2MC5A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by -factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Protein binding
molecule keywords 45L
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc5A00
2MC5A 2MC6A
chains in the Genus database with same CATH superfamily
2RS6A 4DV5E 4KWYA 1TF3A 1A1FA 1A1KA 2LRSA 4R2QA 4LF4E 3FIGA 2CT1A 2EPAA 4M0VA 3BF2A 3ZOQB 1IBME 4WPYA 4IS1C 1X6FA 4IJDA 2EL4A 4F9BB 3DJWA 4DUZE 4WXDA 2MDRA 1STUA 3L00A 2B9DA 5KL5A 4R2EA 1PDAA 2I13A 2EL5A 3JTZA 5KL6A 3MSWA 4F6NA 1A1GA 2EMHA 2EOSA 1GZ6A 4NHRA 4P78A 1IQOA 5KL7A 1B69A 2DGCA 2EMGA 2VE7C 2RQLA 1NCSA 4JI3E 4YY3E 1QU6A 5AC4A 3ADJA 3EPKA 2CPNA 1WHQA 2EPZA 2YTNA 4GEQB 2EN7A 2YTJA 2MKDA 1I94E 3LLHA 1TF6A 1X48A 3HQ1A 2EOZA 1X3CA 1AAYA 2ENAA 4BC7A 4R2RA 5LMNE 2F4VE 3EPLA 2EP3A 2KONA 3JU0A 3AUZA 1T39A 2EMAA 4F2JC 2EN3A 2J7JA 5A6BD 4YHHE 3J7AG 2V8QB 4TUGA 5F3WA 2EZ6A 4BHCA 2VQEE 4DR7E 4NZVA 1T38A 4JI7E 1N32E 3C6KA 4R8OA 4JI4E 4R2AA 4JI1E 2EM5A 5AASA 5LLQA 2EPMX 3BGHA 2LT7A 4O4KA 3DF6A 4X65E 2EOQA 1RC7A 4LF5E 1YUJA 2EPRA 4R2CA 2L2MA 4MLQA 1FKAE 2NUEA 3VYYA 2ADRA 2LTSA 5IV8B 3QG5C 2JR1A 2EMZA 2R1FA 3M99B 2K4VA 2V85A 1N3GA 2EPXA 2H36X 2L3JA 3EQ1A 4ZYGA 2YSOA 2EM6A 4ZYDA 4B3RE 1SFEA 2GLIA 2HJJA 1G2FC 4DR1E 2FGGA 2A25A 2MC5A 1HNWE 1MGTA 4HTGA 2CTDA 1N36E 4LF6E 4JI0E 2NABA 4GKKE 1T4LB 1ZBTA 2EMLA 2LJUA 3EPJA 4DR4E 2EM9A 1XMQE 4JYAE 5A6BA 4Q28A 4L5NC 4L8NA 4KHPE 1DI2A 1XNRE 3F6GA 4JV5E 5LMUE 2YRMA 3VHTB 4WXCA 4O24A 1EH7A 1X49A 2HHHE 4OX9E 1YZ9A 1BB8A 4R2PA 2EMFA 2RPCA 4DR2E 3VYXA 4HEIA 4M30A 2UXBE 2YTEA 2WBSA 2GPIA 2LTRA 4LU9A 2EQ1A 4X9JA 3ADIA 4DV4E 2EM2A 2YWQA 5AE2A 2RTXA 2JWOA 5KL2A 2YU8A 1HR0E 1UN6B 1G2DC 2EOIA 2EPCA 3T1YE 3K6QA 2EOHA 2E1MA 2EOXA 4J8ZA 1PKPA 2EQ3A 2LUPB 3C6MA 1A1LA 1T4OA 2EM0A 2ENCA 2EN2A 2KOUA 2ODRD 5LL6R 4O43A 2LMZA 1YUIA 5AE1A 5AE3A 2LBSB 4N4RB 4JI6E 4X66E 1TN9A 4LFAE 1YSAC 2YT4A 3C4TA 2JY9A 4DR6E 4JI5E 2VRDA 4LF8E 1BBGA 2NA2A 4R2DA 5A6JA 4LFBE 4BMJA 4DV1E 4ZYEA 2GHFA 1KJKA 2FTXB 2EM7A 1P47A 2JP9A 3HPZA 1DGCA 2LJHA 