHHE 2L2KB 4LF4E 3C4BA 3RMPA 2JY9A 4DR4E 3ADGA 2LTSA 3J7Yp 3DJWA 2K4VA 1O0WA 2NUEA 1WXRA 2KOUA 2N3GA 1X47A 1T4LB 2M4IA 4WSPA 1UHZA 2MC5A 2YT4A 4R8OA 2VE7C 4BBYA 5DNYA 4DR2E 3ADLA 3F6HA 3JAMC 1YZ9A 1ZBTA 1SR9A 2FV4B 4WPYA 3J81C 1DQ3A 3OTOE 4M30A 4DR5E 4TUGA 5ADZA 5T6JA 1IBLE 1HNXE 3IWDA 1RQ0A 4OOGC 2B7TA 2VQFE 2E5LE 2LUQA 5LMNE 4NXME 3J7AG 2FGGA 3OMLA 2V88A 1WHNA 3KWRA 4DKKA 2LMZA 5BR8E 4DV0E 1IBKE 4DR7E 2KHXA 4GEQB 4LF8E 3HXLA 1RC7A 4Q28A 2V89A 3ZOQB 4F9AB 2LTRA 2E1MA 4B3TE 5LMUE 4DV2E 3HQ1A 4R03A 4BC9A 4LFCE 1UILA 2JR1A 2EWLA 1PKPA 1GQEA 4B3SE 2EZ6A 2UXDE 4JV5E 3J80C 4JI3E 4LF6E 4JI6E 2UUAE 3IWCA 2KONA 4DV7E 4JI5E 4DR3E 2MC6A 2VQEE 4B3ME 2LBSB 4JI7E 4F9BB 1HR0E 1N32E 2V85A 1J5EE 4X62E 4X8WA 1YYOA 2UU9E 1FJGE 2IHR1 2RTXA 5IT9C 4LFBE 1EKZA 4L5NC 1X48A 4YY3E 2RS7A 4DV1E 4DMIA 3LMLA 1XNRE 3VK6A 4DUYE 3MSWA 4I8OA 4P7DA 2ZM6E 2RSMA 3HTXA 1T4OA 4OX9E 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC6 A;  2MC5 A; 
#chains in the Genus database with same CATH topology
 2EE8 A;  4LF5 E;  3T1H E;  2MKN A;  2DIX A;  1UN6 B;  2EOM A;  2EM7 A;  2YPN A;  1X6E A;  1JK1 A;  3BID A;  1YYK A;  2VRD A;  1YPN A;  4JI4 E;  2MDG A;  4DV3 E;  5AC5 A;  2HC5 A;  4JI1 E;  1P47 A;  2YTD A;  1A1G A;  4KHP E;  1XMQ E;  2V8Q B;  2L33 A;  4DV6 E;  2YRM A;  4M2Z A;  2YZT A;  1A1I A;  1L4S A;  4ZYG A;  2YTF A;  2M7Q A;  1T4N A;  1HNW E;  2L6M A;  4DV5 E;  2EM0 A;  2V87 A;  4P78 A;  4DR1 E;  2EPO A;  3LLH A;  1TF3 A;  4WYQ B;  2EM4 A;  2JPA A;  2YTO A;  4BMJ A;  4LFA E;  2JYA A;  2EML A;  3MHH C;  4F9C B;  1N34 E;  2EPU A;  1XNQ E;  4MLQ A;  1FKA E;  2RS6 A;  2R76 A;  4O5G A;  2I9I A;  5A6B D;  5F3W A;  3TQM A;  2F4V E;  3C4B A;  2N8X A;  2YTG A;  3ADG A;  2LTS A;  2YSO A;  3J7Y p;  3DJW A;  2EPZ A;  2K4V A;  3KZY A;  1WXR A;  4RHB B;  1A1J A;  3ADL A;  4O43 A;  3F6H A;  2LV2 A;  2RQL A;  1PDA A;  3C6K A;  4R2R A;  1IBL E;  2NUF A;  4M30 A;  2UUA E;  2YWQ A;  2LUQ A;  2EN1 A;  4HTG A;  4ZYE A;  5LMN E;  4DV0 E;  1IBK E;  2LMZ A;  3EPH A;  2WCC 3;  4LF8 E;  3ZOQ B;  4DV2 E;  3HQ1 A;  2CSH A;  4O4K A;  2JR1 A;  5TSE A;  4B3S E;  4JI6 E;  2BBG A;  2KON A;  4DV7 E;  1A1F A;  4JI5 E;  2MC6 A;  2Q8U A;  2EOQ A;  2LBS B;  4JI7 E;  2YRH A;  2JXP A;  5AC4 A;  4L5N C;  1X48 A;  4YY3 E;  2R1F A;  4F6M A;  2DLK A;  4DV1 E;  5LLQ A;  