2MC5A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by -factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Protein binding
molecule keywords 45L
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc5A00
2MC6A 2MC5A
chains in the Genus database with same CATH superfamily
3QG5C 3ADLA 2EM5A 4JI5E 1RQ0A 2EN4A 1TN9A 1YYWA 4LF6E 4MLVA 4NHRA 5CFFE 5AC5A 1WXRA 3J80C 4R2PA 1PKPA 1TF6A 4ZYHA 2ENCA 4OOGC 4J8ZA 5A6BA 4X9JA 5LMNE 2EQ0A 1T4LB 4DUZE 2D9HA 2RPCA 3LLHA 3FIGA 1F2IG 4DV6E 1IBLE 1DGCA 1J26A 5A6KA 2EL6A 2FV4B 2LUPB 1UN6B 5IWAE 3P1XA 4DV7E 1XMQE 2UUAE 4R8OA 4X8WA 4IS1C 3K6QA 2ZM6E 2HHHE 5KL3A 2MC6A 1HNWE 2ODRC 3J7Yp 1AH5A 5KL7A 4LU9A 1L4SA 4LF9E 4M0VA 1WHNA 2RS7A 1XMOE 2YTIA 2EPAA 3AUZA 2EM6A 3KZYA 2KOUA 2I13A 4O5GA 1O0WA 1YFHA 2VE7C 4YY3E 2LTRA 4X65E 3OMLA 2VQFE 1UILA 1XNRE 1WHQA 4F9CB 4DMIA 3BGHA 4IJDA 3IWBA 3H09A 2EZ6A 4R2QA 2JYAA 2MDGA 2EPPA 1Z1BA 2BB8A 1EH6A 1GTKA 2EM9A 2L92A 2EL5A 5IT9C 2EMYA 4DV2E 2J7JA 1FJGE 4WXDA 3KZZA 1PJTA 4DV4E 2EOYA 5TSEA 3C6MA 2E72A 1EH7A 4X62E 2DIXA 2EOSA 4JI1E 1XNQE 4Q35B 2VRDA 3EPHA 2N3HA 4B3SE 2WBSA 4NXNE 2WBUA 1X3CA 3HQ1A 5BR8E 2F4VE 3T1YE 4JI7E 1IBME 4R2DA 2L3JA 5A2QC 2EPOA 4JI0E 2JXPA 4O43A 1KYQA 2EMKA 3BF2A 4LF4E 4OX9E 2NA2A 2ENAA 2CTDA 2LRSA 2I9IA 2JR1A 3JU0A 1I94E 2YTQA 3EPKA 2GLIA 3THNA 4F9BB 2EN8A 5FLXC 2LCEA 2EOFA 3ADGA 1PJQA 4DR7E 4B3RE 1FKAE 2MC5A 4BCAA 2YU8A 5AE3A 2M9AA 5IV8B 2EPKX 2B9DA 2GHFA 3HXLA 2EMWA 2EOMA 2L8TA 3OTOE 3HPZA 2EM7A 2UXBE 4X64E 2E5LE 4KWYA 1ZBTA 4BC7A 2V85A 4NZVA 3TQMA 5ADZA 4BMJA 3ZOQB 2EM0A 2M4IA 1YYOA 2NABA 2UUCE 3KWRA 2YTEA 3EPJA 5LLQA 4L8NA 2DMIA 2EOIA 4O24A 5AASA 1X5WA 4F6MA 2NUFA 2JVAA 2EPUA 2LJUA 4M9VC 1N32E 4DR5E 4WFTA 1ZR9A 4HEIA 2EOEA 2DGCA 1YUIA 2RSIA 2EOQA 2YSPA 2EMFA 1BBGA 2LUQA 2A25A 2YRHA 2ENHA 2IHR1 4R2CA 4AQYE 2RS6A 1HNZE 4LF7E 4JI6E 2EPMX 3MHHC 4JI4E 1N34E 4MLQA 2ELZA 4WYQB 4DV5E 4RHBB 2EMZA 4L5NC 4DR3E 4B3ME 1HNXE 1A1HA 2HC5A 2EJ4A 2YTDA 4P7DA 3EQ1A 1G2FC 4LFAE 1J5EE 1X6FA 2EL4A 3ADJA 3VYYA 3HTXA 1UHZA 2L2KB 1X6HA 4F9AB 