1AH5A 2RSMA 1SR9A 2LE2A 4R2SA 2EL6A 2EWLA 2HGHA 2YPNA 2EQ0A 1UHZA 1XMOE 1MEYC 1ZU1A 2EOEA 2EPPA 2L92A 2UXCE 2L2KB 2EM3A 2MKNA 3ECRA 2WBTA 3RMPA 1YYWA 2EMYA 2YTDA 1GQEA 2L8TA 2LV2A 2YTGA 2YRHA 3HTXA 2B7TA 4X64E 2V86A 1F2IG 2EMWA 2FV4B 4B3SE 4DV7E 3BBGA 1DQ3A 2YRKA 2B3TB 2ODRC 1J5EE 3EPHA 2ELYA 4RH8A 1YPNA 3KZZA 5FLXC 2DSYA 5IT9C 2ZM6E 4LFCE 2BB8A 2YTFA 4DUYE 2MDGA 2PRTA 4DV2E 2NUGA 2D9HA 4DV6E 2JYAA 3MHHC 3ADGA 2DIXA 2N3GA 2EMBA 2EJ4A 2ELZA 3KZYA 2LUQA 2B7VA 2JOXA 5DNYA 2HC5A 4MLVA 1WRJA 4I8OA 2EORA 2YTOA 1O0WA 5A2QC 3MHSC 2EOMA 2N3HA 4ZYHA 1RQ0A 2EOOA 4BC9A 4BBYA 2UUAE 4FK5C 4WSPA 3UK3C 2EN8A 1IMUA 1PJTA 2YTPA 4F54A 2E5LE 4M2ZA 1EH8A 2EPLX 3THOB 2EMCA 1WHNA 2DLKA 2EE8A 2VF1A 2V83A 3HPSA 1A1JA 2L3CA 4WYQB 1A1HA 4WFTA 2WBUA 1UBDC 5T6JA 1FJGE 3J80C 2EOJA 3H09A 4WX9A 2DMYA 1X6EA 1N33E 3LMLA 1N34E 2V87A 2IHR1 2UUCE 2EMIA 1WJPA 3OMLA 5A6KA 1XNQE 5BR8E 1BBOA 4B3TE 2EN4A 2WZOA 2YZTA 2CSHA 3IWBA 4F9CB 5KL3A 1ZBQA 1IQSA 2BBGA 2ENHA 3AV0A 2EM4A 2M4IA 1GTKA 2DB2A 3IWCA 2YU5A 1IBLE 1IBKE 1Z1BA 2V89A 4DR5E 3OTOE 1ZAAC 2EOYA 1J26A 5ADZA 4LF7E 5TSEA 1ZR9A 4KZSA 2YSPA 2F8BA 2YTQA 2RSIA 4R03A 3J81C 4TUIA 1PJQA 2EOFA 2VQFE 4Q35B 4JI8E 4K0KE 1HNZE 2MC6A 1NEIA 2LCEA 2R76A 2EPOA 4DR3E 3F6HA 3THNA 4P7DA 2EM8A 2EN1A 2M7QA 5A6AA 4B3ME 2N8XA 4BCAA 1X6HA 4X62E 2EMXA 1YFHA 3ADLA 4GKJE 2E72A 4LTYA 2Q8UA 4DV3E 3P1XA 4DMIA 4F9AB 1T4NA 3HXLA 4LF9E 2DRPA 2UXDE 4M9VC 1A1IA 2G7HA 3VK6A 1EH6A 2JVAA 3KWRA 2RS7A 1JK2A 1L4SA 1KYQA 4GZNC 5IWAE 4BHBA 1RMDA 2UU9E 2L33A 3TQMA 4DV0E 4F6MA 4NXME 2EPKX 1YYKA 2V88A 4JI2E 5KL4A 4X8WA 2YTIA 2UUBE 1EKZA 2NUFA 4NXNE 1JK1A 4RHBB 1X47A 2EPUA 1LLMC 2LVHA 2I9IA 3J7Yp 2K7IA 4O5GA 5CFFE 4OOGC 4DKKA 4BS9A 1PJSA 2WCC3 3JAMC 2KHXA 1WXRA 2EMKA 1HNXE 3T1HE 1YYOA 2EN6A 2L2NA 2M1SA 2EPNA 3C4BA 2JXPA 1UILA 4AQYE 1QNTA 2M9AA 2DMIA 5AC5A 2LO3A 3BIDA 5A69A 4WSGA 3IWDA 2L6MA 2JPAA 1X5WA 2DLQA 5IXMB 2JOBA
chains in the Genus database with same CATH topology
