2MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 37
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg102
15C8H 1CG9A 2VXUH 4ODWB 1JWUB 4Z7UE 5EDXA 3OL2A 1SMOA 3QCTL 3HCVB 1N5YL 4YHIA 3MNZA 5DQDH 4YPJA 5A2FA 4OM0H 4BSJA 1MAML 4IDLA 1FYHB 4RSVA 1G1CA 1BQHA 5FA4A 5K59F 5DUBA 4F57H 1M7DA 4KKCC 2FZ3A 3HR5B 4NIKB 2FRGP 5FOBA 1ZANH 1ETZB 2QADD 2H41A 2N4IA 4OF8A 4JRXB 5FYJD 2J1KA 4A6YA 5A2KH 1IZKA 3LKNB 3I6GB 4JQIL 4JFDE 4XBGA 3CFBB 1JN6A 3PIQB 1CYGA 3OJMB 1HH6A 4HLZG 2W0KA 2QBWA 2IQ9L 1MRFH 2R4SL 3ARBC 2WLYA 3RI5K 4ZFGH 5HYJB 3M8OL 5JHLH 4WI3A 4YE4H 3MRMA 3QZWG 4JG1H 4G8GA 5I8KL 4UIKL 3GKWH 1VACB 2I5YH 2XRAL 2NY7L 2V2XA 1PG7L 2W1NA 4LKXA 3WJLC 2XFXB 5IHUL 1YEGH 4WW2C 5JLZB 1WBZA 2Z31A 1UWGL 5JA9A 2VITB 1YQVL 5IIEB 3RNQB 3ULVE 3J7HA 1A1OB 1BFSA 1QSZA 4UILH 4MQ7A 2PR4H 4XGZB 5BW7C 4XC3H 4ODUA 1MHHA 2ADFH 4QHUB 3IDGB 1VSCA 4R97C 4XPBH 3C6LB 1NCWH 1DZBA 1ZVSB 3TBTB 4DGYH 4ZMAT 2NLJB 2R2CA 2DQHH 3F12A 2DBLL 1KTRL 1XT5A 3VXQA 4XP1L 4IRJD 2ICWA 3TFKD 3C5ZD 4OZ4A 2VLMD 1EFQA 1TXKA 4TNWF 5DJCA 3RUGA 2OS7A 1CLZH 4L9LA 2PO6D 5C0BD 2RB8A 3V6OA 4R4ND 4R4BA 4Q2ZA 5DRWB 5I1GH 2CIKB 3D6GA 5C1MB 2NZ9D 1G6RL 4JFDB 4KQ3L 3C60B 3KPSD 1IKFH 3P77B 1BX2A 4JO2H 5CD3B 1MJ7L 2FBOJ 4JFYB 2FO4A 1IGCH 4UV7H 2IALB 4MCZB 4OZFG 1CXIA 1ACZA 1MUJB 5GSRA 3WFEL 1N5AA 1S9XA 1MFBH 4HPYL 3HPLA 5HGHA 1HCVA 2K1MA 3QIUD 3TESA 4ORGB 1G0YR 4XAWH 1TQCB 3ZSSA 3LN5A 3QCVH 5GJSL 4WGVB 5JDSB 4KRMB 5DD6A 1IT9H 4F58L 1M6OB 4FQXC 1J0KA 1EAJA 1JGVH 1UJ3A 4ZUVA 2KL6A 5JMRA 4WTWA 1AGBA 2AJ3A 3EUUA 3RL1A 4HKJA 2BVOA 1QLEH 3SDAD 2YN3A 1U8NB 5DWUL 1BLNA 4BKLA 4XXDB 4EUPA 1FZJA 3C08L 3FOLA 1NEZA 3OR7B 1RJLA 1S7UA 4JB9H 2D3VA 4HH9A 3I85A 4XP4L 5IVXF 5FECB 3K7UA 1MWAL 5JHDE 2BVTA 2AJZA 5DFVD 1FLTX 3MBEA 1CG9B 1Z9OA 3BN9D 5GPRA 5J06A 3V4UL 1FZKA 1NFDE 2IH1A 2ED9A 2JB6B 3SDCD 4MDJA 4I77L 3L9RA 2XKSA 4OLUL 1E4WL 5E8OB 4KK9C 4YHIB 4PRID 1TVHB 4PJGE 4YDKL 1KT2A 1MOEA 4HIHA 1I3RA 5DD5H 1BQHB 1P6FA 5FA4B 2AJSL 3ULUE 2EEBA 1PY4A 2XWJA 3EIFA 3LB6D 1OLLA 1L9NA 1PG7X 2Y1VA 2BOCB 2DWDA 1RUPH 4AEHH 4MAYA 3L5JA 5DK0A 3V6OE 5JIIA 3H7LA 4QXGH 3V4VL 3NCCB 2EXYC 3QULB 3NTCH 5ID1B 1P4LA 4XHJC 1PKOA 1Y0LB 5DHVH 4KKAD 5DQ9B 5DRZA 4R7DA 1EEQA 1JN6B 4YFLI 4XAKD 1HH6B 3D18B 1X4YA 5D7IA 4YWGH 3L5XL 5EU6A 3WFDL 5I1IH 2X4SB 1NC4A 5DHYA 2HH0L 1QBLL 1XH3A 2Y23A 3EYOA 4HFWA 2CLRA 5BS0A 5J13C 4UDTB 1QFUH 4HK0A 3MLSH 4ZUUB 3WKNA 3BJLA 4G8GB 4YDVB 5C0IB 2V2XB 1IKNC 3BYTA 3IU4L 2WINA 4JRXD 1ADQH 1BQHG 2ESVE 2IAMC 2WM0A 4OLVH 2EDFA 1A6ZA 1WBZB 5EFIA 3ET9F 1EBAA 2X4QA 3MUJA 5IHLB 5J1SC 4Q0XL 3P0YH 2AK4E 5JHDB 1UYWL 4POZD 1WQVT 1WWBX 3D87B 1NAKL 5HYJD 5SWSE 1MHHB 3OJVC 2IQAA 1IAIL 3HI6L 2JJSA 1MCOL 1J1OL 1YNKH 1NDGA 4NC2B 2BVUA 2Q7YA 4PJGB 3VXOB 5T5FH 3VXQB 1V05A 1VERA 1YEKL 4WHTB 1Z3GL 3ARWA 3JV6A 2J8HA 2VDKL 1P4BL 1G7LB 3RTQD 3HN3A 5ESVA 3SE8H 1A2YA 2X5PA 5IB1B 2AQ3A 4Z8FL 4PLKC 3BPCA 1IVLA 1S5HA 3HFML 4Q2ZB 5SX4H 4X6DF 3VFSA 1SYVA 3BIAX 3O4OC 3TO4D 4I3SH 3SGKC 1OM3L 1HSBA 1I8IA 5B3NA 4KRLB 2ZOLA 2ICWI 2FO4B 4NZJA 1BOYA 3LDBB 3LS5H 3WIHH 2J5LB 3GSOA 4MHHI 2KQMA 2J2ZA 5CJXA 1N5AB 3B5TA 1S9XB 3IDUA 5TPWH 4P5TA 2CLZB 4OCMC 2ZCKL 1NAMB 4OSUL 1EVTC 4RWYH 5DA0B 5HGHB 4G7VL 4OF5A 1GL4B 3LN5B 3FT3A 3QJFA 3GMRA 3NN8A 4JY4B 2WP3T 5C0ND 3ZKQD 1DR9A 3BPOB 1CICB 2ESVB 2A2QT 4JFDD 3HB3D 4PS4H 3C60D 3DGCR 5EIIB 3RBSA 5KG9A 1UJ3B 4MHHG 1KIUA 3H9SE 1UH3A 1A6TB 3B8SA 3S37L 3TVMC 2ZSWA 3VI4E 4NN6B 2EYRB 4E41A 2XTJB 1QZ1A 4WO4D 3ULSA 1R3JB 5FFLA 5SWSB 3OAYH 1N0XH 2EXWC 2IH3B 1B90A 3WNKA 2XACC 3QXVA 1QG3A 2P5EE 1BLNB 2VDQH 1TETL 4BKLB 2ZNXA 1T1WA 1NEZB 3QRGH 4K7PY 1Z0MA 1S7UB 4HH9B 4P57A 5AYUL 2XWTB 3M45A 4CN6A 3TO2A 4HDIA 4IMKC 1IBGH 4QTHB 2OXGA 4JN2B 3BKYL 4Z7VE 2ZUQC 5E99L 4DKAA 1FZKB 4AIOA 2IH1B 4I48A 2CRIA 5I1DB 2OJZH 4NM4H 4FQJH 2FEDD 4OAWB 3NBNA 3LOWA 3D5OF 3V52L 4L3CB 5I75C 3UTSD 3EDEA 2BP3A 1Q38A 4YHYB 3NACH 4DOHE 1FNGA 4RFEB 4U1SB 1KT2B 1SEQL 4M7LT 1VFOA 4NQEA 1I3RB 2EIEA 2DWDB 4OFYA 4XC1L 2UZIH 3GZKA 4MAYB 5IV2A 4ODXA 4LSTL 5DK0B 1EZVX 3LPWA 4EUPG 4XBPA 1NEZG 3OGOE 1DVFA 1P4LB 5DRZB 3OF6A 3O41A 3V8OA 3DVNB 2FJHA 3EZ8A 3H3PL 4U4BA 2YZ8A 5L0QC 4KXZI 4ZFOB 1RV6X 5EU6B 1A7OH 1VA9A 4XNMA 4FTVE 4F8TA 3H9SB 5ABDE 2FYYB 5DHYB 4YXKL 4LCCA 2NZIA 3EYOB 4HK3J 5EU7E 1YEFL 3ZYOA 4HK0B 1AR1C 2HT3D 5C09A 4EDWH 3MRLA 4BQ9A 4GMSH 2P5EB 4YFDB 4WNQA 3VXUA 3ZDXE 4LHJB 4NQDE 2P8MB 5EORL 2WINB 1B4JH 4NJAL 4MA3A 5GISL 4M1DH 5AZEH 5BVPH 4H8WH 2AK1L 2X4QB 4PJEE 1LO0L 1KCLA 1KG0A 4O2EB 1MRDH 4MNHA 5E6IC 3G5VA 3O81A 5IP4A 4QRPE 3TIDA 4G8EB 3LV3A 4S1DD 1EIBA 2IQAB 5ICXA 3N9GL 1E28A 3HE7B 3I3DA 4G8GD 4M62L 1NDGB 1QNZL 2O5XH 3NIFF 2Q7YB 4DOHB 4PY8I 3T2QA 5KSBF 2AEQL 3KYNA 3BRFA 3GNMH 5CKGA 2GSIB 1L4IA 3JV6B 2Z31D 1AI1L 3UAJC 4P5MB 4I1NB 1A2YB 1X5HA 1S78D 2VWEC 3O6KH 1J1PH 3LPGA 3HZYB 3BPCB 1FFRA 5FYLL 4S1QH 3C09B 3S37X 2EDQA 1I1RA 3QA3A 3STZA 3M1BA 3MLTA 5DVOA 5LGJA 4NQEE 5SWZE 2ZOLB 4OLZH 3ZHDA 1BBDL 4GJTB 4FTVB 3TBVA 3H3BC 5IK3A 1CLOH 4Z7NE 4ZXBA 1UQSA 2EDTA 4KUCD 4L8CA 5DMYA 4P5TB 1HILB 4KZDH 