2MC5A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by -factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 45L
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Protein binding
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc5A00
2MC5A 2MC6A
chains in the Genus database with same CATH superfamily
4BBYA 1A1IA 2DGCA 2NABA 4O5GA 4DV4E 4GKKE 2EN2A 4KZSA 4R2QA 2D9HA 3BF2A 2EL6A 3VYYA 4X66E 1L4SA 3DJWA 2EORA 5AE2A 1ZR9A 4OOGC 1TN9A 1Z1BA 2E1MA 2EPUA 5KL3A 3TQMA 2PRTA 1XNQE 5IT9C 1J5EE 1N36E 2EQ1A 4X8WA 1ZU1A 4DKKA 4BCAA 4TUGA 2WBUA 2EOMA 2R76A 1IBME 2EN1A 1GTKA 4Q28A 2BBGA 1GZ6A 3C6KA 1DI2A 2L33A 1A1KA 4JI3E 1TF6A 3VYXA 2K4VA 1PJQA 1GQEA 2V86A 2ODRC 4DV6E 5A2QC 1IBKE 2F8BA 2EM5A 4JI0E 2LUPB 2JY9A 1LLMC 3C4TA 3F6HA 3OMLA 2RPCA 5A6BA 1EKZA 5A69A 2B9DA 2YWQA 4F2JC 2LBSB 1BBOA 1A1FA 2EE8A 2EMIA 2V8QB 5LL6R 5AE3A 2CTDA 2EN8A 2EQ0A 4L5NC 2RS7A 3ADJA 4DV2E 2EMKA 5T6JA 2V85A 2YTNA 2EPKX 2EPAA 3EQ1A 4LF8E 2M4IA 1HNZE 2NUFA 4DR4E 1BBGA 1JK2A 5AC4A 2YT4A 4WSGA 4WFTA 2EMXA 3ZOQB 2M9AA 2LUQA 4BS9A 2YU5A 2YZTA 4P7DA 4F6NA 2HGHA 1T38A 2Q8UA 1AH5A 3IWBA 2YTEA 2WCC3 2WBSA 4JI7E 2EM9A 2NUGA 4X65E 2UUCE 3ADLA 4DV0E 1N34E 1YPNA 2EOFA 3J81C 2FV4B 5KL6A 2EMWA 2LMZA 4M2ZA 4LFCE 2EMBA 2EN3A 1PDAA 4R2SA 2EJ4A 1YUJA 2DMIA 4WXDA 1X5WA 3C4BA 4O43A 3HPSA 1T4LB 1X3CA 1NCSA 1UBDC 4R2CA 4IS1C 4DUYE 1JK1A 5AE1A 4K0KE 1BB8A 4DR7E 2RS6A 2HHHE 4B3SE 2EOEA 2L92A 2LJUA 2EMHA 1J26A 4ZYDA 1A1LA 1N32E 3HPZA 4HTGA 2LCEA 4WYQB 1FJGE 1HR0E 3IWDA 2EQ3A 2EMZA 1N33E 4RHBB 1YFHA 3UK3C 2WZOA 3QG5C 5AC5A 4NHRA 4R2DA 2MDGA 4DR5E 2JPAA 1T4OA 2DLKA 2HJJA 2ENCA 5ADZA 4LTYA 2YTJA 1EH7A 3DF6A 3KWRA 2JXPA 2MKNA 2EOIA 2EL5A 2L2MA 1STUA 4ZYHA 2ODRD 2VQEE 4NXME 1DGCA 1O0WA 5FLXC 3MHHC 4F54A 2EM8A 4LU9A 1RMDA 2YTGA 2JVAA 3FIGA 4JI4E 2F4VE 2EMCA 2LE2A 4Q35B 1UHZA 3VHTB 3LLHA 1ZAAC 1IQSA 2EOJA 1X49A 5BR8E 2YTDA 1YYOA 2ADRA 4LF9E 2UUAE 4RH8A 4NXNE 2DSYA 2CSHA 2EMYA 4ZYEA 1YYKA 2YTFA 2ZM6E 2EPRA 2RSIA 5IWAE 4DMIA 3EPLA 3IWCA 3EPHA 4GZNC 2UU9E 4O24A 2L2NA 2GLIA 4N4RB 