2N8XA 2N3GA 1NCSA 2KONA 4FK5C 4ZYDA 3DJWA 3IWCA 2L2MA 1A1GA 2YRMA 4JI8E 1SFEA 4HTGA 1HR0E 2YU5A 2EM3A 2DB2A 4GKKE 2RQLA 2EMIA 4WSGA 2RTXA 4TUGA 4GEQB 1YUJA 4GZNC 2R76A 1DQ3A 4F54A 2V83A 1N3GA 2CSHA 2EM2A 2DLKA 2L33A 1EH8A 1IQSA 2L3CA 5KL5A 4JI2E 2LV2A 4BS9A 2YZTA 3HPSA 2L2NA 2M1SA 4P78A 2YTNA 1JK2A 1A1IA 4KZSA 3VHTB 2LBSB 5A6AA 2YTJA 5KL2A 2LVHA 2NUEA 2DSYA 2HJJA 2B3TB 2EWLA 2EQ1A 1T39A 1T4OA 2EN3A 2B7TA 2K7IA 2UU9E 4DV1E 2UUBE 2MKDA 2EPLX 2V87A 4ZYEA 3C4BA 2GPIA 2EN1A 4LTYA 1QU6A 5T6JA 5F3WA 4R03A 4X66E 3THOB 5AE2A 2EMLA 2E1MA 2WCC3 3DF6A 2UXDE 5KL6A 2DRPA 2CT1A 4WX9A 1N33E 1TF3A 1WJPA 4DV3E 1A1LA 3M99B 2EPRA 2LE2A 2NUGA 3RMPA 1X47A 1RMDA 2EN2A 4N4RB 5KL4A 3J81C 3BIDA 1MGTA 2R1FA 2YRKA 2YTGA 4DR4E 4KHPE 2B7VA 1N36E 4O4KA 2CPNA 4F2JC 1MEYC 2EOOA 2EPCA 4DR1E 3C6KA 1YSAC 5IXMB 4DV0E 1GZ6A 3JAMC 1WRJA 2M7QA 5A69A 1YZ9A 4ZYGA 1ZU1A 3L00A 2DLQA 4JI3E 2EMBA 1STUA 3J7AG 2EMAA 3LMLA 2ODRD 4BC9A 4R2SA 4Q28A 1YPNA 5AC4A 4RH8A 2WZOA 2YSOA 4DUYE 3ADIA 2MDRA 1NEIA 4R2AA 2EORA 3VK6A 1IQOA 3IWDA 3ECRA 4WSPA 2YTOA 3F6HA 1GQEA 2K4VA 4F6NA 2YWQA 1G2DC 2EPNA 1YYKA 3C4TA 1LLMC 2EN7A 2F8BA 2H36X 3UK3C 5A6BD 2L6MA 4WPYA 1B69A 2LO3A 2RSMA 2EMXA 1P47A 1EKZA 1QNTA 4BHBA 1PDAA 5LL6R 2JPAA 1DI2A 2LJHA 4NXME 2EOXA 4M30A 2MKNA 1PJSA 1IBKE 4LF5E 2FGGA 5LMUE 2EOJA 2YTFA 3VYXA 1ZAAC 4I8OA 4TUIA 4DR6E 1T4NA 3BBGA 1BB8A 3MHSC 3AV0A 2EMGA 2V86A 1SR9A 2JOBA 3F6GA 2WBTA 2JY9A 4LFCE 2BBGA 2EQ3A 2JP9A 2YPNA 4M2ZA 1ZBQA 1A1KA 4R2EA 5AE1A 2LTSA 1X49A 5DNYA 2KHXA 3JTZA 1KJKA 3MSWA 4DR2E 2FTXB 1A1FA 4GKJE 2EE8A 1RC7A 4LFBE 2VF1A 2EM8A 2HGHA 2ELYA 2YTPA 1AAYA 4YHHE 1BBOA 2EPZA 2LT7A 2EOZA 4JYAE 2PRTA 1IMUA 2ADRA 2EP3A 4B3TE 2V89A 2EM4A 4DKKA 2UXCE 1T38A 1A1JA 2EN6A 2VQEE 4K0KE 2EMCA 2Q8UA 4BBYA 1UBDC 5A6JA 1JK1A 4JV5E 4BHCA 2EOHA 2LMZA 4R2RA 3T1HE 2DMYA 2V88A 1X6EA 2EPXA 2YT4A 2JOXA 2V8QB 4LF8E 2EMHA 1X48A 2G7HA 4WXCA 2JWOA 3EPLA
chains in the Genus database with same CATH topology