1KOAA 2HT4D 2CPCA 5GGVY 2VQ1A 1WLHA 2VZ3A 2Y6SD 3O6ML 2A77H 4RNRB 5DEFA 4OGAD 4NQDB 4RMTA 5DI8B 3QJFB 2YK1H 5F6IC 3H7BB 2OL3L 3F7QA 1IEAB 4OB5H 2FR4A 4OGXH 5D1QC 3U9UA 2Y5EA 1CFSA 1M05A 3CFCH 2R1XA 4PJEB 3SCMA 1WUNT 2ID5A 1NL0H 4QRPB 4ZPVA 5CHNA 3FMGH 3GSWB 4NKMA 1CZ8L 1C1EL 4P3CL 1HWHB 4HJJL 4WW2F 4KJWD 1FG2A 2AV1A 2UZYB 4PB0L 1BVLA 4PJ8A 4BELD 4QXWA 5K93A 4F3FB 3OAZK 3HI1B 5EUKB 4RIRA 5CMAB 2BX5A 1T2XA 2H2SC 4TUOB 4P59H 1CICD 1IGML 3TO2B 4HDIB 5HDQL 1NMBL 5H2BA 1C08A 3HC3L 3DGGA 2CIIA 2AEIT 4DAGL 4LVNC 4UNUA 3R0NA 1KPRA 4HCRH 4I48B 2J8UF 2XTJD 4QHMB 4FXGA 5L2KE 2B1AH 4HUUA 2ORBL 1JWMB 5F89A 1R5WA 3U0WL 1DBAL 1FNGB 1NGQH 4JDVB 4NQEB 5SWZB 4AG4H 3P73A 5F3HB 5EIVA 12E8H 4YZFE 4ELME 4M1CC 3S6CA 5D7JC 3V5DA 1V5JA 3IDXL 2B2XH 4JR9H 4KY1L 2D03L 5DD1L 1F90L 2X4TA 4F7CB 3MBED 2FECL 4MAUH 2KKQA 3QHZL 4XBPB 1FORH 1G7HA 4GBXA 1YEHH 4TSCL 3ES6A 5B8CC 4JKLA 5DMJB 4U1NB 5C0GB 4ALAH 2FJHB 1B0GB 4GG8A 4XNMB 4XP6H 2R69L 1ND0A 2G5RA 3MA7A 4C58B 4LAQL 5HYSA 2XYCA 4FQLL 4LCCB 3VFOA 4OZIE 2MCPH 4PYHA 3ILQD 1SMAA 4MAYD 3CSPA 5C09B 3V6ZB 3MRLB 3UMTA 2YUVA 4H1LA 4FZEH 1RD6A 4NN7C 4WNQB 3VXUB 4LRIC 4LASH 2NY2B 5KS9A 3GMMA 1S7RA 4MWFA 2NPLX 2EKSB 1AH1A 4K2UL 2HWZL 3I75B 1Q0YL 5EU6D 1X4ZA 3EGSA 4GAJH 1NC4D 1GAFH 4NUGH 5HI4D 5ICXB 5CGYD 5L2KB 2NY1C 5C2UB 1HK6A 2KDGA 4JO3L 4OD2B 3DMMC 3IFPB 2BY1A 3VGDA 2Z8WC 4LLAA 1GOHA 3A6CH 1WTLA 3T0DA 4Y4FA 3KYNB 3MBXH 2FD6H 4HT1L 5T3ZE 5I15H 4NJ9L 4ELMB 3MGTA 4N9GA 4FFVC 4NQCE 1IM3B 4KROD 2FLBT 1YY8A 4HIIA 3ZYZA 3I6LE 1DANU 1G6RA 2IBGA 1M7IA 3DVGA 4G5ZH 3HC4L 1FN4A 2FHFA 5CP7B 3U82B 3QA3B 3STZB 4G7YL 4HMEA 1IAKA 1W0WA 4DW2H 3KPRE 5FUCC 2WW8A 4C4KT 3ARRA 3OKLA 2V9QA 4RAUA 4WVRA 1YMMA 1QEWB 5J11C 1U0QA 5FUZH 4L4TA 3TBVB 4AT6B 1UQSB 1WIPA 3U7WH 4CW1A 3U7YL 4OZIB 3GHBL 3MZGB 3MRIA 4I3RL 5FO8A 5DURB 3T1WA 4XPFL 5JPNA 5JW4R 2VQ1B 5LWYH 5DD0L 1EPFA 2ZG2A 2OJEA 4YK4C 1G9ML 3UJJH 3U9PL 2VSDA 3F5WB 4HEPG 5TQ0H 1BFVL 4TUKL 3U9UB 2DQJH 5CZVH 5D4QA 4PREA 1M05B 4LIQL 4LCWE 1A14H 1A4JB 1JHKL 1T89A 1U91A 5D2NE 1FVCA 4LCYA 4PJIF 1U3HC 4FTVD 4YPGA 1I9JL 3CLFL 3P9LA 4ZPVB 3MJ8A 3EOBA 4GRLB 2BRRL 4KK8D 3TJEL 4UOJA 1T03L 3T8XB 3EFDH 4OGZA 3VH8A 4P5TD 3RAJL 1FG2B 4Y1AE 1P7KB 2AV1B 1ZXQA 2OP4L 4G6KH 1BVLB 4PJ8B 1BAFH 3S35L 4Q58C 3UTPE 1KTDA 4QHKJ 3OPZL 4BA8A 2GT9A 3ARDB 4LQFL 1MHEB 3BUYA 4ZAKB 1DBBH 4ONFH 3QUKB 5F1KC 4TRPH 5H2BB 4HUMB 4HIXL 3DGGB 2CIIB 4NQCB 4CKVX 1FH5H 5BV7H 4H8WC 4S11A 4E41D 3UDWC 1UCBL 4FXGB 5F9WB 2AEPH 3X14B 3BPNC 1JHLL 1WCQA 4NDMB 1FYTE 1R5WB 1MCFA 4N90E 4Z0XB 4YXHH 3G5ZA 5HBBA 1EO8H 1JNNH 4ACPA 4HPOH 3WEXA 1CL7H 4KDTC 4ZNEA 2YMXH 4OCXL 4YQXH 1W0VB 4H88L 1K3ZA 1WAAF 2X4TB 2LVEA 2EH8H 3ARFA 4WJ5B 3WDIA 1BZ9A 4GBXB 3UROR 3KAAA 4NQSA 5JIHA 4WWKB 1MCKA 4KTYA 3BOVA 3WFHB 4LU5H 4MD0B 1LO5B 5SV3A 3IDIA 3BFOA 3JZ7A 4NQED 3WHXA 5I8CA 5SWZD 1FFQA 5GZND 3MA7B 3SHSA 1TENA 3FQRA 3GBNL 5D2NB 3VFOB 2KZWA 8FABA 4LEXL 2R0WH 4ZFZA 5L6YH 1TQBB 1OAKL 4XPTL 1FFOA 2CDGB 4H1LB 2IPUK 3BP7B 3BSZH 1P84K 4Y1AB 4WUUA 2WUCH 5D8JH 4PBVC 1G7PA 4JAMA 2Q8AL 3S34L 3NIGF 1CU4L 3OF6D 4MWFB 4U0QB 1HKLH 1NCNA 2F5AL 4B50A 1DQDH 4NFCA 1AFVL 4EJ1C 5FDWB 1MLCA 5GRYA 4OTXH 3VE0A 4GW1A 2YPVL 1H3UA 3RL2B 2HKFH 4JO4H 4GT7A 3VMNA 5C09D 1W2KT 3CJJA 4PLJC 4XNYH 2I9TA 5IVXA 1FYTB 4YFEA 1CFNB 3SOBH 3VXUD 3B9VA 1MFNA 2R0KL 1T21B 5HYSG 4CVWA 1CXHA 3B9EA 4PFEA 4P2RA 3JWDL 3TNNA 4P9HL 4UINH 4DJMA 2DAVA 1MI5E 3LN4B 3ZDZF 4H1LG 4DTGH 4OLXH 5HTSA 3KLDA 3WCYA 5TFSL 1YY8B 1G6RB 1PW3A 3DVGB 3O0RH 4AEIL 1U6AL 1FN4B 4U3CA 4YDLB 4HWZB 5DJAA 5I18H 5C9JB 1IAKB 3HNVL 1CVSC 3LZFH 3OKLB 4U1KA 4RAUB 4DVBA 1YMMB 4ZS6C 1X5AA 3OAUL 4PRAA 3S35X 4DQOL 2OZ4H 1JZ5A 3HNSL 1OF2A 2HJFA 2C3XA 6CGTA 5F7UA 4LLDB 5FO8B 2LV4A 5F3BA 2NY0B 5DQDL 1KB5L 4DKEH 2OJEB 3SKNB 4K9EH 3DV4A 2FX7H 5D5MF 1VFBA 1J5OH 4PLNC 3H42H 1BEYH 1ZHKA 3FQXA 4X6CF 1NCCL 3QUXA 4NHUA 1T7XA 2EH7H 1XGRA 1KTKE 5JORB 4DKDC 3UYOD 5J57B 5F1NB 3BH8A 5I74C 4YC2B 2CKBL 1ZANL 4L1DA 1FVCB 5IVZB 4U7MA 4WI4A 2VLLA 3P9LB 4Y4HC 5FYKL 4D9RE 3NIDF 1BBJA 5T33H 4S2SA 5D1XC 1U58A 4JANA 1UM4H 3VH8B 4R6UA 5EBWB 5A2IH 5DURD 4UTAH 3T09A 4JQVA 2G5BB 4V2BA 3SQOH 5H94A 5E4IA 1KTDB 3BZEA 4X5XB 4JM4H 1T6VN 4L8DB 1F4AA 1WT5A 4GUPA 4OF7A 4RGNC 3CCHB 3QG7L 4ZFGL 1ZLUH 3BUYB 5GZOD 1OAQH 1MWAB 4FQIH 4NRXA 5CJ8A 1KTLA 3S3SA 2Z0BA 4PJDF 3W0WA 3VG0H 5K9QI 1FNFA 5I8OH 4LHQB 2AXFB 3QFDA 5DGQA 4I13B 3MXVH 4GRLD 2G75A 2BNRA 2HVJA 2LABA 5J4MA 5IVXE 1XR9B 3KLHD 3BI9X 5D6CB 1MREH 4PJ8D 2G2RB 5FHAL 4P2OC 5IT2L 1QO3B 2I60H 1C5CL 3VXPB 1KBGL 5K9QG 1FLRL 1ZVYA 4XC3L 3RX7A 5T3ZD 1MCPL 1LEGA 3VH8G 3ZO0A 5LKNA 3KYKH 1K85A 4NQCD 4EOWH 1RHHB 4S1SH 3LEVH 1LK3H 1RFDH 1BZ9B 4G43A 1AGEB 3EHBD 4URTB 4YDIH 3I6LD 4PJCF 1ED3A 3GRWL 3K4AA 3MO1A 1V3MA 5J6GB 5D6DA 4PJHA 4GAYB 4L3EA 2X1WL 5I9QB 5CEZD 1TDQA 3MCKB 5E6YA 3MRNB 4WW1B 1AQKL 4W4OC 1II4E 5JR1L 4WUUB 2BNQA 1ORSA 1WC7B 4Y16C 4AEEA 4WTZA 1G7PB 3E6FB 1DEDA 1OLZA 4JAMB 2NXYC 4GBXD 2BC4B 2JCCF 4CU6A 2RR3A 2YEZB 3CH1A 2DQIH 1ZEAH 5CUSL 1VESA 2LTQC 1C7SA 5C2BL 5C08A 3S88H 4LOUC 2FCBA 