1XNR E;  3VK6 A;  2EPP A;  4I8O A;  2RSM A;  1A1L A;  2ADR A;  1T4O A;  4OX9 E;  2YTN A;  2LVH A;  2JWO A;  1A1H A;  2EMX A;  2JOB A;  1AH5 A;  2LJH A;  5KL6 A;  4K0K E;  4AQY E;  5CFF E;  2UXC E;  1PJQ A;  2WZO A;  1A1K A;  2YTJ A;  4MLV A;  4LU9 A;  1B69 A;  1N36 E;  2LE2 A;  1YYW A;  1HNZ E;  4JI0 E;  2M9A A;  5AE2 A;  4NZV A;  4TUI A;  3VYY A;  3ADI A;  2EOH A;  2B9D A;  3BBG A;  1TF6 A;  4LF7 E;  4BS9 A;  5AE3 A;  1N33 E;  3HPS A;  1T39 A;  2DMY A;  2N3H A;  4LTY A;  4Q35 B;  2EMW A;  1X49 A;  4M9V C;  3T1Y E;  2NUG A;  2EMZ A;  2YTE A;  3AV0 A;  2EJ4 A;  3FIG A;  2UXB E;  2EPM X;  5AE1 A;  2EPK X;  3QG5 C;  2E72 A;  3K6Q A;  1ZAA C;  4DV4 E;  2EOO A;  3C4T A;  1ZU1 A;  2VF1 A;  2YU8 A;  5A6B A;  4IS1 C;  1BBO A;  1GTK A;  3HPZ A;  4JI8 E;  2NAB A;  3RMP A;  3VHT B;  2RPC A;  1IMU A;  2MC5 A;  2EP3 A;  2CTD A;  3JAM C;  2YTP A;  1SFE A;  2LCE A;  1DGC A;  2CT1 A;  3J81 C;  2EMI A;  2LO3 A;  5ADZ A;  2E5L E;  1RQ0 A;  4NXM E;  2EMB A;  3OML A;  5KL4 A;  1WHN A;  2HJJ A;  4Q28 A;  1KYQ A;  5LMU E;  4LFC E;  4JV5 E;  3J80 C;  2EM8 A;  3IWC A;  4RH8 A;  2VQE E;  2YU5 A;  4B3M E;  2GHF A;  4GZN C;  2V85 A;  5IV8 B;  1J5E E;  1FJG E;  4ZYD A;  1UBD C;  2YSP A;  5IXM B;  4DUY E;  3HTX A;  2I13 A;  2LRS A;  3M99 B;  4BC7 A;  2V86 A;  2NA2 A;  4GKJ E;  4WXC A;  3THN A;  2EPA A;  4X64 E;  4N4R B;  2EOJ A;  2EQ1 A;  2MDR A;  5A2Q C;  1PJT A;  5AAS A;  2EL5 A;  2ODR C;  4BCA A;  1J26 A;  3EPL A;  1TN9 A;  1I94 E;  2EN3 A;  2EM2 A;  2WBT A;  2L3C A;  2FTX B;  2ELZ A;  2WBU A;  3THO B;  1QU6 A;  2A25 A;  4LF9 E;  2B7V A;  2CPN A;  1YUJ A;  2EPR A;  1KJK A;  4R2Q A;  4KWY A;  1MGT A;  2K7I A;  3F6G A;  4WFT A;  2EL6 A;  3BGH A;  2ENA A;  2ODR D;  3C6M A;  1ZBQ A;  3IWB A;  1X3C A;  1DI2 A;  4BHC A;  4X65 E;  2L8T A;  2J7J A;  1YUI A;  2EN4 A;  2ELY A;  2L2M A;  2D9H A;  2LUP B;  2EOS A;  2B3T B;  1MEY C;  2L2K B;  4R2C A;  2EN6 A;  5KL5 A;  1PJS A;  1O0W A;  1Z1B A;  2GLI A;  4R2E A;  2M4I A;  4WSP A;  1UHZ A;  5DNY A;  2DMI A;  2EMA A;  4R2P A;  1QNT A;  2DRP A;  1G2D C;  1YZ9 A;  2EPX A;  1ZBT A;  1SR9 A;  2FV4 B;  4WPY A;  2LT7 A;  1DQ3 A;  5A6A A;  3VYX A;  4TUG A;  1HNX E;  4NHR A;  1YSA C;  2BB8 A;  3IWD A;  2B7T A;  2VQF E;  2EM9 A;  2FGG A;  2V88 A;  5KL7 A;  3MHS C;  1EH7 A;  2EOX A;  5BR8 