2WZOA 3ADLA 4OX9E 4LF4E 4DUYE 2RTXA 2NA2A 3ADIA 2MDRA 1RQ0A 4JI5E 2LRSA 2JR1A 3JU0A 1I94E 3VK6A 4TUGA 4GEQB 1YYWA 4LF6E 5CFFE 3IWDA 1WXRA 3J80C 1PKPA 1DQ3A 4WSPA 2V83A 3F6HA 4F54A 1GQEA 2K4VA 4OOGC 4F9BB 5FLXC 4J8ZA 3ADGA 5LMNE 1YYKA 2L33A 4B3RE 4DR7E 3C4TA 1T4LB 4DUZE 2MC5A 4BCAA 2L3CA 1FKAE 5AE3A 4JI2E 2F8BA 2H36X 3LLHA 4BS9A 2YZTA 2L6MA 3FIGA 3HPSA 2L2NA 2M1SA 4P78A 4WPYA 4DV6E 2B9DA 3HXLA 1IBLE 2L8TA 2RSMA 3OTOE 1J26A 3HPZA 4KZSA 2UXBE 2FV4B 4X64E 2LUPB 1EKZA 2E5LE 5IWAE 2LBSB 3P1XA 4DV7E 1XMQE 5LL6R 2UUAE 4R8OA 2NUEA 1ZBTA 4BC7A 1DI2A 2DSYA 4X8WA 2V85A 2LJHA 5ADZA 3K6QA 2ZM6E 4NXME 4M30A 2B3TB 2EWLA 4BMJA 2HHHE 3ZOQB 1T4OA 1IBKE 4LF5E 2MC6A 1HNWE 2FGGA 2M4IA 2B7TA 2ODRC 5LMUE 1YYOA 3J7Yp 2UU9E 4DV1E 4LU9A 3KWRA 2UUCE 2UUBE 4LF9E 3VYXA 2V87A 4L8NA 4I8OA 5AASA 4TUIA 4DR6E 1T4NA 3C4BA 4M0VA 2NUFA 4LTYA 2JVAA 1QU6A 1N32E 1WHNA 2RS7A 4DR5E 1XMOE 4WFTA 3AV0A 3AUZA 2V86A 5T6JA 5F3WA 2KOUA 1SR9A 2JOBA 4R03A 4X66E 3F6GA 4LFCE 2JY9A 1O0WA 2LUQA 5AE2A 4M2ZA 2VE7C 4YY3E 2E1MA 1ZBQA 2LTRA 4X65E 3OMLA 2VQFE 1UILA 1XNRE 3DF6A 2LTSA 1X49A 1WHQA 4F9CB 5AE1A 4DMIA 5DNYA 2KHXA 2UXDE 3JTZA 2IHR1 3IWBA 2FTXB 3MSWA 3H09A 4DR2E 1N33E 4AQYE 2EZ6A 4GKJE 1RC7A 4LFBE 2VF1A 2RS6A 1HNZE 4DV3E 4LF7E 4JI6E 4YHHE 2L92A 2LE2A 2NUGA 3RMPA 1X47A 4JI4E 1N34E 4JYAE 3J81C 4WYQB 5IT9C 4DV5E 4DV2E 4L5NC 4DR3E 4B3TE 4DR4E 2V89A 4B3ME 1HNXE 1FJGE 4DKKA 4KHPE 2B7VA 2UXCE 1N36E 4DV4E 2VQEE 4P7DA 4K0KE 2CPNA 4BBYA 1J5EE 4X62E 4LFAE 2DIXA 4DR1E 4JV5E 4JI1E 2LMZA 4DV0E 1XNQE 3ADJA 1GZ6A 3JAMC 3VYYA 3HTXA 1UHZA 2M7QA 2L2KB 2N3HA 4F9AB 3T1HE 4B3SE 4NXNE 1YZ9A 2DMYA 2V88A 2N3GA 3HQ1A 5BR8E 2KONA 4JI3E 3T1YE 2F4VE 1STUA 4JI7E 2YT4A 1IBME 3DJWA 3IWCA 2L2MA 2JOXA 2V8QB 4JI8E 2L3JA 5A2QC 1HR0E 4LF8E 4JI0E 3J7AG 3LMLA 2ODRD 4BC9A 1X48A 2G7HA 2JWOA 2DB2A 4GKKE 4Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC6 A;  2MC5 A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  3ADL A;  2EM5 A;  4JI5 E;  1RQ0 A;  2EN4 A;  1TN9 A;  1YYW A;  4LF6 E;  4MLV A;  4NHR A;  5CFF E;  5AC5 A;  1WXR A;  3J80 C;  4R2P A;  1PKP A;  1TF6 A;  