4PJAF 3K8LA 4ISVB 3VE0B 4GW1B 4PJBF 1C5DA 4OLYL 1YECL 3QCVL 4N0CD 4NNYA 43C9A 5D7KE 1EHLH 5IVXB 5JXAL 1C5BL 3RWDA 5KVGL 4IRZH 1K9TA 1UACH 4O00A 1P84J 1OT1A 2OMNA 4PRPE 4KRPC 4RISL 5BZWA 3V0WH 1NC2A 5C0CA 4P2RB 3TNNB 4BZ2H 1VGKB 4ONHA 4JFEA 1A7QH 1PZ5A 1MEXL 3VGGA 1QHPA 1EJ6A 3F7VA 4X4XA 1IARB 3D25A 5DJAB 1WITA 3VFPB 3C8KB 3QEUA 4BQ6A 3TJHC 5BV7C 4NGHL 5I71B 1CGSH 1NGZA 1ZLVK 3GUTA 4G8FA 1FYTD 2FL5A 1F3DJ 4N90D 4XWOD 5DRXB 4DFHA 2XY2A 3MNWB 4X6DE 3RGHA 4PRAB 4Y4FD 4EI6B 4JJ5A 3AS3A 5EN2B 1WVZA 1OAUH 2X2YA 1OF2B 1KCKA 5DVNA 2HJFB 2VXQL 3HUJE 6FABH 3V0AC 2ADGA 1X44A 5FKAA 3LKPA 2F74B 4L5FH 1RUAH 1WZ1H 5J6HA 1UH4A 1VFBB 1L7IH 3TA3A 3UYRL 1ZHKB 4Y2DC 3QFJA 4G6FD 2W9EL 1I1FA 3QUXB 4NHUB 5DS8B 4LSSL 2JIXB 5F7DB 1HN1A 1YMMD 4OQTH 3U2SA 3QUZA 3IDNA 5TDNB 3VFTA 4L4TD 2VLLB 1NGXA 4HX1A 1I8MA 1BBJB 1IFHH 3MROA 4HBQA 4MNGA 2IANA 3RWEB 2X4UA 1TTFA 1U58B 3BHBA 2AI0H 5IG7B 4I0CC 1KIRA 4ZDHA 2YPKB 2OXHA 2NY0D 4JY5H 4KAQH 5H94B 1KEMH 4KV5F 3BZEB 4M93B 1IRAY 4PRPB 2H1PL 3L6FB 2MFNA 2BK8A 1MCSA 4JJHA 3I6KA 3MGAA 3AY4C 4L8BA 4WDIA 1QFUL 2QSVA 3VXRE 2Y7QA 5JZ7C 2Z93B 3QFDB 4NWTL 5LXGH 1MQ8A 1UKSA 5IB4B 2OR8A 4I0PA 3HZMB 5KSBA 1ADQL 1DBJH 5DJ0A 4K3DH 2BNRB 2HVJB 2O61A 3QUYC 4QWWD 2W0FA 1WEJL 1FL6A 4NQVA 2DM2A 3P11L 1Z6JT 2YR3A 2CDFB 2FGWL 1G84A 4HGWB 1EEUA 3L7EB 1FQ9C 1FIGH 4JGUA 3I84A 2DQUH 4X6DB 1MRCL 4GRWH 1R24A 4BZ1H 5FYLE 3AREB 1DUYA 1NBYA 3D85A 5IB3A 3OKEA 1CDCA 1CXEA 1YNKL 4K3JH 4KJQC 1DTUA 1JVKA 4TOYL 3VFRA 4HUVB 3WIIL 3TWCL 1H15B 3HC0A 4G43B 3R0MA 2M2DA 1FIEA 5TF1H 2WMPA 5F1OB 3U0PA 1INDH 4FS0A 2BXYA 3GMNA 1GJIA 5TE4L 3LIZH 2OQJA 3ARBA 5HHVH 3QNZA 1KJ2L 3CGTA 4E0RB 3P4OB 1AC0A 3PL6C 1BJ1J 1KJMB 4WFHE 3FO1A 5CIPA 3OBAA 5ACMA 4RZCB 3WJLA 4K9EC 2COQA 3DXAA 2OTPA 5GS2D 4ZFFA 4WW2A 5C08B 2IBZY 1KF9B 1LO4L 4ODTH 3VXRB 5J7CC 2YUWA 5KVFL 2ATKB 3AXLB 1RZIB 1I8KA 1JF6A 1F58L 1RVFL 5MERB 2A1WL 1SJEB 3HTLX 4WFFD 1TPXC 4L1HA 5BW7A 43C9B 5IEKB 5A16A 1OAYL 2M26A 3KPTA 2R9HC 1UWEH 5HSFA 3U7AA 4K8RL 2R23A 1PKQA 1BZ7A 1Q9LB 3D69A 4WUUD 5J1AB 1RZKH 3QO0B 3V0VA 5BZWB 2ZNWA 4Q6YA 2J8UA 3CFEA 5C0CB 1I9IL 4Q9BA 3WFZA 2HTLD 1FO0H 5FKPA 1LNUA 3PWJA 2YPLA 5EU4A 1BJMA 3ZT7A 3PABB 1N26A 1XGPA 1ACYL 4HS3B 2FSEA 3RX5A 2DD8L 4WTZG 4QRTA 3GSNA 5I1KH 4X4XB 3QUMH 2E7LC 4O5LL 5EOTA 1AXTL 2GAZA 3WNNA 1I7RA 3INUL 4LGRB 3GUTB 4G8FB 5ALBL 3EYQC 4OD1H 4K3EL 3TM6A 3OAYK 1YMHA 5MI0C 2W65A 3DROA 5GS1C 3MLXH 4P2RD 5E8EA 2ADGB 2VAAB 3NPSB 3MRDA 3RVXD 4KVNH 3VXSA 1EXUA 3FN0L 5J6HB 2OL3B 2K7PA 3ZE0F 4NC0B 1G7IB 3TA3B 5GIRA 5DMGC 3AS1A 2YSSA 2AERT 1XAUA 2X1XR 3QFJB 1A64A 3HAEA 4N8VA 3EJYC 5E70A 3IDYB 1XGUA 3C5SA 2P8LB 5ESQB 4FQXA 5F97E 1RZFH 4OCWL 3VFTB 3M17A 1U2HA 5E5UB 4HS6B 4HX1B 1A6WH 3B3IA 1BM3H 2AXHA 5K9OB 4MNGB 4UU9B 5EWIH 4M48L 4OCYL 2HLAA 4H26B 3KYMA 2C5DC 1A7OL 2W38A 1T0NB 3QUXD 5DEGA 2NX5E 1HHIB 3IXTA 4Y4KC 4WHYG 4OZGF 5F7WC 1DQLH 1NDMA 35C8H 1D5ZA 1OP5H 2O61B 4M1DL 2HVKA 2JB5H 2VDMH 4NQVB 4QRSA 5BVPL 1BWMA 3PWNB 2WBKA 1S9WB 4X9IA 2J8UE 1JRHH 3CPLB 3GK8H 3MREA 4PRPD 3DX6A 1OTSD 5IESH 4YHPA 1QFOA 2LU3A 3L3IA 4MXQD 1NBYB 4J3SA 3W0WD 4O9HH 3S36L 3VFRB 2O5XL 3KS0H 3RZCC 2EECA 3FB8B 5JQHC 3MYZA 4KHTL 1TJIH 4X83A 2X10A 2BNRD 4G42A 3U0PB 2R8SH 1HSAA 2VZTA 3SKJL 2R1WB 5HD8C 1OQOA 4TNVF 1DBML 3PE9A 2R29H 3GMNB 3VFWB 1JGLH 2A9NL 5B38B 1FRGH 3ARBB 3H9YA 4S1QL 1FFPB 3QNZB 3CC5A 4M6NH 5E94B 3VD5A 1FV1A 1P5VA 4WRLA 3ARED 4LHUG 5FIEA 1X9QA 1FVDA 3G9VA 1JZ4A 4MD4A 1UXWA 3FONA 1YQ2A 2VN7A 5C07E 3SY0B 1LE9A 5IW1B 5CIPB 4PJIA 3WJJC 4PJ5A 4FMFA 4LIQE 1IKNA 1CLOL 2F54E 3QI9A 1U3YA 2IGFH 3P4NA 2IAMA 1EAPB 3K80A 4EN3C 4WW2B 5I1AB 2P46B 4CMMA 3VW3L 1K6QL 5CD5D 4M1GH 3RRQA 5AEAA 1GYAA 3FT2B 2A77L 1I8KB 4JDTL 2L0DA 1S3KH 2R2BA 4ELKA 3FAXA 5EBLA 5DYOA 5A16B 3MYJB 4KZEL 2FH8A 4QEGA 4R97B 2EKJA 2EDKA 3G9AB 5C70A 1QRKA 3TCLA 4JVWA 3VI3F 3OKNB 1I85C 4B53A 4WEBH 3HE6C 3JV5A 4MA1C 3V0VB 3SDDC 1KLGA 2J8UB 1NL0L 3UTTA 3VD4A 3QNXA 3VFGH 4ZYKA 5HHNB 1Q0XH 3O2DL 3JTTA 4FZ8L 1CN4A 4YBQD 1XGPB 3B9KC 3HI5H 4N1CA 5C08D 5IQ7L 5JIKA 1QR1B 5TDOA 3VXRD 3PWVB 4NZRH 4XBEL 3IKKA 4H0HB 1WK0A 4QRTB 4OI8A 1I8LC 5E24E 1KC5H 1A4KA 2DQEL 2FEEI 4PGBA 1HXMA 3E6HA 2GAZB 4IRSC 4HKXB 2DQCL 5FGBC 1IC5L 2IMNA 3PGCA 4NYLA 5FUOH 5I1EH 3MLPA 4MX7B 3QIBC 1WAAA 5L7XH 3SGKA 1N8ZA 1U8LA 1YMHB 2IFGA 5FAAA 2W65B 3DROB 2NXZC 4TVPD 5C0CD 2B1AL 5DJDA 3RZWA 3ILPB 3UJIL 2WANA 4JFED 2B0SH 3T2PA 3CMOH 5FYLD 2BVQA 3VXSB 1A1NB 4ZODA 1GIGH 4X80H 4WI5A 2DM4A 3RDTC 3HHRB 5GIRB 2DJUA 4NUJB 5FHBH 5C07B 2YSSB 4OCLC 2R0LH 1JF1B 4OZHF 2I9LA 3HAEB 4N8VB 4NN5C 2VL5A 3BWAB 3BDYL 4UOW1 3IKCA 1XEDA 5DHXB 4FQXB 4X7DC 3RVWD 3S3PA 4RA0C 2YA0A 4F33B 1T66C 3M17B 3B3IB 1YEHL 4LSRL 3TVMA 1JP5A 3ARGB 1IGIH 5I1HL 4OV5A 5ACZB 1MF2L 1CE6A 4LEOA 3ALXA 3VU2A 4ODSH 4PJ5E 2YUXA 3TA3D 3S36X 4WFHD 4XCNA 4N0RA 3QFJD 5KANI 3QT2A 2NY4B 5C7XL 3BAEH 4PJ9B 1DCLA 5E2UL 3UPRA 3T2OA 4E42A 2NW2B 3QUZD 4GW5A 1FL5B 4JFQA 1MH5A 2LVCA 4OD3L 2C3VA 2VB5A 5I30L 1G1YA 2IAND 3TPUA 3HAEG 4N8VG 4HWBL 4FRWA 3O3DA 4I4WA 3PNWB 1S7SA 5KANG 1LVEA 