3OTOE 4X64E 4B3RE 2RS6A 2V86A 4DV5E 1J26A 5ADZA 2FV4B 4B3SE 4DR1E 4LF7E 2FGGA 2LRSA 2MC5A 4DV7E 1HNWE 1N36E 4LF6E 4JI0E 4LF4E 4KZSA 4GKKE 2F8BA 1DQ3A 1T4LB 1ZBTA 2B3TB 2ODRC 3FIGA 1J5EE 4DR4E 1XMQE 4M0VA 4R03A 3ZOQB 4Q28A 5FLXC 2DSYA 4L5NC 4L8NA 3J81C 4WPYA 4TUIA 5IT9C 2ZM6E 2VQFE 4JI8E 4LFCE 4K0KE 4KHPE 1HNZE 4F9BB 1DI2A 1XNRE 3F6GA 3DJWA 4DUYE 4DUZE 2MC6A 4JV5E 5LMUE 2MDRA 4DV2E 1STUA 2NUGA 2B9DA 4DV6E 4DR3E 3F6HA 1X49A 2HHHE 4OX9E 1YZ9A 4P7DA 3JTZA 3MSWA 3ADGA 2M7QA 4DR2E 4B3ME 2DIXA 4BCAA 2N3GA 3VYXA 1IBME 4M30A 2UXBE 1GZ6A 4X62E 4P78A 2LTRA 3ADLA 4GKJE 4LU9A 2LUQA 3ADIA 4LTYA 4DV4E 4DV3E 2B7VA 2JOXA 5DNYA 2VE7C 5AE2A 4I8OA 2RTXA 2JWOA 3P1XA 4JI3E 4YY3E 1O0WA 5A2QC 1QU6A 1HR0E 4DMIA 3ADJA 4F9AB 1T4NA 3HXLA 2CPNA 2N3HA 3T1YE 1WHQA 3K6QA 1RQ0A 4BC9A 2UUAE 4BBYA 2E1MA 4LF9E 2UXDE 4GEQB 4J8ZA 1PKPA 1I94E 2G7HA 3LLHA 4WSPA 3VK6A 2LUPB 1X48A 3KWRA 2JVAA 3HQ1A 2RS7A 1T4OA 4BC7A 5LMNE 2F4VE 2KONA 3JU0A 4F54A 3AUZA 2KOUA 2E5LE 5IWAE 4M2ZA 2UU9E 2ODRD 5LL6R 2L33A 4DV0E 2LMZA 4YHHE 4NXME 1WHNA 3J7AG 2V8QB 4TUGA 5F3WA 2V88A 2VF1A 5AE1A 4JI2E 5AE3A 2LBSB 1YYKA 2EZ6A 4X8WA 4JI6E 2VQEE 4X66E 4DR7E 2V83A 4LFAE 4JI7E 1N32E 3HPSA 2UUBE 2YT4A 2L3CA 4R8OA 4WYQB 3C4TA 4WFTA 1EKZA 2NUFA 4JI4E 4NXNE 1X47A 2JY9A 4JI1E 4JI5E 4DR6E 4LF8E 5T6JA 1FJGE 2NA2A 3J80C 5AASA 3J7Yp 3H09A 5CFFE 4OOGC 4LFBE 4DKKA 4BMJA 4BS9A 4DV1E 2FTXB 2DMYA 1N33E 3DF6A 4X65E 3LMLA 3JAMC 1N34E 2V87A 3HPZA 1RC7A 2KHXA 1WXRA 2LJHA 2IHR1 2RSMA 1SR9A 2LE2A 2UUCE 4LF5E 4JYAE 2L2MA 3OMLA 1FKAE 1XNQE 2NUEA 2EWLA 5BR8E 3VYYA 3T1HE 1HNXE 4B3TE 2LTSA 1UHZA 2WZOA 1YYOA 1XMOE 2L2NA 2YZTA 2L92A 2UXCE 3IWBA 4F9CB 2M1SA 2L2KB 1ZBQA 2JR1A 3C4BA 1UILA 3AV0A 4AQYE 3RMPA 1YYWA 2K4VA 2M4IA 2DB2A 1GQEA 2L8TA 2V85A 3IWCA 1IBLE 3IWDA 2L6MA 3HTXA 2H36X 1IBKE 2L3JA 2V89A 2B7TA 4DR5E 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC5 A;  2MC6 A; 
#chains in the Genus database with same CATH topology