4ZYH A;  2ENC A;  4OOG C;  4J8Z A;  5A6B A;  4X9J A;  5LMN E;  2EQ0 A;  1T4L B;  4DUZ E;  2D9H A;  2RPC A;  3LLH A;  3FIG A;  1F2I G;  4DV6 E;  1IBL E;  1DGC A;  1J26 A;  5A6K A;  2EL6 A;  2FV4 B;  2LUP B;  1UN6 B;  5IWA E;  3P1X A;  4DV7 E;  1XMQ E;  2UUA E;  4R8O A;  4X8W A;  4IS1 C;  3K6Q A;  2ZM6 E;  2HHH E;  5KL3 A;  2MC6 A;  1HNW E;  2ODR C;  3J7Y p;  1AH5 A;  5KL7 A;  4LU9 A;  1L4S A;  4LF9 E;  4M0V A;  1WHN A;  2RS7 A;  1XMO E;  2YTI A;  2EPA A;  3AUZ A;  2EM6 A;  3KZY A;  2KOU A;  2I13 A;  4O5G A;  1O0W A;  1YFH A;  2VE7 C;  4YY3 E;  2LTR A;  4X65 E;  3OML A;  2VQF E;  1UIL A;  1XNR E;  1WHQ A;  4F9C B;  4DMI A;  3BGH A;  4IJD A;  3IWB A;  3H09 A;  2EZ6 A;  4R2Q A;  2JYA A;  2MDG A;  2EPP A;  1Z1B A;  2BB8 A;  1EH6 A;  1GTK A;  2EM9 A;  2L92 A;  2EL5 A;  5IT9 C;  2EMY A;  4DV2 E;  2J7J A;  1FJG E;  4WXD A;  3KZZ A;  1PJT A;  4DV4 E;  2EOY A;  5TSE A;  3C6M A;  2E72 A;  1EH7 A;  4X62 E;  2DIX A;  2EOS A;  4JI1 E;  1XNQ E;  4Q35 B;  2VRD A;  3EPH A;  2N3H A;  4B3S E;  2WBS A;  4NXN E;  2WBU A;  1X3C A;  3HQ1 A;  5BR8 E;  2F4V E;  3T1Y E;  4JI7 E;  1IBM E;  4R2D A;  2L3J A;  5A2Q C;  2EPO A;  4JI0 E;  2JXP A;  4O43 A;  1KYQ A;  2EMK A;  3BF2 A;  4LF4 E;  4OX9 E;  2NA2 A;  2ENA A;  2CTD A;  2LRS A;  2I9I A;  2JR1 A;  3JU0 A;  1I94 E;  2YTQ A;  3EPK A;  2GLI A;  3THN A;  4F9B B;  2EN8 A;  5FLX C;  2LCE A;  2EOF A;  3ADG A;  1PJQ A;  4DR7 E;  4B3R E;  1FKA E;  2MC5 A;  4BCA A;  2YU8 A;  5AE3 A;  2M9A A;  5IV8 B;  2EPK X;  2B9D A;  2GHF A;  3HXL A;  2EMW A;  2EOM A;  2L8T A;  3OTO E;  3HPZ A;  2EM7 A;  2UXB E;  4X64 E;  2E5L E;  4KWY A;  1ZBT A;  4BC7 A;  2V85 A;  4NZV A;  3TQM A;  5ADZ A;  4BMJ A;  3ZOQ B;  2EM0 A;  2M4I A;  1YYO A;  2NAB A;  2UUC E;  3KWR A;  2YTE A;  3EPJ A;  5LLQ A;  4L8N A;  2DMI A;  2EOI A;  4O24 A;  5AAS A;  1X5W A;  4F6M A;  2NUF A;  2JVA A;  2EPU A;  2LJU A;  4M9V C;  1N32 E;  4DR5 E;  4WFT A;  1ZR9 A;  4HEI A;  2EOE A;  2DGC A;  1YUI A;  2RSI A;  2EOQ A;  2YSP A;  2EMF A;  1BBG A;  