1A22B 3MZTA 4FQ1L 2PETA 1F13A 4TVSa 1G9NH 5I19L 4LP5A 1FNLA 3DX6B 1GAFL 4JQXC 3QCUH 2SEBB 4NUGL 4PBXA 3DBXA 4YHPB 1HHHA 1RZKC 3L3IB 5JW4N 1ODAA 4PV9A 5EA0L 4U49A 1DP0A 5KVDH 2BRQA 3ARVA 5DJ6A 3FQWA 2P47B 2YKLH 1I7TA 4CMHB 1T0MB 5EZLB 1ZOXA 3QIWC 1EMTL 4G42B 2Z8SA 1DBKH 1VPOL 4AZ8A 4Q9QH 2AJVL 1WAAE 3O2VH 1GHFH 4UI2A 2NR6C 3DHMA 3WSQH 1Q1JL 1V7ML 4KMTL 5D5MA 4R4FL 4ODHL 4M6AA 4OFKA 1AKJA 4UB0L 4X6CA 4F7EA 3ZSTA 1RUMH 5LAXB 4DEPC 5J13B 1X5YA 3CFKA 3D85D 4GXVH 1MQKH 4KKCD 1FVDB 3QXWA 4MD4B 5E2VL 1I1AB 2CMRL 1RURH 1LE9B 1NCUA 4JPVH 5FUZL 4PJ5B 2DLFL 5FYJU 3S98A 3QJHB 3TYFB 1A9BA 1RJYA 1E4KC 1RIVL 1VDGA 9CGTA 1R3HA 5DJ8A 5FYKE 1O5DT 4CVZA 4MD5A 5E6IA 2A6DA 3ARBD 3NIGE 4WI6A 2R2BB 3DURA 2Q86B 1CLYL 4NP4H 1M71A 1N6UA 5CZVL 1I9RH 2XNAA 4U6VH 3D3VE 2ITCA 4LMQI 4LSVH 1BPVA 2QQNH 5D1ZB 2CJUL 3UTTB 3GI8H 2P1YA 4TULH 4MVBC 3DXAD 3EFDL 5TDOB 1OSPH 3A67L 4OM1L 5C0RL 1SBSH 1HQ4A 3WUWB 4LCUA 2J88H 2J7LA 5EO1A 1OY3B 4NOBA 4FQ2L 5JW5A 5IM7A 4MB4A 3E6HB 3L5IA 3T3PF 2A0LD 1MCIA 1MFCH 2ZSVB 4HBCH 4LDOB 5TE6H 2BOBB 1E27A 3W11C 2DLEA 1KCUH 1U8MB 1N8ZB 1A7NL 1YJDL 3QNYA 1D9KB 1AGDB 2W91A 3QEHB 4CJ0A 3EYVB 3FRPA 3MLRH 1KGCE 4PJCA 1KB5B 3O3UN 4CADA 5SWQA 5GSVA 1WFOA 5EBMA 3IYLW 1IQWH 1KULA 1GZQB 3PGDA 3E8UH 4MJIA 5I1CH 3D0LA 5TE7H 5LGHH 3O9WB 1NCAL 4XVSL 1AGCA 1JPSH 2RHEA 2OTUB 2I9LB 4YHMH 1HDMA 2VLRE 3DYPA 2BY2A 1WCBA 2CKBB 2EE2A 4FNLH 5EO9A 4FFZH 1FNEB 3FO0H 5D1QA 2AGJH 4JKPH 4M8VA 3MCLL 5DHVA 2A74A 7FABH 3IB4A 2AXGA 2APFA 2JCCA 1J1XH 2Z35A 4D3CL 3GMQA 5FYJL 5GS0H 4LU5L 4HF5H 4R7NB 2WUBL 3PWLA 1MPAL 3VXSD 4LEOB 4PJAA 1OD9A 5JIPA 3D3VB 1KACB 3CK0H 4M6OL 4PJBA 4U6XB 3NIDE 5C07D 3E2HB 4AH2A 3AAZA 3NFSH 2F8VA 3BT2L 1XIWC 3WKMH 3KPLA 5C0FA 1A3QA 4FQXD 3BSZL 3UPRB 3GMLA 3BGAA 1ADQA 4XCFL 2X05A 2C3VB 2ZUQB 3T0EC 1CIDA 4AIZB 1MJUH 1NLBH 5BCAA 4GOSA 4Z77A 1DUZB 4PJDE 3U48A 5FGSA 4N0YL 2B8OT 3VXME 3CNKA 3GB7A 5AD0A 3QEGL 1KCSL 3G5YA 4OTXL 1L6XA 2OI9C 4PJFE 3BEVA 4YXLL 4P9ML 2VDLH 3DBXB 3T4AB 2NW3B 5CINL 1CFVL 5J0BA 3L5WB 2AJUL 1A6UH 4J7RA 3C9NA 5C92A 2OK0L 3DX8A 5D7JA 5DJ6B 3RU8H 3U46A 4BSVA 4Z78A 3SOBL 4NPYB 5DD3L 5B22A 1AO7A 3EYSL 1ZHNB 4PRNB 4V1DE 4LLMA 3HS0A 5B8CA 1KJVA 2XQBH 2VLRB 4JZJC 5F7EL 2WZPD 4YHKL 3IFNH 4N5EC 5D5MB 2XKNA 4KKLC 2PTVA 3FQUB 1YEJL 1Q9WA 3PDDA 1WFUA 2XN9A 1R0AL 2DLGA 4WCYH 5I18L 2QTEA 1D7FA 3MRCA 5ID0A 4NNXB 3LZFL 4EBQH 1ROWA 3WIHA 1DJSA 1GGIH 5CEYB 4U1GC 5D2LF 1XF3B 4JLRB 4LRIA 3QPXL 2EXYD 3GI9H 4GQPH 3MACL 3MV7E 4XHJD 5DRNB 5IKCA 4G9DB 2ZG3A 3ECBB 5CAYB 5DJ8B 1QRNE 1H5BC 4Z7QF 2XICA 1FNSH 4Y0GA 1ORQA 4MD5B 4HXAL 3P2TA 1RUKL 2JCCE 2A6DB 5AUMB 1RULH 1I3VA 1A1MB 2XT1B 3DURB 5KSVA 1W72L 1M71B 2EH7L 3DRTA 4RGOH 3H9ZA 4PJDB 1KCVL 5IWLC 3KJ4C 3BPLB 3DMMA 1I1AD 3VXMB 4OFVA 5F7KC 5CJOH 3LKRA 4PJ5D 3C2SA 4U6TA 1FP5A 3W82A 4PJFB 3OX8B 5ERWB 4AL8H 2PN5A 1R3KB 3UTQA 2IAMD 4HHAA 4UTAL 1ZT4A 5CILL 4NQXA 4XTRD 5HXMA 4LCUB 1JPTH 4BFBD 1KELH 5JW5B 3U79A 3CUPA 1S8DB 2HG5A 2J6EL 5HVHC 4V1DB 2E9WA 1DL7L 5IB5B 5LBSL 2HKHH 3QNYB 1UM5L 3OWEA 2Q20A 4YIQB 5C8JB 3UTTD 1JNLH 4PJCB 3CZFA 4CADB 4PY7B 1G9NC 5E8NA 1NSNH 4XWGL 1TJGH 4KPHL 2UWEF 1ZLUK 2AABH 3IDJA 3O3EA 3PGDB 1Q94B 3D0LB 4X4YA 3SO3B 4MS8C 2I60L 1KNOB 2VE6B 1MIEH 4TTDC 3SDYH 1AGCB 3FTGA 4G9FA 5IB2A 5F6IB 3G08B 3O8XC 3UBXB 4YHNA 3GSXB 5D1QB 1XF2B 4LNVA 5BZDB 4Q9RL 1QRNB 3NCJL 2NCMA 5DHVB 4ZUTB 5BRZA 4KU1A 4W6XB 2JCCB 2Z35B 1U3HA 5EB9A 1IQDA 3H0TB 4R8WL 1P4IH 4C57C 4GQ9L 3PWLB 3IETA 1U8JB 4J6RH 4R26H 1U8QB 4X8XA 1K5NB 1H8NA 2IFFH 4LBEB 3WNPA 1HHGA 2CK0H 2DF3A 4WGWB 4NSKA 4PJBB 5ITBL 3BQUC 2VLJE 4AH2B 1EGJH 2H9GB 3MFFA 1DN2A 3FRPG 4FQQA 3PP3H 5FV2A 1Q9OB 1ZLWK 3ZKMC 5DUPL 1UXSA 5FYKD 1DVFC 1CFQA 1HEZA 3S8WA 1SVCP 3BZ4A 3GJFH 4CVUA 3UDWA 4G6AD 3MLYH 2BFVL 1REIA 4IMLA 1HZHH 1QFWI 2Y06L 3I2CH 3MOBH 2EXWD 3GB7B 5AD0B 5E2TH 3AC0A 2R2HA 4LP4A 1QFHA 2IPTH 3BEVB 2QSQA 4P2QE 5JTWA 5D72H 1JPFA 4KDTA 4ZPTB 5GGUB 4HK3N 1S7WA 3QG6A 3BJ91 1EEYB 1URLA 3C9NB 3DX8B 5D7JB 1VGEL 1U8PA 4X9HA 3U46B 5FB8A 3NCBB 4Z78B 2QQLL 3O3BB 4GFTB 1AO7B 1SEBA 5HHQA 1JMXA 1C16B 3ESVF 4LLMB 1C12A 3VRJA 1B3JA 1KUMA 1SYSB 1A02N 1A7QL 3MX0A 4GRWF 5DC9B 2VXVH 2WK2A 5HVGB 1ULVA 5DMKA 1KJ2B 5K9JL 4X0KA 1U92A 2GY7B 3L3DA 1A3RL 4X4ZA 2CUIA 1JWSB 5IQ9A 4M7JL 3GSVA 3VFVB 3IJHB 3ARTA 4JHZA 5ID0B 5L8KB 3CDYA 3IAQA 5FO9B 4ETQA 1Q9KA 1PLGH 2EO1A 4QYOB 4NN7B 1TZIB 4GW4B 3VXNA 4PGJA 2VLKA 3FHAA 2VLJB 4M61A 1TVBA 1KFAH 5IKCB 1OGAA 5SX4I 1OPGH 3FOMA 3D0VA 5IVNA 3LY6A 4X98B 3GJEB 2XA8H 1AGFA 3KYOA 4KTDH 4ODVL 3BMVA 1WZ1L 1MVUB 2XWBA 4D9LH 2CGRH 1R6VA 3DX7A 4TTGA 1AKJD 4OGYH 5JQ6L 5KSVB 2HJLB 3QXTA 4JPIA 3DRTB 5CGTA 1WISA 4BUHA 2YA2A 1LHZA 2YRZA 3L7FA 4W70A 1QSVA 1TITA 5GS0C 4OQTL 2EDRA 4XPAH 1HOCB 4GRMA 2WLZA 3CXHJ 3UTQB 4KVCH 4NKIL 1B9ZA 4LVOC 3MV8A 1ZT4B 4NQXB 4KAQL 4HAFA 4RWHA 1GC1H 1EHAA 5D7LA 3I50H 5FXCH 5MP6L 3EBAA 3BXNB 4CU7A 5GRXG 4QXUH 2VNCA 3C2AH 2HG5B 5E4EC 5M94B 2EDHA 1BFOA 5HYFA 3P0VL 1YYML 5F6HJ 3UXFA 3LQZA 2H6PA 4HCRA 3FB6A 1EZVY 4BJLA 5C0AA 1FDLH 4F7TA 5J11B 4N1EA 2NY5L 1DBJL 5HHME 3BP6A 