4YHHE 2IHR1 1XMOE 1N3GA 1WHQA 2JWOA 2EN6A 5CFFE 4I8OA 2A25A 2WBTA 4LF6E 2EN7A 4F9AB 4JI1E 2VQFE 3JTZA 3ECRA 3EPKA 4DV7E 3T1YE 4BC7A 5LLQA 2DB2A 4P78A 3LMLA 1A1HA 4M9VC 4R8OA 2EMLA 1MGTA 1X6EA 2CPNA 1YZ9A 1PJTA 2N8XA 1WHNA 2UUBE 3AUZA 5TSEA 2V89A 1IBLE 2ENHA 3EPJA 1XNRE 1WRJA 3C6MA 3HQ1A 4MLVA 3BBGA 2V87A 4F9BB 1PKPA 2YRKA 2M7QA 3JU0A 3K6QA 2EOXA 2LO3A 5KL7A 2E5LE 1KJKA 2BB8A 4DR2E 2RQLA 2KHXA 4LF5E 2EM4A 2EPMX 3BIDA 2EPOA 4R2AA 2EM6A 4DUZE 2MC5A 1B69A 2EPLX 2EPNA 4BMJA 2EOOA 1WJPA 2B3TB 4R2EA 4KWYA 1IMUA 2LTSA 2EPCA 2B7TA 4M30A 3J7Yp 2N3GA 1TF3A 4LFAE 1I94E 4TUIA 4GKJE 2YPNA 1T39A 1QNTA 2EMFA 4ZYGA 2DLQA 2GPIA 4AQYE 1ZBQA 3ADIA 1X6FA 4DR3E 4F6MA 5AASA 1ZBTA 2ENAA 4WX9A 1YYWA 3L00A 2N3HA 3JAMC 1AAYA 2DMYA 4R2RA 2ELZA 2VE7C 1MEYC 4YY3E 4OX9E 2V83A 4FK5C 4R03A 2EM7A 2VRDA 2VF1A 2LV2A 5A6AA 5A6KA 2V88A 5A6JA 1UN6B 1T4NA 2YTQA 2EPPA 4DV1E 2NA2A 1UILA 2EM2A 2EM0A 2EP3A 4BC9A 2UXBE 1RQ0A 1SFEA 2FGGA 1WXRA 5KL5A 3OTOE 1HNXE 2JP9A 4LF4E 2ELYA 2EOYA 2LJHA 3THNA 1SR9A 2MDRA 1G2DC 3MHSC 1DQ3A 2EPXA 4GEQB 1PJSA 4X9JA 3RMPA 2KOUA 2JOBA 3VK6A 1X6HA 4DV5E 2GHFA 3ADGA 2EN4A 3AV0A 4KHPE 2DIXA 3M99B 2EOZA 4JI2E 2NUEA 3J80C 3KZZA 4JI5E 2G7HA 2DRPA 2YRHA 2B7VA 2KONA 2EPZA 4NZVA 3HTXA 4HEIA 2LRSA 5KL4A 3P1XA 2YSPA 4B3ME 4WXCA 1NEIA 4DR6E 4B3RE 4L8NA 1KYQA 2EMAA 2E72A 2EOSA 2L2KB 2EZ6A 2JOXA 2LTRA 4F9CB 1X47A 1F2IG 3H09A 4JYAE 2YSOA 5F3WA 1HNWE 2EOQA 1X48A 2RTXA 4MLQA 2L3JA 2YU8A 3KZYA 1FKAE 3HXLA 2MC6A 4WSPA 2J7JA 2RSMA 5DNYA 3J7AG 3THOB 1G2FC 1EH6A 5LMNE 2L3CA 1RC7A 2EM3A 4O4KA 2L8TA 1P47A 1IQOA 2YTIA 2UXCE 5IV8B 2LVHA 2R1FA 1QU6A 4M0VA 3MSWA 5A6BD 1YSAC 4WPYA 2I13A 2EMGA 1XMQE 2HC5A 4J8ZA 1YUIA 2YTPA 2JYAA 3BGHA 2EOHA 4B3TE 2MKDA 4X62E 2H36X 4BHBA 2K7IA 5LMUE 1A1JA 2JR1A 4JI6E 2FTXB 2EL4A 4X64E 4JI8E 5KL2A 4BHCA 4LF7E 4DR1E 2I9IA 4R2PA 1EH8A 3T1HE 2EWLA 4LFBE 2LT7A 4JV5E 2L6MA 2CT1A 2UXDE 4DV3E 2YRMA 2M1SA 3F6GA 2YTOA 1A1GA 5IXMB 4IJDA
chains in the Genus database with same CATH topology
1SR9A 4BBYA 3ADLA 2MDRA 2CPNA 4DV4E 1DQ3A 1YZ9A 4GKKE 4GEQB 3RMPA 1T4LB 3C4BA 3HPSA 2KOUA 4KZSA 2JOBA 1WHNA 3VK6A 4DV5E 4DUYE 4K0KE 5AE1A 2UUBE 4DR7E 3VYYA 3ADGA 3AUZA 2RS6A 4X66E 2HHHE 2V89A 1IBLE 4B3SE 2L92A 3DJWA 1J26A 1XNRE 3AV0A 5AE2A 4KHPE 2DIXA 4OOGC 4JI2E 1N32E 2NUEA 3HPZA 2E1MA 3J80C 4WYQB 4JI5E 2G7HA 1FJGE 1HR0E 4JI1E 3HQ1A 3IWDA 1XNQE 2V87A 5IT9C 4F9BB 2B7VA 1N36E 4X8WA 1PKPA 1J5EE 2M7QA 2KONA 2UUCE 4LF4E 1N33E 3JU0A 3K6QA 2WZOA 3HTXA 4DKKA 4BCAA 4TUGA 1IBME 2LRSA 2E5LE 3P1XA 4Q28A 4DR5E 4B3ME 1GZ6A 1T4OA 4M2ZA 4DR2E 5ADZA 1DI2A 2KHXA 2L33A 4LF5E 4DR6E 4LTYA 4JI3E 4B3RE 4L8NA 3DF6A 3KWRA 2L2KB 2EZ6A 2JOXA 4DUZE 2L2MA 2LTRA 1X47A 1STUA 2K4VA 2MC5A 3H09A 4F9CB 3VYXA 5F3WA 4JYAE 1GQEA 1HNWE 2ODRD 2V86A 1X48A 2ODRC 2VQEE 4NXME 2RTXA 4DV6E 5A2QC 2L3JA 4BMJA 1O0WA 1IBKE 2F8BA 5FLXC 2B3TB 4F54A 1FKAE 4JI0E 2LUPB 2JY9A 1N34E 4LU9A 3HXLA 3C4TA 2MC6A 4WSPA 3F6HA 2LTSA 3OMLA 2RSMA 2JVAA 3FIGA 2B7TA 5DNYA 4JI4E 4M30A 2F4VE 2LE2A 1EKZA 3J7AG 2B9DA 3J7Yp 2N3GA 1UHZA 5LMNE 2L3CA 2LBSB 1RC7A 3LLHA 4LFAE 5BR8E 1X49A 1I94E 4TUIA 2V8QB 1YYOA 4GKJE 2L8TA 5LL6R 4LF9E 5AE3A 2UXCE 2UUAE 4L5NC 4M0VA 1QU6A 2DSYA 3MSWA 4NXNE 4WPYA 4AQYE 1ZBQA 2RS7A 4J8ZA 3ADJA 1XMQE 4DV2E 1YYKA 5T6JA 3ADIA 2ZM6E 2V85A 4DR3E 5AASA 4B3TE 1ZBTA 4X62E 2H36X 1YYWA 4LF8E 2M4IA 1HNZE 2NUFA 4DR4E 2N3HA 3JAMC 5LMUE 2DMYA 5IWAE 4DMIA 3IWCA 4JI6E 2VE7C 2FTXB 2YT4A 2UU9E 4X64E 2L2NA 4JI8E 4YY3E 4LF7E 4DR1E 2V83A 4WFTA 3ZOQB 4OX9E 2LUQA 4R03A 4P7DA 2YZTA 2VF1A 4BS9A 4YHHE 2V88A 1T4NA 2IHR1 1XMOE 4DV1E 3T1HE 1WHQA 2NA2A 1UILA 2JWOA 2EWLA 3IWBA 5CFFE 4LFBE 4I8OA 4JV5E 2L6MA 4JI7E 4BC9A 2NUGA 4LF6E 2UXDE 4DV3E 2UXBE 4X65E 1RQ0A 2FGGA 2M1SA 4F9AB 1WXRA 3F6GA 3OTOE 3J81C 4DV0E 2FV4B 3JTZA 2VQFE 4DV7E 3T1YE 1HNXE 4BC7A 2LMZA 2DB2A 4P78A 3LMLA 2JR1A 2LJHA 4R8OA 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC5 A;  2MC6 A; 
#chains in the Genus database with same CATH topology