 2RS6 A;  4DV5 E;  4KWY A;  1TF3 A;  1A1F A;  1A1K A;  2LRS A;  4R2Q A;  4LF4 E;  3FIG A;  2CT1 A;  2EPA A;  4M0V A;  3BF2 A;  3ZOQ B;  1IBM E;  4WPY A;  4IS1 C;  1X6F A;  4IJD A;  2EL4 A;  4F9B B;  3DJW A;  4DUZ E;  4WXD A;  2MDR A;  1STU A;  3L00 A;  2B9D A;  5KL5 A;  4R2E A;  1PDA A;  2I13 A;  2EL5 A;  3JTZ A;  5KL6 A;  3MSW A;  4F6N A;  1A1G A;  2EMH A;  2EOS A;  1GZ6 A;  4NHR A;  4P78 A;  1IQO A;  5KL7 A;  1B69 A;  2DGC A;  2EMG A;  2VE7 C;  2RQL A;  1NCS A;  4JI3 E;  4YY3 E;  1QU6 A;  5AC4 A;  3ADJ A;  3EPK A;  2CPN A;  1WHQ A;  2EPZ A;  2YTN A;  4GEQ B;  2EN7 A;  2YTJ A;  2MKD A;  1I94 E;  3LLH A;  1TF6 A;  1X48 A;  3HQ1 A;  2EOZ A;  1X3C A;  1AAY A;  2ENA A;  4BC7 A;  4R2R A;  5LMN E;  2F4V E;  3EPL A;  2EP3 A;  2KON A;  3JU0 A;  3AUZ A;  1T39 A;  2EMA A;  4F2J C;  2EN3 A;  2J7J A;  5A6B D;  4YHH E;  3J7A G;  2V8Q B;  4TUG A;  5F3W A;  2EZ6 A;  4BHC A;  2VQE E;  4DR7 E;  4NZV A;  1T38 A;  4JI7 E;  1N32 E;  3C6K A;  4R8O A;  4JI4 E;  4R2A A;  4JI1 E;  2EM5 A;  5AAS A;  5LLQ A;  2EPM X;  3BGH A;  2LT7 A;  4O4K A;  3DF6 A;  4X65 E;  2EOQ A;  1RC7 A;  4LF5 E;  1YUJ A;  2EPR A;  4R2C A;  2L2M A;  4MLQ A;  1FKA E;  2NUE A;  3VYY A;  2ADR A;  2LTS A;  5IV8 B;  3QG5 C;  2JR1 A;  2EMZ A;  2R1F A;  3M99 B;  2K4V A;  2V85 A;  1N3G A;  2EPX A;  2H36 X;  2L3J A;  3EQ1 A;  4ZYG A;  2YSO A;  2EM6 A;  4ZYD A;  4B3R E;  1SFE A;  2GLI A;  2HJJ A;  1G2F C;  4DR1 E;  2FGG A;  2A25 A;  2MC5 A;  1HNW E;  1MGT A;  4HTG A;  2CTD A;  1N36 E;  4LF6 E;  4JI0 E;  2NAB A;  4GKK E;  1T4L B;  1ZBT A;  2EML A;  2LJU A;  3EPJ A;  4DR4 E;  2EM9 A;  1XMQ E;  4JYA E;  5A6B A;  4Q28 A;  4L5N C;  4L8N A;  4KHP E;  1DI2 A;  1XNR E;  3F6G A;  4JV5 E;  5LMU E;  2YRM A;  3VHT B;  4WXC A;  4O24 A;  1EH7 A;  1X49 A;  2HHH E;  4OX9 E;  1YZ9 A;  1BB8 A;  4R2P A;  2EMF A;  2RPC A;  4DR2 E;  3VYX A;  4HEI A;  4M30 A;  2UXB E;  2YTE A;  2WBS A;  2GPI A;  2LTR A;  4LU9 A;  2EQ1 A;  4X9J A;  3ADI A;  4DV4 E;  2EM2 A;  2YWQ A;  5AE2 A;  2RTX A;  2JWO A;  5KL2 A;  2YU8 A;  1HR0 E;  1UN6 B;  1G2D C;  2EOI A;  2EPC A;  3T1Y E;  3K6Q A;  2EOH A;  2E1M A;  2EOX A;  4J8Z A;  1PKP A;  2EQ3 A;  2LUP B;  3C6M A;  1A1L