3BH9B 3CZFB 2VUYA 5E8PA 5E8NB 1RAMA 2AQ2A 5I1LA 3UAJD 2YD4A 2A6JB 3O3EB 2YXMA 4X4YB 1TZHB 3D39A 2DQUL 5HVFB 1YYLH 4ZO9A 4PTUA 5IFAH 4RMSA 1NCTA 2BVPA 4YDJA 1AJ7H 3NZ8B 5IB2B 3BW9A 1JTOA 4M5YL 1QBML 4CRPA 4YHNB 3JUZA 5LQBL 3L1OH 1ZHLB 1G0XA 1O7VA 4Y19A 1U3HB 2YRLA 4KUCF 1U8KA 4Y4HA 2XZQL 1QLFA 3RUGF 2EDBA 2YC1B 3NZHL 4R0LC 1BF2A 5D1XA 3IETB 4X5LA 2DQDH 5EZIH 2OR7A 1P53A 4XZUB 4MJID 3VWJB 1PSKH 1YEDB 2EIBA 3LIZL 4OKVB 2KH2B 5HHVL 1A5FH 1DANT 3O2WH 4FQQB 2D7PA 2OTWA 1XZ0A 3OQ3B 5D1QD 5C86A 5DT1H 1UXSB 1CDIA 3U1SH 3T2NH 5KTEH 3BZ4B 4ZG1A 3FQNA 1I3GH 5D70L 3PXHA 4A6YL 4MXWH 5AAMA 4IMLB 2V6HA 3BPNB 2ZJSH 3UTZB 4OZGE 1L9MA 1T3FA 4RGMC 2R2HB 3JV4A 4D0DB 4P2OA 4WV1C 4NZDA 1JPFB 2X6MA 1PAMA 1S7WB 3QG6B 5DJ2B 4XT1C 2PYEA 5HHMB 1FVEA 1U8OA 4OT1L 5IR1A 1U8PB 5LVEA 1UWEL 1W0YT 3LRSA 1AXSB 4HS8H 1RZKL 3MLVH 3KPPB 4FG6C 3DUSB 5EUOA 3W9EA 3F7RA 5HHQB 5TH2A 1MCQA 3VRJB 4NC1C 1QPPA 3ARUA 4PB9H 4X4ME 1H3XA 4DKFH 5EO0A 2H32B 1LO2L 1F4YH 5C0AE 1D5IH 4GAGL 4F80A 5CJQH 3QXAB 4JRYA 3H9HA 3L3DB 1QPXA 4NQTA 4OZHA 5FO7A 1OD7A 1U95A 4M1CD 5IQ9B 3OJDB 5D7JD 4W4OA 4ETQB 2D31B 1CBVL 3G6JE 2M1KA 2QHRL 4YAQB 1AO7D 1OCWH 4Y16A 4ONGL 2KBGA 1CGXA 3MSPA 4M61B 1F11A 1TVBB 3MLXL 5IBTH 1OGAB 4O02H 4IJ3C 2FBJL 3FOMB 1YNLH 3SGJC 5HHXH 4QCIA 1JYXA 5DK3A 1AGFB 2XWBB 4KUZL 3LS4H 3WFBL 1JZ8A 4OKDA 3IXAA 4JVPA 1TJHL 4XPHL 4OI7A 2XN9D 4NRYB 4JPIB 4Z7OF 3ULVH 5CBEA 1BVKB 3L7FB 4UDUA 5GJTL 1BQSA 5HJ3B 1A7PL 1N64L 4OZGB 3S3JA 3L3OB 1H3VA 2I07B 3SKUD 1LP9F 3STLB 1BM3L 3KXFA 4GRMB 1ZV5A 2VABA 1CF8L 3F6IA 4ZOEA 3WN5C 1SQ2N 4C56E 1MSPA 1VEMA 4N1HB 2V17H 2L4OA 3FRUB 3VI3E 3CFDB 2PXYC 2BY0A 1VFUA 4X7SH 3ZE2F 4IRJC 1KIPA 1N2RA 3OKMA 4K8RD 4R90L 3OR6A 2YOCA 2VC2L 2NY1D 4XNZC 4KTEL 1I7ZA 3DMMD 2PO6C 4OCSL 1JGDB 5C0AB 4RMVA 4KKBC 2EYTB 2IBZX 5JOFB 3BP6B 4IEFB 2P5WE 2NZ9C 5E8PB 4YHZH 3NAAH 3BKCH 2X40A 3A6OA 4UV4H 5IW6B 5ESAA 4QRQB 2ZKHH 1FSKB 3REVA 5CZKA 3IFOB 4M7ZC 5CCKH 2R56L 3GK8L 4ONOA 4PTUB 5E2JA 4W4NA 1OQXA 2BVPB 4YDJB 5IBLC 3BW9B 4APQB 4Y2DA 4XX1E 4Y8DC 3KPMB 1H0DA 1NBVL 2W9LA 2E9JA 1ZLSL 3TBYB 1SJHA 2IG2H 3KPOA 4GMTH 4HZLB 3MJ7B 3N85L 4JG0L 3WUZA 1U9KA 3STBA 3N1PC 1R3IH 3NABH 3MMEA 1QLFB 3MV9E 1YUHB 3RY6C 1HI6B 1Q72H 4G9FD 1RZ8B 4RGNB 5EOCL 1LMKA 1MHPH 2CR3A 4PGDB 3VDBA 1XZ0B 1HINL 2F19H 4C56B 3AY4A 3RWJB 3SDXE 2XXCB 2KUTA 3WL9A 4WFGD 3HG1E 3B6SA 3VG9B 2DKMA 4HKBA 1U3HD 3CIQA 1BD2E 3AMLA 1IC7L 5DZOA 4QT5A 3QUYA 3UEZA 5F9OH 4BQBA 5DFVC 1RZGA 4M02A 3PGFH 1DLHB 5BO1H 2X4NB 4P2OB 3MNVB 1L0QA 1R3LB 2XA3A 3AFLA 4YGAB 2J4WH 4KI5C 5JW3L 3DIFA 4U6YA 1U8OB 3UPCA 5E08L 3GSUB 4M7KH 4E5XA 2YN5A 2BY3A 4AENA 3ULUH 3LRSB 1DFBL 4DUXA 4NZTL 3W9EB 3BO8A 1K4DA 5TH2B 4KGJA 2VR4A 3TZVC 3ZZ1A 1GC1C 1Q0XL 4G8IA 5L88L 2OBGA 5EO0B 3QXDB 3MRGA 3L3GA 1NLDH 1ZKAA 2HRPL 1E0OB 2FX8L 5I17A 1T1XB 1AP2A 3FJTA 4JRYB 3WXVH 3H9HB 1HE7A 3TBSB 3QHTC 1XF5B 4OZHB 5FO7B 1D5BA 1U95B 1GGBL 5HHMD 1B0WA 4TSBH 3VJ6B 4YX2H 2CK2A 5A3IC 2EE3A 2GYSA 4IIQB 3THML 1AD0B 3I3EA 1ZA6A 3MV9B 1FAIL 5L7XL 4BZYA 2OZ4A 3PL6A 3EAKA 5IW3A 4Y16B 3WD5L 1LDPH 5T1MB 1NAMH 3NA4A 1NMAH 4Y5VB 3MXWH 5FA3A 4QCIB 2B0SL 3BE1L 4NWUL 3VD7A 2LTQB 2VIRB 5FYJE 1KN2H 1U3JA 1GIGL 3SDXB 3B9DA 2X4OA 2K9UA 1CT8A 3IXAB 4PJ7F 3HG1B 5FHBL 5CBEB 1J18A 3GBLA 3NFNA 3VDCA 4NM8L 3GO1L 3OGCA 1E4XH 5JNYA 4X6EA 1KSRA 2EYSA 5EZJA 4FFYH 4NOFA 2VLKD 5L2JA 4OCNC 1JZ6A 1S7TA 3BX7C 1MIMH 4K94L 1OGAD 4K23H 4M03A 4ZOBA 2ZUUA 3KLAB 4DCQA 1IGIL 1N6QL 4WUKL 4U7KA 4BK4A 4FABL 1GGCH 3C6SA 1HXYA 4XVTH 3GIZL 4XP9L 4HFUH 2BJMH 4POUB 1KIPB 1E6JH 3QQ9C 2Q3AA 2E7LA 3BAEL 4OJFH 5KJRH 3QISA 3PP4H 4PLJD 1I7ZB 4F15B 5F88A 1XR8A 2ICWJ 2UUDH 5GGRB 1S7QA 3DO3A 3Q1SL 4U1MA 3T3PE 2W9DL 5GS1A 1E6OH 4LLUB 2R1YB 3C6LC 3MV8D 5KW9H 3REVB 1DEEA 1OAZL 2FHCA 3VRLF 1INEH 2VLME 4HV8A 3KJ6H 4OUOA 4Y2DB 2KPNA 3P30L 3MJ6A 5C0BE 1OW0C 1H0DB 2Q6WB 2F15A 4JFHE 4UQ2B 4X6BB 4HUWB 4ZTPH 5C0AD 3WIFB 3U4EA 5B39A 4ZS6D 5GGTH 5D2LA 3P9MB 4NO0A 1T80A 3KPSE 1CL7I 1CR9H 4XVJL 1XGYL 5BJTA 2X7LA 4Z5RA 5HDBF 3QHFL 3PHOB 1ZA3A 2WWKO 4N9OB 4ZTOH 1X7QB 1CE1H 5GRUL 4UT9L 4I9WE 4DGIH 1OGTB 4RCAA 3RWHB 1NCBL 3D39D 4U6HA 4CVXB 5F1IB 1K4CA 4ZSOA 2NY3C 4JFXA 4APQD 2I27N 1NMCC 2BERA 4HWEL 4J4PC 2Q76B 1X5GA 5T1DH 2E7HA 1FZOB 2VUOA 3FB7B 4H20L 4Y4KA 2ZUWA 3BUTA 4M4RA 3GDBA 1RK0A 4Y19D 3FHQA 4HKBB 1IAOA 1YA5A 4Y4HD 1AY1H 3NH7L 1F02I 1M7XA 1YPZF 4QT5B 1EH9A 4MB3A 3BISA 3OKKA 5D1XD 3ZKNC 3CVHH 3VFMB 2IJ0C 3BP4B 3IU3A 3DLQR 1TZGH 4POYA 1PQZA 3K2MC 3DJ9A 3ULVC 2GJJA 2ED7A 3E3QE 2LFGA 3T1FA 4RGND 4BFGA 3QQ4A 4U6YB 3T65A 3ZHKA 4E5XB 5CSZA 2VH5H 4AENB 2APXA 1LD9A 3OV6A 4NO5A 4HMDA 1PY9A 1RY7B 3RZCA 3C5ZB 5BOPA 1F8TH 2E6QA 1DSFH 4FQCL 5DGRA 3MRGB 2FX9H 5HY9B 2BSSA 4X9GA 1AP2B 4QHNA 2R39A 1L0XA 4GG6F 4P2OD 5EOCJ 4J2XA 4M6MH 4PJXA 2EC9U 1D5BB 2PYED 1IC4L 4PRIE 1KPVB 3KPSB 3MQIA 5TE6L 4EVNA 3MLZL 3KYAA 2G60H 2GK0A 2VDNH 4UIMA 5IGXL 1YNTA 2R0ZL 1YDPA 3U30B 3WJJA 4OIIH 1MJ8H 3IJSA 5DO2D 5KSUA 5FA3B 1FE8L 4MNQA 4IDJL 2DTSA 4EN3A 4LARL 1RJZA 3G6AA 4YLQT 1ZSDB 5TE7L 1W72B 4JRYD 1CT8B 5IFHL 4M8QA 