 4BBY A;  1A1I A;  2DGC A;  2NAB A;  4O5G A;  4DV4 E;  4GKK E;  2EN2 A;  4KZS A;  4R2Q A;  2D9H A;  3BF2 A;  2EL6 A;  3VYY A;  4X66 E;  1L4S A;  3DJW A;  2EOR A;  5AE2 A;  1ZR9 A;  4OOG C;  1TN9 A;  1Z1B A;  2E1M A;  2EPU A;  5KL3 A;  3TQM A;  2PRT A;  1XNQ E;  5IT9 C;  1J5E E;  1N36 E;  2EQ1 A;  4X8W A;  1ZU1 A;  4DKK A;  4BCA A;  4TUG A;  2WBU A;  2EOM A;  2R76 A;  1IBM E;  2EN1 A;  1GTK A;  4Q28 A;  2BBG A;  1GZ6 A;  3C6K A;  1DI2 A;  2L33 A;  1A1K A;  4JI3 E;  1TF6 A;  3VYX A;  2K4V A;  1PJQ A;  1GQE A;  2V86 A;  2ODR C;  4DV6 E;  5A2Q C;  1IBK E;  2F8B A;  2EM5 A;  4JI0 E;  2LUP B;  2JY9 A;  1LLM C;  3C4T A;  3F6H A;  3OML A;  2RPC A;  5A6B A;  1EKZ A;  5A69 A;  2B9D A;  2YWQ A;  4F2J C;  2LBS B;  1BBO A;  1A1F A;  2EE8 A;  2EMI A;  2V8Q B;  5LL6 R;  5AE3 A;  2CTD A;  2EN8 A;  2EQ0 A;  4L5N C;  2RS7 A;  3ADJ A;  4DV2 E;  2EMK A;  5T6J A;  2V85 A;  2YTN A;  2EPK X;  2EPA A;  3EQ1 A;  4LF8 E;  2M4I A;  1HNZ E;  2NUF A;  4DR4 E;  1BBG A;  1JK2 A;  5AC4 A;  2YT4 A;  4WSG A;  4WFT A;  2EMX A;  3ZOQ B;  2M9A A;  2LUQ A;  4BS9 A;  2YU5 A;  2YZT A;  4P7D A;  4F6N A;  2HGH A;  1T38 A;  2Q8U A;  1AH5 A;  3IWB A;  2YTE A;  2WCC 3;  2WBS A;  4JI7 E;  2EM9 A;  2NUG A;  4X65 E;  2UUC E;  3ADL A;  4DV0 E;  1N34 E;  1YPN A;  2EOF A;  3J81 C;  2FV4 B;  5KL6 A;  2EMW A;  2LMZ A;  4M2Z A;  4LFC E;  2EMB A;  2EN3 A;  1PDA A;  4R2S A;  2EJ4 A;  1YUJ A;  2DMI A;  4WXD A;  1X5W A;  3C4B A;  4O43 A;  3HPS A;  1T4L B;  1X3C A;  1NCS A;  1UBD C;  4R2C A;  4IS1 C;  4DUY E;  1JK1 A;  5AE1 A;  4K0K E;  1BB8 A;  4DR7 E;  2RS6 A;  2HHH E;  4B3S E;  2EOE A;  2L92 A;  2LJU A;  2EMH A;  1J26 A;  4ZYD A;  1A1L A;  1N32 E;  3HPZ A;  4HTG A;  2LCE A;  4WYQ B;  1FJG E;  1HR0 E;  3IWD A;  2EQ3 A;  2EMZ A;  1N33 E;  4RHB B;  1YFH A;  3UK3 C;  2WZO A;  3QG5 C;  5AC5 A;  4NHR A;  4R2D A;  2MDG A;  4DR5 E;  2JPA A;  1T4O A;  2DLK A;  2HJJ A;  2ENC A;  5ADZ A;  4LTY A;  2YTJ A;  1EH7 A;  3DF6 A;  3KWR A;  2JXP A;  2MKN A;  2EOI A;  2EL5 A;  2L2M A;  1STU A;  4ZYH A;  2ODR D;  2VQE E;  4NXM E;  1DGC A;  1O0W A;  5FLX C;  3MHH C;  4F54 A;  2EM8 A;  4LU9 A;  1RMD A;  2YTG A;  2JVA A;  3FIG A;  