E;  2KHX A;  1RC7 A;  2LTR A;  2YTI A;  4R03 A;  1UIL A;  2EZ6 A;  1GQE A;  1NEI A;  3KZZ A;  4DR3 E;  1HR0 E;  1IQO A;  3UK3 C;  2EMY A;  1EH6 A;  2RSI A;  4X62 E;  2WBS A;  2UU9 E;  2IHR 1;  4R2A A;  2RTX A;  3EQ1 A;  5IT9 C;  4LFB E;  4BHB A;  1EKZ A;  5A69 A;  2PRT A;  5KL2 A;  1N3G A;  3L00 A;  1X6H A;  1X5W A;  4DMI A;  3LML A;  1T38 A;  4ZYH A;  2EOZ A;  3MSW A;  1BB8 A;  2EOI A;  2EQ0 A;  1LLM C;  3AUZ A;  2DSY A;  2DB2 A;  5A6K A;  2EOY A;  4JI2 E;  3EPK A;  4DR7 E;  2F8B A;  2M1S A;  2V83 A;  2YRK A;  2HHH E;  1X6F A;  3JU0 A;  2ENH A;  3JTZ A;  1F2I G;  4B3R E;  4M0V A;  2EOR A;  2EL4 A;  1WJP A;  2YTQ A;  3ECR A;  3H09 A;  2L3J A;  1XMO E;  4WXD A;  1STU A;  2EM6 A;  1IBM E;  2H36 X;  2JVA A;  2LJU A;  4DR6 E;  1EH8 A;  4F54 A;  3P1X A;  1YFH A;  4WX9 A;  1WRJ A;  3EPJ A;  2JOX A;  4L8N A;  4X66 E;  4KZS A;  5A6J A;  2EOF A;  2L2N A;  2EM5 A;  5IWA E;  2UUC E;  4JYA E;  2EMC A;  4J8Z A;  4IJD A;  2UUB E;  1GZ6 A;  2HGH A;  2EQ3 A;  4GKK E;  2G7H A;  3BF2 A;  5FLX C;  3ADJ A;  5LL6 R;  1BBG A;  2L92 A;  1WHQ A;  2EMH A;  2GPI A;  1ZR9 A;  4NXN E;  4R2D A;  3DF6 A;  2DGC A;  4DUZ E;  2EPN A;  4YHH E;  2EN2 A;  4LF4 E;  2JY9 A;  4DR4 E;  1RMD A;  2NUE A;  4WSG A;  2KOU A;  2N3G A;  1X47 A;  2EOE A;  1T4L B;  4DR2 E;  2YT4 A;  4R8O A;  2VE7 C;  4BBY A;  2JP9 A;  1AAY A;  3OTO E;  4DR5 E;  1G2F C;  5T6J A;  4O24 A;  2EM3 A;  4OOG C;  3J7A G;  2MKD A;  5KL3 A;  4DKK A;  3KWR A;  4GEQ B;  4R2S A;  3HXL A;  2EMG A;  2V89 A;  4F9A B;  2E1M A;  4B3T E;  4BC9 A;  1JK2 A;  4F2J C;  2EWL A;  1PKP A;  2EN8 A;  4X9J A;  2EMF A;  2UXD E;  2EMK A;  4JI3 E;  4LF6 E;  2EN7 A;  4F6N A;  2DLQ A;  1IQS A;  1NCS A;  4F9B B;  1N32 E;  2ENC A;  4X8W A;  1YYO A;  2EPL X;  4FK5 C;  2RS7 A;  4HEI A;  2EPC A;  2ZM6 E;  4P7D A; 
#chains in the Genus database with same CATH homology
 2DB2 A;  2JWO A;  2LRS A;  4BC7 A;  4JI2 E;  2JOB A;  2LJH A;  4LF5 E;  2V86 A;  2F8B A;  2M1S A;  2NA2 A;  2V83 A;  4AQY E;  5CFF E;  3T1H E;  2HHH E;  4K0K E;  2UXC E;  2DIX A;  2WZO A;  4GKJ E;  4LU9 A;  4X64 E;  1N36 E;  2LE2 A;  1YYW A;  1HNZ E;  1YYK A;  4JI0 E;  2MDR A;  3JU0 A;  5AE2 A;  5A2Q C;  3JTZ A;  4JI4 E;  4DV3 E;  5AAS A;  4TUI A;  3VYY A;  3ADI A;  4B3R E;  4M0V A;  2NUF A;  2ODR C;  4BCA A;  2B9D A;  1J26 A;  