1UADC 1LO3L 4XAKE 1T04A 1JUFA 4O51B 1Y6KR 2ADIB 3QAZB 4OQTA 5JNYB 4X6EB 3OKYA 2EYSB 2FHBA 4LLWA 4OFIA 5EZJB 2GSGA 3TT3L 3JWOH 3R8BB 3RIAF 3T3ME 3V6FA 4PY8J 4Y16D 7FABL 1I85A 1DLFH 3HE6A 2NXYD 4H5SB 1S7TB 3OB0K 3SDDA 3MRHA 2QQKH 4DCQB 3SDAB 3U0TB 3C6SB 1HXYB 2FIRT 4Q9CA 4MJ2A 3B9KA 3DWTA 4LOUD 1T1ZA 5E9DA 4CDGC 4Z9KB 1VFAB 4HJGA 1I8LA 4XMPL 1T2QH 2XZAH 5E1AA 2F53A 4MQXC 4IRSA 4YEFA 1V8HA 5FGBA 5GS3A 2G9HB 4M9OA 5KS9F 3QIBA 5HYJE 3O6LH 4JO1H 5SV4A 2VXSH 3SDCB 5KVMC 3KXFD 5MI0B 5GS1B 1NLBL 3ALWA 5CBAA 3JSSA 1FGNL 4C4KO 2AQ1A 1IGTA 5ANMA 3FO9A 3WV0A 3V5KA 1VKXA 3KPQA 5DJXB 1N4XH 5K9KA 1DEEB 1SY6H 2FB4H 2YD7A 4J1UA 4UT6H 4ZD3H 3Q3GB 1EBPA 1KB9K 5E56A 3CDCA 1DN0A 2JELL 4Y7MA 3RDTA 2FJGA 4BSWB 3ULUC 3T77B 5D9SB 1IEBA 1XF1A 2UWEE 3G5XB 3HNTL 2BSTA 3OHXA 3CX2A 2V5TA 3VGFA 1OP3K 4Y89A 3U4EB 4AMKH 3SGDH 5D2LB 5IUSA 3IJYA 5DXWA 1UM6H 4QKXB 4NBXB 3OXSB 4ZUSA 3QZWB 4UOW0 3KDMB 1WIUA 3QSKB 4JFFA 2X7LB 1D6VH 4GSDH 1T83C 3IRPX 5AAWA 1T1YB 2ARJA 5GGQL 3IFNL 2H3NA 3A6BH 4JFXB 4YHOH 4B7LA 4BQCA 3F58L 5CEZL 3IVKB 4Y2DD 5EC2A 4WCYL 4KJYA 1EEZA 4H25A 5FCUL 4Y5YC 1GGIL 1S5IL 1RPQA 3RA7H 3QDGA 5DMIH 1Z5LB 1BQLL 2IADB 4TUJA 3BPOC 3Q6FB 1CICC 2DKSA 3N1MC 2XV6B 3MUZ1 2UV3A 4UAOC 5F71A 3WXWH 1S9VA 1WWWX 4N8CH 5B39G 3SJVA 3DETC 3VMOA 3T0BA 1UZ6F 43CAA 5I1JH 4JQXA 4E9LA 2J3SA 1ZHBA 2YWYA 1LD9B 1JFQH 5JZ7D 4M5ZH 5MEQA 1FO0A 2WIMA 2Y4SA 4FA8A 1UA6L 4S0SD 1O7SA 2MPAL 3SE9H 1PG7W 2Z92A 3KGRA 3RTQB 1D3CA 3QUYD 3QIWA 3EO9H 1RUQL 4KMLB 2UWEB 4RQQB 1P5UA 1ES0A 2ZPKL 1AHWB 3UC0L 1OL0A 2RFXB 3QUMA 4MB5A 1CQYA 5A2LH 7CGTA 5T1LB 3ZKXC 2FH6A 4OZFB 3UTSE 2MQCA 2W60B 3TV3H 3TO4B 4EVNB 3VMPA 3LQAH 4XH2B 4YHYC 1KCRL 4XP5L 5C0JA 1JK8B 4UZGA 2HKHL 1CVRA 2AJXH 1YNTB 1LK2B 1JNLL 4KQ4H 5INCA 3PV6B 4M43H 1NFIA 5BXFA 5CLWA 2ZCLL 5HYQA 5KSUB 5LJYH 1E4KA 3LEYH 3VDAA 5HYIA 2PTTA 3V7AG 4JFHD 2EIZA 5F7YC 1RJZB 2AABL 4PGCA 3ZDYF 5J12B 2F5BH 4QRUA 2PYFB 2HT2D 2D7QA 2HFGH 4LVHC 3GSRB 1M4KA 3PHQA 5LG1A 4XI5C 4D8PA 3T0VA 2OM5A 4R96A 4LK4A 1P1ZB 2HFEB 3ZE1E 4LLWB 4PRBA 5F8RC 4XCCH 2BSRA 1FGVH 4M7LL 4HUXA 4I9WD 4WO4B 3TT1H 4MA1B 1D6EB 1TFHA 3MRHB 5HHOA 1DQTA 1KN4H 2EE6A 3BDXA 5DLML 2CR6A 1WWCA 4J6RL 3B9KB 5T3ZH 3ABZA 2ICEA 1AD9A 3BVNA 1D5XA 4LFHG 4P99A 5E1AB 4QXTA 5FEBA 1KEGL 3W9DA 4HIEB 4WEUD 4KI5F 3RX8A 1N5YH 4NZUL 1FFNA 1CTOA 3QWQB 2O5YL 2R9HD 3QIBB 5I6XB 1GGUA 5DC0A 1MAMH 2QKIA 2OCFD 4OV6F 2NXZB 2OX5A 4G8GE 1S9YA 3UTSB 3HE7C 5HGAA 3FO9B 2E5EA 5E8DL 4TQEL 3I2CL 5K9KB 4GRWB 4L8SB 1IILE 4GKNA 4J1UB 4Z95L 3HMWL 4Y5XC 4KWUA 1IEBB 3BZFA 4JQIH 1YN7A 3ESUF 1L7TL 3DSFL 2WBJC 3EYQD 1RHFA 1JPST 5J8OA 2IQ9H 2R4SH 4IHOA 3LSOA 2VDRL 32C2A 3NA9H 1A3LL 1JV5A 3MNZB 2VXTL 2HMIC 3M8OH 3EOAA 2O5ZL 2ATPA 3KHOA 5DUBB 2NY7H 1M7DB 1PG7H 5DMGD 1I9EA 2FZ3B 3RUGE 5IHUH 3BIKA 5EU7C 2V5MA 1X5IA 2VQTA 1UH2A 5DDHA 1XIWA 4H25B 3EJYD 1UWGH 5FOBB 4NO3A 1YQVH 4A6YB 3EYFA 1LP9A 4XCEA 2C1OA 4JHWH 4TNWK 5F96L 3T0EA 4XBGB 5HDOA 3M07A 3B9AA 3QEQA 2E7CA 2R4RL 2XA8L 1T5XA 3F65A 1S9VB 1H3PL 2JJVA 1QFWH 2CGRL 2DBLH 4WHDA 4XP1H 1K8IA 43CAB 3MRMB 2D0HA 3JWOC 4LSDA 3G6DL 3QPQC 3AROA 1B2WL 2GITA 1TVDA 1Z0NA 1P7QA 3OZ9L 4LKXB 4Y4KD 3QI9C 2A73A 4WI2A 3WNMA 4Z7UF 5LCVL 2Z92B 3TBWA 2Z31B 2GTWA 4WTXA 1NCDH 3BWUC 4FN0A 4KQ3H 5JOEA 1ES0B 2HA1A 3TP4A 4JZJA 2XTJE 3QUMB 4MQ7B 1GC1L 3EJJX 1MJ7H 3RJDA 4DVRL 3MRQA 4ODUB 5FDYA 3DO7A 3C2AL 3SQBA 2WQ8A 1I1YA 3Q6GL 1HIML 4H0IA 3WFEH 4U05A 5IROC 2MKLC 3F12B 4HPYH 5KN5A 2VL4A 3LH2L 3GGWA 5GZNC 2ICWB 3RZCD 1FDLL 1UFUA 1H3TA 1VADA 4OZ4B 2FJFA 5GJSH 2X09A 5INCB 3P40A 4YBLC 1NFIB 5DJCB 5BXFB 3FN3A 1OTTC 3RUGB 5HYQB 4F58H 4L9LB 4LRNL 5HD8D 4R4BB 1H5BA 2FATL 4QRUB 5T1LD 1ZVHA 3PHQB 3ROOA 2DMBA 3ARXA 4HGMA 4D8PB 1BX2B 4HULB 2ZUXA 4R96B 2ZUTA 4XNXL 1V7NL 5IHZA 2K7QA 5IWLA 5DWUH 2MQ0A 3UZVB 1XGQA 2HTKC 3C08H 1JF5A 5GSRB 2DYPA 3EO0A 4G6JH 3HPLB 4MNQD 4XP4H 4PJHF 1EHXA 1DDHA 4EN3D 2DQDL 1MWAH 4RX4D 4EKXA 3BVNB 3DVIA 2NY2C 3ULVF 2YS4A 2FLRT 5DD6B 3V4UH 4PRHA 5D7IE 4QXTB 3MLUL 4OLUH 1HCFX 5IMOA 5EU6E 1E4WH 1WBYA 4ZUVB 2UYLA 1U8IA 5A40E 3CD4A 3SE4C 4YDKH 5EU5A 3ZE2E 1GPOL 1YN6A 1AGBB 3TPKA 5BS0E 1F4WL 2AJ3B 4CAGA 3HE6D 1DQML 3RL1B 3SDDD 4HKJB 1S9YB 2BVOB 5AWNL 3ARQA 2QR0A 5HGAB 1VEOA 2WIIA 1U8HA 3X13A 4NBYB 4EUPB 1FZJB 3B9KD 3FOLB 3ZHLA 2MHAA 5E9DD 4GKNB 2W0PA 3D9AL 3FN9A 3RVUC 3V4VH 1RJLB 3BZFB 5DJZA 1YN7B 1GZPA 4IRSD 3O8XA 2AJZB 3MBEB 4OIAA 3QIBD 2NTSP 3WFDH 4MZ3A 4MDJB 1RZ7L 3L9RB 2NXZD 1KENL 1OP9A 32C2B 4X8JA 2HH0H 1QBLH 2A6IA 4JPWH 1JRHI 1JV5B 5E5MA 2B4CL 4KHXL 4PB9L 1LDSA 4HIHB 2PW2A 5HI5C 3CXDL 2R15A 1JE6A 3LQAC 2XWJB 4Z0BL 3RDTD 1KPUA 4OUUA 4PJ7A 2FO1A 4X7TA 4BUGA 3BQUA 1JNHA 3BIKB 4ESKA 3BESR 5IOPA 5DDHB 1R5VA 1MFDL 5IEHA 1OB1A 4QNPE 4Q0XH 4NO3B 3MOAL 3OKDA 1QYGL 5E95B 5AZ2L 3MPCA 1OCWL 1R5IA 1T66D 4XCEB 3T0EB 1PGRB 4R7DB 5CS7A 1NAKH 1UB5A 3SN6N 3FB5A 4JFFD 5DQJA 4O02L 3DTXA 5D7IB 1IAIH 3HI6H 3QEQB 1MCOH 2ZOKA 4JFOA 5MENA 2AJYL 1IL1A 1J1OH 1NC4B 3FKUS 1JZ3A 1KXTB 5DZLA 1XH3B 4HFWB 1K8IB 2CLRB 4GRLC 5BS0B 2OI9B 2UY6A 5I2IA 1CTNA 1RU9L 2I26N 4XRCA 1YEKH 