A;  1T4O A;  2EM0 A;  2ENC A;  2EN2 A;  2KOU A;  2ODR D;  5LL6 R;  4O43 A;  2LMZ A;  1YUI A;  5AE1 A;  5AE3 A;  2LBS B;  4N4R B;  4JI6 E;  4X66 E;  1TN9 A;  4LFA E;  1YSA C;  2YT4 A;  3C4T A;  2JY9 A;  4DR6 E;  4JI5 E;  2VRD A;  4LF8 E;  1BBG A;  2NA2 A;  4R2D A;  5A6J A;  4LFB E;  4BMJ A;  4DV1 E;  4ZYE A;  2GHF A;  1KJK A;  2FTX B;  2EM7 A;  1P47 A;  2JP9 A;  3HPZ A;  1DGC A;  2LJH A;  1AH5 A;  2RSM A;  1SR9 A;  2LE2 A;  4R2S A;  2EL6 A;  2EWL A;  2HGH A;  2YPN A;  2EQ0 A;  1UHZ A;  1XMO E;  1MEY C;  1ZU1 A;  2EOE A;  2EPP A;  2L92 A;  2UXC E;  2L2K B;  2EM3 A;  2MKN A;  3ECR A;  2WBT A;  3RMP A;  1YYW A;  2EMY A;  2YTD A;  1GQE A;  2L8T A;  2LV2 A;  2YTG A;  2YRH A;  3HTX A;  2B7T A;  4X64 E;  2V86 A;  1F2I G;  2EMW A;  2FV4 B;  4B3S E;  4DV7 E;  3BBG A;  1DQ3 A;  2YRK A;  2B3T B;  2ODR C;  1J5E E;  3EPH A;  2ELY A;  4RH8 A;  1YPN A;  3KZZ A;  5FLX C;  2DSY A;  5IT9 C;  2ZM6 E;  4LFC E;  2BB8 A;  2YTF A;  4DUY E;  2MDG A;  2PRT A;  4DV2 E;  2NUG A;  2D9H A;  4DV6 E;  2JYA A;  3MHH C;  3ADG A;  2DIX A;  2N3G A;  2EMB A;  2EJ4 A;  2ELZ A;  3KZY A;  2LUQ A;  2B7V A;  2JOX A;  5DNY A;  2HC5 A;  4MLV A;  1WRJ A;  4I8O A;  2EOR A;  2YTO A;  1O0W A;  5A2Q C;  3MHS C;  2EOM A;  2N3H A;  4ZYH A;  1RQ0 A;  2EOO A;  4BC9 A;  4BBY A;  2UUA E;  4FK5 C;  4WSP A;  3UK3 C;  2EN8 A;  1IMU A;  1PJT A;  2YTP A;  4F54 A;  2E5L E;  4M2Z A;  1EH8 A;  2EPL X;  3THO B;  2EMC A;  1WHN A;  2DLK A;  2EE8 A;  2VF1 A;  2V83 A;  3HPS A;  1A1J A;  2L3C A;  4WYQ B;  1A1H A;  4WFT A;  2WBU A;  1UBD C;  5T6J A;  1FJG E;  3J80 C;  2EOJ A;  3H09 A;  4WX9 A;  2DMY A;  1X6E A;  1N33 E;  3LML A;  1N34 E;  2V87 A;  2IHR 1;  2UUC E;  2EMI A;  1WJP A;  3OML A;  5A6K A;  1XNQ E;  5BR8 E;  1BBO A;  4B3T E;  2EN4 A;  2WZO A;  2YZT A;  2CSH A;  3IWB A;  4F9C B;  5KL3 A;  1ZBQ A;  1IQS A;  2BBG A;  2ENH A;  3AV0 A;  2EM4 A;  2M4I A;  1GTK A;  2DB2 A;  3IWC A;  2YU5 A;  1IBL E;  1IBK E;  1Z1B A;  2V89 A;  4DR5 E;  3OTO E;  1ZAA C;  2EOY A;  1J26 A;  5ADZ A;  4LF7 E;  5TSE A;  1ZR9 A;  4KZS A;  2YSP A;  2F8B A;  2YTQ A;  2RSI A;  4R03 A;  3J81 C;  4TUI A;  1PJQ A;  2EOF A;  2VQF E;  4Q35 B;  4JI8 E;  4K0K E;  1HNZ E;  2MC6 A;  1NEI A;  2LCE A;  2R76 A;  2EPO A;  4DR3 E;  3F6H A;  3THN A;  4P7D A;  2EM8 A;  2EN1 A;  2M7Q A;  5A6A A;  4B3M E;  2N8X A;  4BCA A;  1X6H A;  4X62 E;  2EMX A;  1YFH A;  3ADL A;  4GKJ E;  2E72 A;  4LTY A;  2Q8U A;  4DV3 E;  3P1X A;  4DMI A;  4F9A B;  1T4N A;  3HXL A;  4LF9 E;  2DRP A;  2UXD E;  4M9V C;  1A1I A;  2G7H A;  3VK6 A;  1EH6 A;  2JVA A;  3KWR A;  2RS7 A;  1JK2 A;  1L4S A;  1KYQ A;  4GZN C;  5IWA E;  4BHB A;  1RMD A;  2UU9 E;  2L33 A;  3TQM A;  4DV0 E;  4F6M A;  4NXM E;  2EPK X;  1YYK A;  2V88 A;  4JI2 E;  5KL4 A;  4X8W A;  2YTI A;  2UUB E;  1EKZ A;  2NUF A;  4NXN E;  1JK1 A;  4RHB B;  1X47 A;  2EPU A;  1LLM C;  2LVH A;  2I9I A;  3J7Y p;  2K7I A;  4O5G A;  5CFF E;  4OOG C;  4DKK A;  4BS9 A;  1PJS A;  2WCC 3;  3JAM C;  2KHX A;  1WXR A;  2EMK A;  1HNX E;  3T1H E;  1YYO A;  2EN6 A;  2L2N A;  2M1S A;  2EPN A;  3C4B A;  2JXP A;  1UIL A;  4AQY E;  1QNT A;  2M9A A;  2DMI A;  5AC5 A;  2LO3 A;  3BID A;  5A69 A;  4WSG A;  3IWD A;  2L6M A;  2JPA A;  1X5W A;  2DLQ A;  5IXM B;  2JOB A; 
#chains in the Genus database with same CATH homology
 3OTO E;  4X64 E;  4B3R E;  2RS6 A;  2V86 A;  4DV5 E;  1J26 A;  5ADZ A;  2FV4 B;  4B3S E;  4DR1 E;  4LF7 E;  2FGG A;  2LRS A;  2MC5 A;  4DV7 E;  1HNW E;  1N36 E;  4LF6 E;  4JI0 E;  4LF4 E;  4KZS A;  4GKK E;  2F8B A;  1DQ3 A;  1T4L B;  1ZBT A;  2B3T B;  2ODR C;  3FIG A;  1J5E E;  4DR4 E;  1XMQ E;  4M0V A;  4R03 A;  3ZOQ B;  4Q28 A;  5FLX C;  2DSY A;  4L5N C;  4L8N A;  3J81 C;  4WPY A;  4TUI A;  5IT9 C;  2ZM6 E;  2VQF E;  4JI8 E;  4LFC E;  4K0K E;  4KHP E;  1HNZ E;  4F9B B;  1DI2 A;  1XNR E;  3F6G A;  3DJW A;  4DUY E;  4DUZ E;  2MC6 A;  4JV5 E;  5LMU E;  2MDR A;  4DV2 E;  1STU A;  2NUG A;  2B9D A;  4DV6 E;  4DR3 E;  3F6H A;  1X49 A;  2HHH E;  4OX9 E;  1YZ9 A;  4P7D A;  3JTZ A;  3MSW A;  3ADG A;  2M7Q A;  4DR2 E;  