4JI4 E;  2F4V E;  2EMC A;  2LE2 A;  4Q35 B;  1UHZ A;  3VHT B;  3LLH A;  1ZAA C;  1IQS A;  2EOJ A;  1X49 A;  5BR8 E;  2YTD A;  1YYO A;  2ADR A;  4LF9 E;  2UUA E;  4RH8 A;  4NXN E;  2DSY A;  2CSH A;  2EMY A;  4ZYE A;  1YYK A;  2YTF A;  2ZM6 E;  2EPR A;  2RSI A;  5IWA E;  4DMI A;  3EPL A;  3IWC A;  3EPH A;  4GZN C;  2UU9 E;  4O24 A;  2L2N A;  2GLI A;  4N4R B;  4YHH E;  2IHR 1;  1XMO E;  1N3G A;  1WHQ A;  2JWO A;  2EN6 A;  5CFF E;  4I8O A;  2A25 A;  2WBT A;  4LF6 E;  2EN7 A;  4F9A B;  4JI1 E;  2VQF E;  3JTZ A;  3ECR A;  3EPK A;  4DV7 E;  3T1Y E;  4BC7 A;  5LLQ A;  2DB2 A;  4P78 A;  3LML A;  1A1H A;  4M9V C;  4R8O A;  2EML A;  1MGT A;  1X6E A;  2CPN A;  1YZ9 A;  1PJT A;  2N8X A;  1WHN A;  2UUB E;  3AUZ A;  5TSE A;  2V89 A;  1IBL E;  2ENH A;  3EPJ A;  1XNR E;  1WRJ A;  3C6M A;  3HQ1 A;  4MLV A;  3BBG A;  2V87 A;  4F9B B;  1PKP A;  2YRK A;  2M7Q A;  3JU0 A;  3K6Q A;  2EOX A;  2LO3 A;  5KL7 A;  2E5L E;  1KJK A;  2BB8 A;  4DR2 E;  2RQL A;  2KHX A;  4LF5 E;  2EM4 A;  2EPM X;  3BID A;  2EPO A;  4R2A A;  2EM6 A;  4DUZ E;  2MC5 A;  1B69 A;  2EPL X;  2EPN A;  4BMJ A;  2EOO A;  1WJP A;  2B3T B;  4R2E A;  4KWY A;  1IMU A;  2LTS A;  2EPC A;  2B7T A;  4M30 A;  3J7Y p;  2N3G A;  1TF3 A;  4LFA E;  1I94 E;  4TUI A;  4GKJ E;  2YPN A;  1T39 A;  1QNT A;  2EMF A;  4ZYG A;  2DLQ A;  2GPI A;  4AQY E;  1ZBQ A;  3ADI A;  1X6F A;  4DR3 E;  4F6M A;  5AAS A;  1ZBT A;  2ENA A;  4WX9 A;  1YYW A;  3L00 A;  2N3H A;  3JAM C;  1AAY A;  2DMY A;  4R2R A;  2ELZ A;  2VE7 C;  1MEY C;  4YY3 E;  4OX9 E;  2V83 A;  4FK5 C;  4R03 A;  2EM7 A;  2VRD A;  2VF1 A;  2LV2 A;  5A6A A;  5A6K A;  2V88 A;  5A6J A;  1UN6 B;  1T4N A;  2YTQ A;  2EPP A;  4DV1 E;  2NA2 A;  1UIL A;  2EM2 A;  2EM0 A;  2EP3 A;  4BC9 A;  2UXB E;  1RQ0 A;  1SFE A;  2FGG A;  1WXR A;  5KL5 A;  3OTO E;  1HNX E;  2JP9 A;  4LF4 E;  2ELY A;  2EOY A;  2LJH A;  3THN A;  1SR9 A;  2MDR A;  1G2D C;  3MHS C;  1DQ3 A;  2EPX A;  4GEQ B;  1PJS A;  4X9J A;  3RMP A;  2KOU A;  2JOB A;  3VK6 A;  1X6H A;  4DV5 E;  2GHF