4JI1 E;  3H09 A;  1I94 E;  2L3J A;  1XMO E;  1STU A;  1IBM E;  2H36 X;  2JVA A;  4DR6 E;  4LF7 E;  2L3C A;  4F54 A;  3P1X A;  4KHP E;  1XMQ E;  2FTX B;  2V8Q B;  4BS9 A;  2L33 A;  5AE3 A;  4DV6 E;  1N33 E;  3HPS A;  2YZT A;  2DMY A;  4M2Z A;  1QU6 A;  2JOX A;  4L8N A;  4X66 E;  4KZS A;  2N3H A;  4LTY A;  2M7Q A;  1T4N A;  1HNW E;  2L2N A;  2L6M A;  4DV5 E;  1X49 A;  5IWA E;  2V87 A;  4LF9 E;  4P78 A;  4DR1 E;  2B7V A;  2CPN A;  3LLH A;  2UUC E;  4JYA E;  3T1Y E;  3AUZ A;  3VYX A;  2NUG A;  4WYQ B;  3AV0 A;  4J8Z A;  2UUB E;  3FIG A;  2UXB E;  1GZ6 A;  3F6G A;  4WFT A;  5AE1 A;  2ODR D;  4BMJ A;  4LFA E;  1ZBQ A;  3IWB A;  4GKK E;  2G7H A;  5FLX C;  1DI2 A;  4X65 E;  3ADJ A;  3K6Q A;  5LL6 R;  2L8T A;  4F9C B;  1N34 E;  2L92 A;  4DV4 E;  1XNQ E;  1FKA E;  3C4T A;  1WHQ A;  2VF1 A;  2RS6 A;  4NXN E;  2L2M A;  5F3W A;  2F4V E;  3DF6 A;  4DUZ E;  2LUP B;  3HPZ A;  2B3T B;  4JI8 E;  4YHH E;  2L2K B;  4LF4 E;  3C4B A;  3RMP A;  2JY9 A;  4DR4 E;  3ADG A;  2LTS A;  3J7Y p;  3DJW A;  2K4V A;  1O0W A;  2NUE A;  1WXR A;  2KOU A;  2N3G A;  1X47 A;  1T4L B;  2M4I A;  4WSP A;  1UHZ A;  2MC5 A;  2YT4 A;  4R8O A;  2VE7 C;  4BBY A;  5DNY A;  4DR2 E;  3ADL A;  3F6H A;  3JAM C;  1YZ9 A;  1ZBT A;  1SR9 A;  2FV4 B;  4WPY A;  3J81 C;  1DQ3 A;  3OTO E;  4M30 A;  4DR5 E;  4TUG A;  5ADZ A;  5T6J A;  1IBL E;  1HNX E;  3IWD A;  1RQ0 A;  4OOG C;  2B7T A;  2VQF E;  2E5L E;  2LUQ A;  5LMN E;  4NXM E;  3J7A G;  2FGG A;  3OML A;  2V88 A;  1WHN A;  3KWR A;  4DKK A;  2LMZ A;  5BR8 E;  4DV0 E;  1IBK E;  4DR7 E;  2KHX A;  4GEQ B;  4LF8 E;  3HXL A;  1RC7 A;  4Q28 A;  2V89 A;  3ZOQ B;  4F9A B;  2LTR A;  2E1M A;  4B3T E;  5LMU E;  4DV2 E;  3HQ1 A;  4R03 A;  4BC9 A;  4LFC E;  1UIL A;  2JR1 A;  2EWL A;  1PKP A;  1GQE A;  4B3S E;  2EZ6 A;  2UXD E;  4JV5 E;  3J80 C;  4JI3 E;  4LF6 E;  4JI6 E;  2UUA E;  3IWC A;  2KON A;  4DV7 E;  4JI5 E;  4DR3 E;  2MC6 A;  2VQE E;  4B3M E;  2LBS B;  4JI7 E;  4F9B B;  1HR0 E;  1N32 E;  2V85 A;  1J5E E;  4X62 E;  4X8W A;  1YYO A;  2UU9 E;  1FJG E;  2IHR 1;  2RTX A;  5IT9 C;  4LFB E;  1EKZ A;  4L5N C;  1X48 A;  4YY3 E;  2RS7 A;  4DV1 E;  4DMI A;  3LML A;  1XNR E;  3VK6 A;  4DUY E;  3MSW A;  4I8O A;  4P7D A;  2ZM6 E;  2RSM A;  3HTX A;  1T4O A;  4OX9 E;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...