4B3M E;  2DIX A;  4BCA A;  2N3G A;  3VYX A;  1IBM E;  4M30 A;  2UXB E;  1GZ6 A;  4X62 E;  4P78 A;  2LTR A;  3ADL A;  4GKJ E;  4LU9 A;  2LUQ A;  3ADI A;  4LTY A;  4DV4 E;  4DV3 E;  2B7V A;  2JOX A;  5DNY A;  2VE7 C;  5AE2 A;  4I8O A;  2RTX A;  2JWO A;  3P1X A;  4JI3 E;  4YY3 E;  1O0W A;  5A2Q C;  1QU6 A;  1HR0 E;  4DMI A;  3ADJ A;  4F9A B;  1T4N A;  3HXL A;  2CPN A;  2N3H A;  3T1Y E;  1WHQ A;  3K6Q A;  1RQ0 A;  4BC9 A;  2UUA E;  4BBY A;  2E1M A;  4LF9 E;  2UXD E;  4GEQ B;  4J8Z A;  1PKP A;  1I94 E;  2G7H A;  3LLH A;  4WSP A;  3VK6 A;  2LUP B;  1X48 A;  3KWR A;  2JVA A;  3HQ1 A;  2RS7 A;  1T4O A;  4BC7 A;  5LMN E;  2F4V E;  2KON A;  3JU0 A;  4F54 A;  3AUZ A;  2KOU A;  2E5L E;  5IWA E;  4M2Z A;  2UU9 E;  2ODR D;  5LL6 R;  2L33 A;  4DV0 E;  2LMZ A;  4YHH E;  4NXM E;  1WHN A;  3J7A G;  2V8Q B;  4TUG A;  5F3W A;  2V88 A;  2VF1 A;  5AE1 A;  4JI2 E;  5AE3 A;  2LBS B;  1YYK A;  2EZ6 A;  4X8W A;  4JI6 E;  2VQE E;  4X66 E;  4DR7 E;  2V83 A;  4LFA E;  4JI7 E;  1N32 E;  3HPS A;  2UUB E;  2YT4 A;  2L3C A;  4R8O A;  4WYQ B;  3C4T A;  4WFT A;  1EKZ A;  2NUF A;  4JI4 E;  4NXN E;  1X47 A;  2JY9 A;  4JI1 E;  4JI5 E;  4DR6 E;  4LF8 E;  5T6J A;  1FJG E;  2NA2 A;  3J80 C;  5AAS A;  3J7Y p;  3H09 A;  5CFF E;  4OOG C;  4LFB E;  4DKK A;  4BMJ A;  4BS9 A;  4DV1 E;  2FTX B;  2DMY A;  1N33 E;  3DF6 A;  4X65 E;  3LML A;  3JAM C;  1N34 E;  2V87 A;  3HPZ A;  1RC7 A;  2KHX A;  1WXR A;  2LJH A;  2IHR 1;  2RSM A;  1SR9 A;  2LE2 A;  2UUC E;  4LF5 E;  4JYA E;  2L2M A;  3OML A;  1FKA E;  1XNQ E;  2NUE A;  2EWL A;  5BR8 E;  3VYY A;  3T1H E;  1HNX E;  4B3T E;  2LTS A;  1UHZ A;  2WZO A;  1YYO A;  1XMO E;  2L2N A;  2YZT A;  2L92 A;  2UXC E;  3IWB A;  4F9C B;  2M1S A;  2L2K B;  1ZBQ A;  2JR1 A;  3C4B A;  1UIL A;  3AV0 A;  4AQY E;  3RMP A;  1YYW A;  2K4V A;  2M4I A;  2DB2 A;  1GQE A;  2L8T A;  2V85 A;  3IWC A;  1IBL E;  3IWD A;  2L6M A;  3HTX A;  2H36 X;  1IBK E;  2L3J A;  2V89 A;  2B7T A;  4DR5 E;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...