A;  3ADG A;  2EN4 A;  3AV0 A;  4KHP E;  2DIX A;  3M99 B;  2EOZ A;  4JI2 E;  2NUE A;  3J80 C;  3KZZ A;  4JI5 E;  2G7H A;  2DRP A;  2YRH A;  2B7V A;  2KON A;  2EPZ A;  4NZV A;  3HTX A;  4HEI A;  2LRS A;  5KL4 A;  3P1X A;  2YSP A;  4B3M E;  4WXC A;  1NEI A;  4DR6 E;  4B3R E;  4L8N A;  1KYQ A;  2EMA A;  2E72 A;  2EOS A;  2L2K B;  2EZ6 A;  2JOX A;  2LTR A;  4F9C B;  1X47 A;  1F2I G;  3H09 A;  4JYA E;  2YSO A;  5F3W A;  1HNW E;  2EOQ A;  1X48 A;  2RTX A;  4MLQ A;  2L3J A;  2YU8 A;  3KZY A;  1FKA E;  3HXL A;  2MC6 A;  4WSP A;  2J7J A;  2RSM A;  5DNY A;  3J7A G;  3THO B;  1G2F C;  1EH6 A;  5LMN E;  2L3C A;  1RC7 A;  2EM3 A;  4O4K A;  2L8T A;  1P47 A;  1IQO A;  2YTI A;  2UXC E;  5IV8 B;  2LVH A;  2R1F A;  1QU6 A;  4M0V A;  3MSW A;  5A6B D;  1YSA C;  4WPY A;  2I13 A;  2EMG A;  1XMQ E;  2HC5 A;  4J8Z A;  1YUI A;  2YTP A;  2JYA A;  3BGH A;  2EOH A;  4B3T E;  2MKD A;  4X62 E;  2H36 X;  4BHB A;  2K7I A;  5LMU E;  1A1J A;  2JR1 A;  4JI6 E;  2FTX B;  2EL4 A;  4X64 E;  4JI8 E;  5KL2 A;  4BHC A;  4LF7 E;  4DR1 E;  2I9I A;  4R2P A;  1EH8 A;  3T1H E;  2EWL A;  4LFB E;  2LT7 A;  4JV5 E;  2L6M A;  2CT1 A;  2UXD E;  4DV3 E;  2YRM A;  2M1S A;  3F6G A;  2YTO A;  1A1G A;  5IXM B;  4IJD A; 
#chains in the Genus database with same CATH homology
 1SR9 A;  4BBY A;  3ADL A;  2MDR A;  2CPN A;  4DV4 E;  1DQ3 A;  1YZ9 A;  4GKK E;  4GEQ B;  3RMP A;  1T4L B;  3C4B A;  3HPS A;  2KOU A;  4KZS A;  2JOB A;  1WHN A;  3VK6 A;  4DV5 E;  4DUY E;  4K0K E;  5AE1 A;  2UUB E;  4DR7 E;  3VYY A;  3ADG A;  3AUZ A;  2RS6 A;  4X66 E;  2HHH E;  2V89 A;  1IBL E;  4B3S E;  2L92 A;  3DJW A;  1J26 A;  1XNR E;  3AV0 A;  5AE2 A;  4KHP E;  2DIX A;  4OOG C;  4JI2 E;  1N32 E;  2NUE A;  3HPZ A;  2E1M A;  3J80 C;  4WYQ B;  4JI5 E;  2G7H A;  1FJG E;  1HR0 E;  4JI1 E;  3HQ1 A;  3IWD A;  1XNQ E;  2V87 A;  5IT9 C;  4F9B B;  2B7V A;  1N36 E;  4X8W A;  1PKP A;  1J5E E;  2M7Q A;  2KON A;  2UUC E;  4LF4 E;  1N33 E;  3JU0 A;  3K6Q A;  2WZO A;  3HTX A;  4DKK A;  4BCA A;  4TUG A;  1IBM E;  