1A6VH 1Z3GH 3KLHC 2GITB 5A2JH 2B7DT 2VDKH 3WFCL 1P4BH 1N3NA 4Z8FH 4YO0A 5J9PA 4P5KA 3HFMH 3ARDC 3QDGD 1A6ZB 4ZAKC 3TBWB 5EFIB 4Q6IC 1NFDF 1ZTXH 2V17L 4RBPK 1NKOA 5BMFL 5GXBB 1OM3H 2V5SA 1DE4A 2EDLA 4E41E 5C0DA 4KROB 3L3KA 1D5MA 5BQ7A 2DQTL 2PW1A 3SJVD 3EHBC 5F9WC 1BGXL 2BDNH 1N7ML 1QFPA 2IEPA 1I1YB 3FQTA 3ULUF 4PG2A 1ERNA 1VHPA 4OSUH 4G7VH 4LCIL 5E5RB 3CDGA 2P8PA 3F8UB 4TVPL 1F4XL 5ESVB 4YHZL 3QIWD 3NAAL 1DQJA 3BKCL 1S5HB 2ZKHL 1WZMA 1IAMA 3VFSB 4O58L 1SYVB 3S37H 3ROOB 4TPRL 2YD2A 4WWKC 3NOIA 3O4LA 1MCJA 4HWNA 3D1MC 1HSBB 2ZCHL 1I8IB 2QEJA 3LMJL 1U3ZA 1VENA 5IHZB 4C59B 4LSUL 3IRZA 4GMTL 4RFOH 1TETH 1XGQB 4S1RL 3AM8C 4QY8A 3GSOB 2NYYC 5D2NC 4XMLL 4B41A 1J0HA 3NABL 2MJWA 1TQBC 2DLHA 1YPZA 5AYUH 5IBUB 1P7HL 1A9EA 1HYSD 1QA9A 1A7BA 1KYOK 3BKYH 5E99H 3RY5A 1G7MA 3FT3B 3GMRB 2Y07H 3NN8B 4WY7L 5KG9B 5MENE 2W92A 5HVHB 5T3XH 1U8IB 4PD4K 5IF0A 3BKJH 4ORZC 5ADOL 2ZSWB 1SEQH 4FFWC 1YN6B 3T0WA 4E41B 2HFFA 1ZAGA 2VZSA 4Y8AA 3ULSB 3I9GL 5C09E 5HHOD 3ZTNL 2V2WA 3EYUL 2RCSH 4XC1H 4MVBD 2WIIB 2E9IA 4RAVA 3VXUE 3DARA 2ENYA 4LSTH 1T1WB 2GFBA 4XCYA 1FC2D 5J1TC 1YEEH 5BO1L 4AQOA 4GG6A 4OCRL 2NNAA 4IOSD 4P57B 4KK5C 3ARYA 3EOYG 5DJZB 5IVOA 1GZPB 5EC1A 4M7KL 3H3PH 5IBUG 2OR9H 3W11D 3WLBA 2X9XA 1NGYA 5TQ2L 4LSQL 2XG5A 4YDLC 4X8JB 4YXKH 2A6IB 3MLWL 1YZZA 3DX9A 4ZUWA 1AE6L 4R0LA 2E3VA 4NKOA 4WI9A 1NLDL 2PW2B 3W2DL 4FXLA 1NKRA 5EORH 4OUUB 2JTDA 5IV2B 4NJAH 1YY9C 5GISH 2GW5A 4ODXB 4TSBL 5HDBE 1R5VB 4GKZA 5IEHB 25C8H 2NY0C 2AK1H 1LO0H 1NANH 4RA3A 2QLVB 1DVFB 3O41B 1AC6A 3BEWA 4YHLL 4JFPA 3DTXB 4QHLA 5GHWL 2J8OA 3N9GH 5MENB 1KJ3H 1IL1B 2D9QB 4M62H 4YC2C 1QNZH 2EZ0C 2P44B 3KWWA 2BHZA 5E0QA 3CLEL 5KBNC 2AEQH 4WV1A 1IM9A 4G6ML 2XKUA 5E00A 4QWWC 1CD0A 1XIWD 3RVVC 1AI1H 3RWGA 1PD6A 1NUNB 2YBRA 3PJSA 3P4MA 2C7UA 1K8DA 4LLVA 3TYGL 5J9PB 4MA3B 4Z7VF 3F7YA 5FYLH 1UVQA 3T0ED 4JEGB 4D0CA 5MHSD 3U4BL 1KG0B 3BGMA 3QEQD 4MNHB 3G5VB 2C1PA 3TIDB 4LLQA 1RIUL 1JPGA 4U1IA 5D7SL 3LV3B 3BYYA 1BBDH 1MLBA 1WICA 5BS0D 1E28B 2V2TA 3FQTB 4AM0A 1E6JL 3GBML 4EZMA 3P4LA 2FEEL 4N0FA 3FZUC 4AYFA 5ALCL 4B0MM 3HRPA 1ZS8A 4GG6E 2X1PA 5IFJA 5F7HA 3MODL 1A7RL 3O6MH 3CDGB 4YNYA 3MRBA 2OL3H 4M9PA 4MJ5A 3X3FL 1DQJB 2GIYA 3OAZH 3RPIA 5T5NF 3RQ3A 5KW9L 3SGJA 1FBIH 2Z9TA 2VO5A 4QF1A 4N5ED 4W6YB 3GSNL 1RMFL 3M1BB 3MLTB 2CRYA 4KKLD 2DI8A 1OOAA 2CRZA 3QDJA 5LGJB 1C1EH 4P3CH 4HJJH 1FZMA 5JDJA 1LWRA 5D96C 4PB0H 5CEZE 3BRDA 4LSPL 5IK3B 4C83A 4QY8B 4I5BA 4ZXBB 1CGWA 4I18C 2HP4A 4L8CB 1WZLA 4ZS7L 3CAFA 3RPKA 3R1GH 2BHUA 1J0YA 5HDQH 3WN5A 4LVOB 1A9EB 2MKWA 1NMBH 2YA1A 1QA9B 5DEFB 3HC3H 3DRQA 4PJEF 3X12A 3B5HA 3GMPA 5DVMA 1EGJA 2DJ4A 4DAGH 1Y6NR 2PXYA 4MLSA 4GAFB 4ERSL 4U0RC 4UT7L 4U1LA 2Y25A 2FR4B 4IRJA 1NEUA 5C6TL 5HPMA 2DL9A 1CFSB 2ORBH 4LAJH 5E4EB 2E6PA 2CO7B 2R1XB 3FFCA 3SCMB 2C4FT 5DR5L 3GJFA 4UBDC 2HFFB 1U2CA 2PO6A 3EFFA 4MXVE 4NHCL 5CHNB 2X70A 1RQ5A 4NKMB 1MNUL 5KAQF 2GQHA 2QSCL 1QR4A 5HGDA 2CQVA 3IT8D 4LLYA 4RAVB 3RKDC 4D0BA 3CVHL 2AKRA 1AR2A 4KY1H 5KS9E 4X9FA 1F90H 4RIRB 5HHPA 1HHKA 4GG6B 3QHZH 4U3XA 3HZVA 1GH7A 1TLKA 3L3HA 1GRWA 4TSCH 1XF4A 2DTML 1C08B 3RVXC 3V5HA 1FPTL 1KPRB 1NGYB 2ADJA 4WENB 2R69H 4HUUB 5F89B 1N59A 4FQLH 1JBJA 2AP2A 4P48A 3DX9B 4Z7NF 3C8HA 4NKOB 4OBSA 4LPTA 4BFEA 1QKZL 3P73B 3QRFM 1KXVC 3GHEL 4MS8D 3RY6A 4J3VA 3IGAA 3V5DB 1NPUA 4TTDD 3Q5OA 1NGPL 4DN3L 5JO5A 3O8XD 2HWZH 4BM7A 4JZOA 1WSST 2C26A 1G7HB 5F1SA 2DKUA 5K59E 4QTIL 4JPKL 5GGRY 3ES6B 3ISWA 4MCYA 4JFPB 4OIIL 2EDJA 1YMME 4JO3H 4GG8B 4P2CG 1T2JA 5F72S 3CU7A 4L4TE 1ND0B 3QB7C 1QD0A 5HYSB 1CK0H 1XCQA 3KWWB 3V8CA 4OFYD 4WV1B 4HT1H 1IM9B 4OIBA 4G3YL 1EV2E 5E00B 4NJ9H 1QSEA 2Z4QA 5FYKU 1EK3A 3ZL4L 2I25N 3ZKMD 2BVEA 2C7UB 3PWPA 1K8DB 1DVFD 3GMMB 3JWOL 4LLVB 4M93C 2LU7A 1S7RB 1UVQB 4N0UA 1UZ6E 1DLFL 4D0CB 5L9DL 3FFDA 1X4XA 4BH8A 1JJUA 3HC4H 1X6LA 1BFTA 4MXQC 3TZVA 1MCWW 4UTBL 3UYPA 5MEND 3EGSB 5T1KA 2DI9A 4L4VA 4ODWA 1OARL 2D4FA 3PUCA 4YZFF 3U7YH 2DDQH 3VFUA 5HDLA 3GHBH 4I3RH 5ILTL 2YD6A 5I0DA 4Y4FB 2CXGA 1G9MH 5EOQL 2VXSL 3W81A 3MGTB 5GRJL 3U9PH 1P2CA 4N9GB 3MRBB 2DQGH 3DUHA 4W81A 1BFVH 4TUKH 5E2WL 4J8RA 4HSQA 3D48R 3AREC 3RPIB 3IFLL 4LIQH 5DTFA 1N4XL 4HIIB 3U36A 1JHKH 1M7IB 2KQNA 1PZUB 1ETZA 4ZD3L 4DGVH 4G6FB 3CLFH 2P42B 1TCRA 2VR9A 3LKNA 1W0WB 1SBBA 2BRRH 3TJEH 3I6GA 1T03H 1XMWA 4OZIF 3MA9L 4RFNB 3CFBA 3PIQA 3RAJH 1AIFA 2OP4H 4ZNEE 4L4TB 15C8L 2VXUL 1L6ZA 4AQ1B 1CCZA 4C83B 4I5BB 5ETUA 3U4AA 4CW1B 4F9LC 4LQFH 3MRIB 1S7XA 5JPNB 3L95A 4OM0L 3OSKA 3DRQB 3GMPB 4HIXH 2PXYB 4J3XA 4F57L 4KDVA 1UCBH 4X5WA 4HIJA 5HPMB 4PREB 3NPZB 3JUYA 1JHLH 5F9AC 3FFCB 1PJ9A 3EJZC 5JLZA 5CFHA 1BMGA 1U91B 4P46C 4LCYB 4XNZB 1GXEA 4YPGB 3W5MA 3EFFB 3MJ8B 3EOBB 5GS0D 4ZXBD 4WFFE 1A1OA 4OCXH 4Z7UA 5A43C 4XGZA 4KI5E 4WUUE 3IDGA 1F6LL 2AKRB 1CI5A 1MRFL 3C6LA 1ZVSA 2ZP0T 3TBTA 2GT9B 3AB0B 2NLJA 3VCLA 5F21B 1BOGA 3L3HB 5JHLL 4YE4L 1UG9A 4D9QE 5I1JL 1M1SA 3RVTC 1MJJA 4JG1L 3SCMD 4W6WB 3GKWL 1OW0A 2I5YL 4CUCA 3GFUA 1J8KA 1YEGL 2JKXA 3GBNH 1PX4A 5DRWA 4LEXH 3G5ZB 2ZWLT 4N8PA 2CIKA 4XPTH 5F6HI 3EO9L 3WEXB 