2LUQ A;  2A25 A;  2YRH A;  2ENH A;  2IHR 1;  4R2C A;  4AQY E;  2RS6 A;  1HNZ E;  4LF7 E;  4JI6 E;  2EPM X;  3MHH C;  4JI4 E;  1N34 E;  4MLQ A;  2ELZ A;  4WYQ B;  4DV5 E;  4RHB B;  2EMZ A;  4L5N C;  4DR3 E;  4B3M E;  1HNX E;  1A1H A;  2HC5 A;  2EJ4 A;  2YTD A;  4P7D A;  3EQ1 A;  1G2F C;  4LFA E;  1J5E E;  1X6F A;  2EL4 A;  3ADJ A;  3VYY A;  3HTX A;  1UHZ A;  2L2K B;  1X6H A;  4F9A B;  2N8X A;  2N3G A;  1NCS A;  2KON A;  4FK5 C;  4ZYD A;  3DJW A;  3IWC A;  2L2M A;  1A1G A;  2YRM A;  4JI8 E;  1SFE A;  4HTG A;  1HR0 E;  2YU5 A;  2EM3 A;  2DB2 A;  4GKK E;  2RQL A;  2EMI A;  4WSG A;  2RTX A;  4TUG A;  4GEQ B;  1YUJ A;  4GZN C;  2R76 A;  1DQ3 A;  4F54 A;  2V83 A;  1N3G A;  2CSH A;  2EM2 A;  2DLK A;  2L33 A;  1EH8 A;  1IQS A;  2L3C A;  5KL5 A;  4JI2 E;  2LV2 A;  4BS9 A;  2YZT A;  3HPS A;  2L2N A;  2M1S A;  4P78 A;  2YTN A;  1JK2 A;  1A1I A;  4KZS A;  3VHT B;  2LBS B;  5A6A A;  2YTJ A;  5KL2 A;  2LVH A;  2NUE A;  2DSY A;  2HJJ A;  2B3T B;  2EWL A;  2EQ1 A;  1T39 A;  1T4O A;  2EN3 A;  2B7T A;  2K7I A;  2UU9 E;  4DV1 E;  2UUB E;  2MKD A;  2EPL X;  2V87 A;  4ZYE A;  3C4B A;  2GPI A;  2EN1 A;  4LTY A;  1QU6 A;  5T6J A;  5F3W A;  4R03 A;  4X66 E;  3THO B;  5AE2 A;  2EML A;  2E1M A;  2WCC 3;  3DF6 A;  2UXD E;  5KL6 A;  2DRP A;  2CT1 A;  4WX9 A;  1N33 E;  1TF3 A;  1WJP A;  4DV3 E;  1A1L A;  3M99 B;  2EPR A;  2LE2 A;  2NUG A;  3RMP A;  1X47 A;  1RMD A;  2EN2 A;  4N4R B;  5KL4 A;  3J81 C;  3BID A;  1MGT A;  2R1F A;  2YRK A;  2YTG A;  4DR4 E;  4KHP E;  2B7V A;  1N36 E;  4O4K A;  2CPN A;  4F2J C;  1MEY C;  2EOO A;  2EPC A;  4DR1 E;  3C6K A;  1YSA C;  5IXM B;  4DV0 E;  1GZ6 A;  3JAM C;  1WRJ A;  2M7Q A;  5A69 A;  1YZ9 A;  4ZYG A;  1ZU1 A;  3L00 A;  2DLQ A;  4JI3 E;  2EMB A;  1STU A;  3J7A G;  2EMA A;  3LML A;  2ODR D;  4BC9 A;  4R2S A;  4Q28 A;  1YPN A;  5AC4 A;  4RH8 A;  2WZO A;  2YSO A;  4DUY E;  3ADI A;  2MDR A;  1NEI A;  4R2A A;  2EOR A;  3VK6 A;  1IQO A;  3IWD A;  3ECR A;  4WSP A;  2YTO A;  3F6H A;  1GQE A;  2K4V A;  4F6N A;  2YWQ A;  1G2D C;  2EPN A;  1YYK A;  3C4T A;  1LLM C;  2EN7 A;  2F8B A;  2H36 X;  3UK3 C;  5A6B D;  2L6M A;  4WPY A;  1B69 A;  2LO3 A;  2RSM A;  2EMX A;  1P47 A;  1EKZ A;  1QNT A;  4BHB A;  1PDA A;  5LL6 R;  2JPA A;  1DI2 A;  2LJH A;  4NXM E;  2EOX A;  4M30 A;  2MKN A;  1PJS A;  1IBK E;  4LF5 E;  2FGG A;  5LMU E;  2EOJ A;  2YTF A;  3VYX A;  1ZAA C;  4I8O A;  4TUI A;  4DR6 E;  1T4N A;  3BBG A;  1BB8 A;  3MHS C;  3AV0 A;  2EMG A;  2V86 A;  1SR9 A;  2JOB A;  3F6G A;  2WBT A;  2JY9 A;  4LFC E;  2BBG A;  2EQ3 A;  2JP9 A;  2YPN A;  4M2Z A;  1ZBQ A;  1A1K A;  4R2E A;  5AE1 A;  2LTS A;  1X49 A;  5DNY A;  2KHX A;  3JTZ A;  1KJK A;  3MSW A;  4DR2 E;  2FTX B;  1A1F A;  4GKJ E;  2EE8 A;  1RC7 A;  4LFB E;  2VF1 A;  2EM8 A;  2HGH A;  2ELY A;  2YTP A;  1AAY A;  4YHH E;  1BBO A;  2EPZ A;  2LT7 A;  2EOZ A;  4JYA E;  2PRT A;  1IMU A;  2ADR A;  2EP3 A;  4B3T E;  2V89 A;  2EM4 A;  4DKK A;  2UXC E;  1T38 A;  1A1J A;  2EN6 A;  2VQE E;  4K0K E;  2EMC A;  2Q8U A;  4BBY A;  1UBD C;  5A6J A;  1JK1 A;  4JV5 E;  4BHC A;  2EOH A;  2LMZ A;  4R2R A;  3T1H E;  2DMY A;  2V88 A;  1X6E A;  2EPX A;  2YT4 A;  2JOX A;  2V8Q B;  4LF8 E;  2EMH A;  1X48 A;  2G7H A;  4WXC A;  2JWO A;  3EPL A; 
#chains in the Genus database with same CATH homology
 2WZO A;  3ADL A;  4OX9 E;  4LF4 E;  4DUY E;  2RTX A;  2NA2 A;  3ADI A;  2MDR A;  1RQ0 A;  4JI5 E;  2LRS A;  2JR1 A;  3JU0 A;  1I94 E;  3VK6 A;  4TUG A;  4GEQ B;  1YYW A;  4LF6 E;  5CFF E;  3IWD A;  1WXR A;  3J80 C;  1PKP A;  1DQ3 A;  4WSP A;  2V83 A;  3F6H A;  4F54 A;  1GQE A;  2K4V A;  4OOG C;  4F9B B;  5FLX C;  4J8Z A;  3ADG A;  5LMN E;  1YYK A;  2L33 A;  4B3R E;  4DR7 E;  3C4T A;  1T4L B;  4DUZ E;  2MC5 A;  4BCA A;  2L3C A;  1FKA E;  5AE3 A;  4JI2 E;  2F8B A;  2H36 X;  3LLH A;  4BS9 A;  2YZT A;  2L6M A;  3FIG A;  3HPS A;  2L2N A;  2M1S A;  4P78 A;  4WPY A;  4DV6 E;  2B9D A;  3HXL A;  1IBL E;  2L8T A;  2RSM A;  3OTO E;  1J26 A;  3HPZ A;  4KZS A;  2UXB E;  2FV4 B;  4X64 E;  2LUP B;  1EKZ A;  2E5L E;  5IWA E;  