2LRS A;  2E5L E;  3P1X A;  4Q28 A;  4DR5 E;  4B3M E;  1GZ6 A;  1T4O A;  4M2Z A;  4DR2 E;  5ADZ A;  1DI2 A;  2KHX A;  2L33 A;  4LF5 E;  4DR6 E;  4LTY A;  4JI3 E;  4B3R E;  4L8N A;  3DF6 A;  3KWR A;  2L2K B;  2EZ6 A;  2JOX A;  4DUZ E;  2L2M A;  2LTR A;  1X47 A;  1STU A;  2K4V A;  2MC5 A;  3H09 A;  4F9C B;  3VYX A;  5F3W A;  4JYA E;  1GQE A;  1HNW E;  2ODR D;  2V86 A;  1X48 A;  2ODR C;  2VQE E;  4NXM E;  2RTX A;  4DV6 E;  5A2Q C;  2L3J A;  4BMJ A;  1O0W A;  1IBK E;  2F8B A;  5FLX C;  2B3T B;  4F54 A;  1FKA E;  4JI0 E;  2LUP B;  2JY9 A;  1N34 E;  4LU9 A;  3HXL A;  3C4T A;  2MC6 A;  4WSP A;  3F6H A;  2LTS A;  3OML A;  2RSM A;  2JVA A;  3FIG A;  2B7T A;  5DNY A;  4JI4 E;  4M30 A;  2F4V E;  2LE2 A;  1EKZ A;  3J7A G;  2B9D A;  3J7Y p;  2N3G A;  1UHZ A;  5LMN E;  2L3C A;  2LBS B;  1RC7 A;  3LLH A;  4LFA E;  5BR8 E;  1X49 A;  1I94 E;  4TUI A;  2V8Q B;  1YYO A;  4GKJ E;  2L8T A;  5LL6 R;  4LF9 E;  5AE3 A;  2UXC E;  2UUA E;  4L5N C;  4M0V A;  1QU6 A;  2DSY A;  3MSW A;  4NXN E;  4WPY A;  4AQY E;  1ZBQ A;  2RS7 A;  4J8Z A;  3ADJ A;  1XMQ E;  4DV2 E;  1YYK A;  5T6J A;  3ADI A;  2ZM6 E;  2V85 A;  4DR3 E;  5AAS A;  4B3T E;  1ZBT A;  4X62 E;  2H36 X;  1YYW A;  4LF8 E;  2M4I A;  1HNZ E;  2NUF A;  4DR4 E;  2N3H A;  3JAM C;  5LMU E;  2DMY A;  5IWA E;  4DMI A;  3IWC A;  4JI6 E;  2VE7 C;  2FTX B;  2YT4 A;  2UU9 E;  4X64 E;  2L2N A;  4JI8 E;  4YY3 E;  4LF7 E;  4DR1 E;  2V83 A;  4WFT A;  3ZOQ B;  4OX9 E;  2LUQ A;  4R03 A;  4P7D A;  2YZT A;  2VF1 A;  4BS9 A;  4YHH E;  2V88 A;  1T4N A;  2IHR 1;  1XMO E;  4DV1 E;  3T1H E;  1WHQ A;  2NA2 A;  1UIL A;  2JWO A;  2EWL A;  3IWB A;  5CFF E;  4LFB E;  4I8O A;  4JV5 E;  2L6M A;  4JI7 E;  4BC9 A;  2NUG A;  4LF6 E;  2UXD E;  4DV3 E;  2UXB E;  4X65 E;  1RQ0 A;  2FGG A;  2M1S A;  4F9A B;  1WXR A;  3F6G A;  3OTO E;  3J81 C;  4DV0 E;  2FV4 B;  3JTZ A;  2VQF E;  4DV7 E;  3T1Y E;  1HNX E;  4BC7 A;  2LMZ A;  2DB2 A;  4P78 A;  3LML A;  2JR1 A;  2LJH A;  4R8O A;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...