3F6LA 4P2RE 4UILL 1JYNA 5EBGA 2PR4L 4U3HA 3DHJA 4JFYA 2Q8AH 3S34H 4F2MA 1F3DH 2ADFL 1CU4H 5D71H 3TV3L 4XPBL 4MCZA 1C7TA 1NCWL 3NPSC 5JO5B 4J4PA 1B0RA 4DGYL 3ARFB 1AFVH 4ZNCD 2DQHL 3GIVA 3MRPA 4NQSB 1TTGA 4ORGA 1T20A 4S10A 2YPVH 4MCYB 5B3JF 4FP8H 3IDIB 5JDSA 4PG9A 1CLZL 1M6OA 3WHXB 5I8CB 1OWRM 2EC8A 3FQRB 3O6FC 4JKKA 2HFGL 2R0KH 5IJVA 8FABB 5I1GL 1ZWIA 4ZFZB 3VD3A 1MAJA 1FFOB 3JWDH 4P9HH 1IKFL 1QSEB 2Z4QB 4JO2L 4IOFD 1W8OA 3OXRA 1A8JH 5HI3C 4JY6A 3PWPB 1IGCL 4UV7L 5TFSH 5IJKC 2UY7A 5KSAC 3FFDB 4AEIH 2DMCA 5FF6A 1U6AH 4BH8B 3K3QA 1MFBL 1T0PB 3TZVB 3HNVH 1MLCB 3GEWB 5T1KB 4XAWL 5FECA 3LKOA 5HYEA 2P7TA 3OAUH 5ADPH 1IM9D 4BQ8A 1IT9L 4DQOH 2JB6A 3HNSH 2I9TB 1U36A 3VFUB 1JGVL 3VGAB 3MC0A 2V5YA 5E8OA 1KB5H 3LD8B 1TVHA 4AIXA 3BN3B 4FG6D 1P2CB 3W0WE 2EDYA 1CGUA 1NCCH 4K3GA 1QLEL 4J8RB 1FNAA 3DOSA 2BOCA 2VZ1A 5DTFB 3NCYS 3U36B 2BNRE 3BRGC 2CKBH 4JB9L 5FYKH 3QULA 1TCRB 5ID1A 1Y0LA 5DQ9A 4U1KB 4DVBB 1AIFB 2P49B 3D18A 5ETUB 2B5IB 2K3TA 2X4SA 3QG7H 3MV11 4HQQH 3GM8A 3NA9L 4LDEB 5F3BB 1S7XB 3L95B 4NNPH 1ZE3C 4XHQA 4UDTA 4ZUUA 3DV4B 4YDVA 5DD5L 5C0IA 2ICES 3FQXB 1HNFA 4X5WB 4HIJB 4AEHL 1RUPL 1BJ1H 1XGRB 3CX5K 3QDJD 4PJHE 1WBXA 3BH8B 4L3EE 5C3TA 4QXGL 3NCEB 3HPJA 2GTZA 5FHAH 5IMLA 5IT2H 3ZYJA 4IBLT 3NTCL 1C5CH 1H8SA 5JHDA 1KBGH 4S2SB 2EICA 4JANB 4PUBH 4JHWL 4HUKB 1FLRH 4Z7UB 2A0LC 1UB6A 1MCPH 1NFDA 2BNQE 4XVUC 4YWGL 5I1IL 1WZKA 4GUPB 2HRLA 4O2FA 2PXYD 1X5XA 1QFWL 4PJGA 3VCLB 2MOVA 1BOGB 2JK5A 2IWGA 3VXOA 4NRXB 1KTLB 1BIIA 5C08E 5JMOC 1MJJB 3MLSL 3S7GA 3W0WB 3FFCD 4WHTA 3GRWH 3ARPA 4LDLB 1G7LA 3H3KA 2DIAA 5IB1A 3IDMA 2G75B 4MYWB 4OLVL 4I0KA 4KKBD 2CDEA 3H2WA 3BD5A 4LHUA 1AQKH 1NCDL 3P0YL 4L29A 3CSBA 2YHGA 5JR1H 1MCBA 1T83A 4TVPE 5C0CE 4MLIA 4F2MB 1T7ZA 1LEGB 4JFEE 3NFPA 4M3JA 2D7MA 2NY3B 3RWIA 5IBLD 5CUSH 1G9MC 1NMCB 3WDHA 1B0RB 1IEHA 5C2BH 2CLZA 1NAMA 5AG9A 5T5FL 3GIVB 3MRPB 4Y5YA 3WLWC 1T20B 3NCMA 4OLYH 3OJ2C 4R2GC 1YECH 1ED3B 3MO1B 4R3SA 4PG9B 4JY4A 3SE8L 1CICA 2ESVA 4PJHB 5DK2A 3W39A 5EIIA 5JXAH 4L3EB 1C5BH 5KVGH 2VKWA 3EDKA 5IJVB 2AK4A 1A6TA 1ZWIB 4RISH 2EYRA 2DI7A 1ZLVH 4N68A 5JW4M 1OAXH 3ARGC 4I3SL 3KR3H 1R3JA 5SWSA 2BNQB 1ORSB 3OXRB 3ARFD 1X3DA 2IH3A 3MV01 2E9BA 4JY6B 1MEXH 3LS5L 4XMKH 3QFJE 3WIHL 3CH1B 3IS0X 5FF6B 2NY4C 2DS4A 3TC9A 2QSTA 5TPWL 4G6JL 4PJ9C 5ISZA 4RWYL 4NGHH 2XWTA 3JV0A 3B2UC 3JXAA 4QTHA 3LKOB 4HD9A 1C5DB 4JN2A 4JREC 4MNGE 2IANE 3SEPA 2P7TB 4O4YH 3AVEA 4NNYB 5I1DA 4PS4L 2XZCH 4OAWA 2VXQH 1QSED 2JJTC 3RWDB 4KI5D 4L3CA 3IAGC 3PWPD 1IE5A 1J0IA 4RFEA 4U1SA 2XZZA 1NC2B 4ONHB 4TSAH 4NQUA 3UYRH 4JFEB 2IC2A 1N0XL 2W9EH 1EO5A 4D9QD 1PZ5B 3NIFE 3TZVD 4LSSH 5T1KD 2VDQL 3F7VB 1BJ8A 1BVZA 5KSBE 4L4VD 1FCCA 3QRGL 4CMHC 3D25B 5E6ZA 1HWGB 3B5GA 3QEUB 3VA2C 1ZGLP 1NGZB 1IBGL 2FL5B 3DVNA 3GMOA 5A3ID 5GGTA 5M95B 4JJ5B 4KK6D 3ZT5A 4ZFOA 5KOMC 2XOTA 2B39A 2OJZL 4NM4L 4FQJL 3H9SA 1CD8A 2FYYA 4XB7A 4MZ2A 2H1PH 5FKAB 3LKPB 3MR9A 4MSWA 4JPWL 3NACL 4U33A 2HLFC 1I1AC 4NWTH 2P5EA 1I1FB 3MFGB 2P8MA 1CDHA 3L5HA 2UZIL 2EC9T 2YD1A 2D0GA 3CH8A 1WBXB 3QWRA 1WEJH 4GS7C 5F44A 4XTRC 3U2SB 3QUZB 3IDNB 3P11H 3HPJB 2GTZB 1NGXB 1HQRA 5IMLB 4O2EA 2FGWH 1I8MB 4P4RA 3MROB 2IANB 2X4UB 4GXUN 4Z7VA 3BHBB 3K2UH 1MRCH 3CVHA 1KIRB 1UB6B 4G8EA 4ZDHB 4AEFA 1NFDB 1O0VA 3ELAT 3DI2B 3HE7A 4Y2OA 3LRHA 2DICA 1DQQA 4O2FB 4TOYH 5D1ZC 3JWDC 5JOPE 4P9HC 3WIIH 3TWCH 2JK5B 3DXAE 4EEEA 2ED8A 4QO1A 3I6KB 5ACLA 1BIIB 4L8BB 4WDIB 5ISZE 2GSIA 4Y5XA 2Y7QB 4EDWL 1A6VL 1BQUA 3S97C 4GMSL 4CU8A 3CX5J 3QQ9D 4P5MA 4K71B 4I0PB 2WBJA 5KSBB 4LPCA 1B4JL 3HZYA 3IDMB 5DJ0B 5TE4H 5AZEL 1A47A 2CDEB 2W0FB 1FL6B 2ARJQ 3I3BA 4H8WL 1PKQE 4LHUB 1KIQA 1KJ2H 1ZTXL 4L29B 1MRDL 3ETBF 3HUJF 4ZO7A 4NCC2 3C6LD 1K2DA 4LPWA 1D9KC 1SJVA 1R24B 5KOVC 2BDNL 2YPLE 3NFPB 4FTVA 2H2PC 3DI3B 3EOTH 1DUYB 3RWIB 3D85B 5IB3B 2Q3ZA 3OKEB 1HILA 1LO4H 3HC0B 2WWMC 5KVFH 4Y5YB 5E03A 3O9WC 3GNML 1F2XK 4RNRA 2APBA 4NQDA 1F58H 5DI8A 1RVFH 4R3SB 2A1WH 3H7BA 1IEAA 4K7PH 1OAYH 2W07A 3O6KL 1J1PL 4P0DA 5DK2B 3W39B 4FMKA 4UAOB 4K8RH 2OQJB 2WAHA 4PJEA 5INDA 2AK4B 1JI2A 4G6AC 1I9IH 4QRPA 1F45A 2NY3D 3VXSE 4OLEA 1NQBA 3GSWA 4J4PD 2ZUSA 2YD3A 2ICCA 1ACYH 4OLZL 3FO1B 3V7MA 5FM5M 4RFOL 4F3FA 2DD8H 1MY5A 3HI1A 3E2HC 5EUKA 3DXAB 4OI9A 3BKMH 5CMAA 4ZFFB 4O5LH 1FAKT 4TUOA 4KZDL 1AXTH 5ISZB 3INUH 1A21A 3ZKND 4WIQA 5ALBH 1JGUH 4L3ED 2DRUA 2BVYA 2EDDA 4K3EH 1E4XI 2YK1L 3AS2A 3ULVD 2Y07L 3QWOA 4OB5L 4BYHA 3ZKXB 4OGXL 4QHMA 5CLTA 4L9DA 1JWMA 2R23B 3D69B 1PKQB 3CFCL 1BZ7B 2BNQD 3IS1X 2Y72A 5T3XL 3BKJL 3FN0H 5IROA 3CFEB 4JDVA 3UTOA 2VJXA 4EQ3A 5SWZA 5FKPB 1LNUB 3FMGL 4ENEC 5F3HA 3PWJB 2YPLB 5EU4B 3B4NA 2RCSL 2FSEB 1I75A 1SY6A 2QV2A 1BWWA 2EEDA 3GSNB 2X4RA 3DYOA 3EZJB 4OCWH 3VWKC 4F7CA 1YEEL 3PWUA 5EOTB 4P59L 1YEIH 2CH8A 1I7RB 4LVHB 4AY0A 2HN7A 4M48H 3RGVC 1E4JA 4OCYH 4U1NA 5C0GA 3GMOB 3K8MA 2WQRA 1B0GA 5EUOF 2OR9L 3JVGC 2W0LA 4HCRL 1NC2D 4YH6A 5E8EB 3WNOA 2X1OA 3MR9B 4MSWB 3MRDB 3MUHL 1EXUB 2VTFA 1NGQL 1QHOA 3V95A 3V6ZA 1X5KA 3SPVA 4AG4L 1Z9MA 12E8L 4CJ1A 2E8ZA 2D4DA 1QFWM 4KH2A 2B2XL 1XGUB 4YR6A 4JR9L