2LBS B;  3P1X A;  4DV7 E;  1XMQ E;  5LL6 R;  2UUA E;  4R8O A;  2NUE A;  1ZBT A;  4BC7 A;  1DI2 A;  2DSY A;  4X8W A;  2V85 A;  2LJH A;  5ADZ A;  3K6Q A;  2ZM6 E;  4NXM E;  4M30 A;  2B3T B;  2EWL A;  4BMJ A;  2HHH E;  3ZOQ B;  1T4O A;  1IBK E;  4LF5 E;  2MC6 A;  1HNW E;  2FGG A;  2M4I A;  2B7T A;  2ODR C;  5LMU E;  1YYO A;  3J7Y p;  2UU9 E;  4DV1 E;  4LU9 A;  3KWR A;  2UUC E;  2UUB E;  4LF9 E;  3VYX A;  2V87 A;  4L8N A;  4I8O A;  5AAS A;  4TUI A;  4DR6 E;  1T4N A;  3C4B A;  4M0V A;  2NUF A;  4LTY A;  2JVA A;  1QU6 A;  1N32 E;  1WHN A;  2RS7 A;  4DR5 E;  1XMO E;  4WFT A;  3AV0 A;  3AUZ A;  2V86 A;  5T6J A;  5F3W A;  2KOU A;  1SR9 A;  2JOB A;  4R03 A;  4X66 E;  3F6G A;  4LFC E;  2JY9 A;  1O0W A;  2LUQ A;  5AE2 A;  4M2Z A;  2VE7 C;  4YY3 E;  2E1M A;  1ZBQ A;  2LTR A;  4X65 E;  3OML A;  2VQF E;  1UIL A;  1XNR E;  3DF6 A;  2LTS A;  1X49 A;  1WHQ A;  4F9C B;  5AE1 A;  4DMI A;  5DNY A;  2KHX A;  2UXD E;  3JTZ A;  2IHR 1;  3IWB A;  2FTX B;  3MSW A;  3H09 A;  4DR2 E;  1N33 E;  4AQY E;  2EZ6 A;  4GKJ E;  1RC7 A;  4LFB E;  2VF1 A;  2RS6 A;  1HNZ E;  4DV3 E;  4LF7 E;  4JI6 E;  4YHH E;  2L92 A;  2LE2 A;  2NUG A;  3RMP A;  1X47 A;  4JI4 E;  1N34 E;  4JYA E;  3J81 C;  4WYQ B;  5IT9 C;  4DV5 E;  4DV2 E;  4L5N C;  4DR3 E;  4B3T E;  4DR4 E;  2V89 A;  4B3M E;  1HNX E;  1FJG E;  4DKK A;  4KHP E;  2B7V A;  2UXC E;  1N36 E;  4DV4 E;  2VQE E;  4P7D A;  4K0K E;  2CPN A;  4BBY A;  1J5E E;  4X62 E;  4LFA E;  2DIX A;  4DR1 E;  4JV5 E;  4JI1 E;  2LMZ A;  4DV0 E;  1XNQ E;  3ADJ A;  1GZ6 A;  3JAM C;  3VYY A;  3HTX A;  1UHZ A;  2M7Q A;  2L2K B;  2N3H A;  4F9A B;  3T1H E;  4B3S E;  4NXN E;  1YZ9 A;  2DMY A;  2V88 A;  2N3G A;  3HQ1 A;  5BR8 E;  2KON A;  4JI3 E;  3T1Y E;  2F4V E;  1STU A;  4JI7 E;  2YT4 A;  1IBM E;  3DJW A;  3IWC A;  2L2M A;  2JOX A;  2V8Q B;  4JI8 E;  2L3J A;  5A2Q C;  1HR0 E;  4LF8 E;  4JI0 E;  3J7A G;  3LML A;  2ODR D;  4BC9 A;  1X48 A;  2G7H A;  2JWO A;  2DB2 A;  4GKK E;  4Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...