2MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 37
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg102
4ZTPL 3IU4L 3CU1A 1QYGH 4QKXB 2LU4A 3B9KB 2FL5A 4KK6C 2PYEE 5DXWA 4IOIB 3IDGA 3IFNL 4NC2B 2EXYC 4P4KD 1JFQL 5T33H 1IT9H 1MVFA 3AREA 3L3KA 2IFFL 4O58H 5DMGC 3I6KA 4YR6A 3VXPA 2FHCA 1EHXA 3EYFB 5JXED 4WW2F 1EHAA 4KH2A 4WI6A 4OLVH 1MSPA 1OAZL 1UKQA 1ND0A 1G9MC 5HJ3A 1UT9A 2HKHL 3IAQA 5EZIH 5KZCB 5IQ7H 2X4SA 1RZGA 4OKDA 1IEAB 3H9HA 3EJYC 5GGSA 1AE6L 1KCKA 1MCEA 1PQZA 3HAEB 4I8DA 3BIAX 5L2KA 5GIRB 3WFHB 2AQ2A 4P2RA 2NY6C 4IIQA 2J88H 4KJQC 3F8UB 2AK4D 2WWMC 2C26A 3SE3C 3DYMA 2YEZB 2AK1H 1T1YA 2VLLB 2XWJB 3AROA 1ACYL 4JPKL 4NQCD 2UZIL 4BH8B 3TCXA 4BSJA 4A6YB 2VRAA 2AGJL 5GGUB 2CRMA 3PGCB 2CLZA 4IHOB 5HHVL 5BO1L 3N9GL 4U1HB 3NCEB 2EXWD 4LEXL 1KTKE 3S37X 5DJ2A 2A9MH 3DXAA 3MJ6A 3V0WH 1RVFH 2WK2A 1ZGLP 4N9OB 4JN1H 3R06A 4OZFB 3DVFA 2FR4B 4I5BB 5H2BA 5KVFL 4H8WL 4NN7B 1F6AA 1E4WH 4JFZH 1R3LA 5CILL 3DTXA 4JY5H 4R7DB 3X13A 2LU7A 4ZUVB 4YBQC 4DCQA 4F7MB 4XX1G 3IDNB 2O93L 4QEGA 1RHHA 5DI8A 3LRGA 2PYED 4RMSA 2IQAB 3JUYA 3DURA 3UTTA 2PO6D 1WBXB 3LN9A 4XVUC 2E5EA 1LK3L 3RA7H 3MBXH 1HK6A 3E3QE 3FN9A 4MD5A 4MXQC 2Q87A 1R5WB 2Q8AH 3RWFB 4S1QH 5BVPL 1L9NA 1ZWIA 3QQ3A 5I1AB 1NC2B 2LV4A 1GL4B 1D6EA 1HOCA 1PKOA 1AO7E 4EI5D 2W0KA 5IP4A 4UDTA 3DJ9A 3IFLH 4JFEB 5C07B 1HE7A 4ORZC 2R56L 3FN0L 4L8SC 5E56A 2VUOA 3M45A 3BESR 3QQNA 4N8VB 4HWBA 2CLVB 1MRFL 2XKNA 4FQXC 3KXFB 4DQOL 4CU8A 1LE9A 5FYLL 4XXCC 4X9FA 2CR3A 1KCVH 2VDPH 1CGTA 3GO1L 3MFGB 3I6LE 2DKMA 3V7AG 3UTSB 2CKBA 3SGEI 1SJHB 1MCOH 2HKFH 3CXHK 1AHWA 1BX2A 2W1NA 4ORGA 3FN3A 4X6FB 1JWSB 2BOBB 2NY4D 1KJ2A 2WP3T 4BSVB 1HQ4A 3EBAA 1QRNB 3STZB 5KVDH 1TPXB 1C1EH 1EBAA 4IRSB 5HYJB 5D72H 5DZLA 2NZ9D 4DK6A 3CXHJ 3O2VL 3RGVC 5IBTH 3O3EB 3PE9A 4X80H 3WHXA 4U7MA 4HZLA 2VDOL 3F6IA 3ARYA 5LBSH 1I8LC 4JZOA 3IFOA 3QUXD 2PN5A 5FF6B 3IETB 1EGJA 4KQ4L 1YEIH 3ZKSD 4L8SA 1Q0XH 3SGKC 3EDFA 3BD4A 5CMAA 3GMPA 4L9LA 4HX1A 2AJZB 1Q0YL 1QHPA 3O0RH 4FQXA 1B4RA 3EYVB 4XXCA 4H20L 5GHWL 3UC0L 3GUTB 2IFGA 1T0NA 3C8DA 3DXAE 4V2BA 3GM8A 1INEH 1KTLA 5FKAB 4OTXL 4OM1H 5DVNA 3P4LA 5CFHA 2ZOKA 4HC1L 5LKNA 1JPTH 5CUSH 3FO9A 1AO7D 1NMCB 1WEJL 4GO6B 4JM2D 4KDTC 2XXCB 1DQJB 4WU7B 2R0ZL 1FV1A 1K4DA 3RGVA 2BHUA 4H0GA 4EBQL 4XPBH 2F9BT 4Q2ZA 4WTXA 4RAUB 4PFEA 4M03A 4XVJH 1Z0NA 1HSAB 3ARED 4HUUA 1I8LA 4K3HA 1P7QA 4Y4FB 1MFCH 4MYWB 3KG5A 4D8PA 3H7BA 1PX4A 4LCIL 3I6LD 5ADPH 3ZHDA 3FAXA 2G2RA 4GRLB 2EH8H 3S88L 4E42A 1A8JH 1HHGA 3P4OA 2IMMA 4JY4A 3RX8A 4GAFB 4YE4L 1YJDL 3DX9B 4HSQA 1NGXB 2G9HB 1PG7X 3TVMB 3HC0A 3WNNA 2FGZA 4CJ1A 3GDBA 3BH8A 2HLFD 3IJYA 1G7PB 2FO4B 4PJAA 3WIHL 4R26H 3IDIA 1OP5H 4KDTA 4OLZL 1CLZL 4OZGF 1XF2B 4S11A 4FQCL 4U3HA 2VDNH 5CBAA 1ZT1B 1VEOA 1UM6L 3CMGA 1BD2A 1SM3H 2JCCA 1A6TA 4GW1A 4KK6D 2O26U 4X4XB 4YFLI 3KGRA 3MUY1 1P6AB 1OP3K 1U8QA 2EXYD 4NQSB 2L7UA 3AU1B 1MJUL 4TUOA 5E95B 4NQDB 5TDOB 1ZT4A 4JKWA 4EDWH 3FAWA 3DXAD 3J7HA 5DMGD 2A9NL 1J5OL 4PBVC 5I1EH 1A3LL 1ETZB 2SEBA 3SGDI 4H5SB 1RJLA 4DOHE 1NKOA 2RB8A 3MREA 3WFEL 1LD9B 5IB2B 4ZFZB 5B22A 1S5IL 1J0JA 4GRMA 3OAZH 3HI5L 5EPMB 1T0MB 4K94L 3LEVH 3OKKB 5IKCB 3EJYD 2OL3A 4NFCA 4Y5YC 3FO1A 5I1CH 2DQHH 2W65A 3FTGA 1U8KA 4M1DL 4MAUH 3W9DA 4I3RH 3ULUF 4AEHH 1R0AH 2B20A 4ODBD 1IM9A 1C5BL 2NY6D 4KJQD 3QQ9C 5BQ7A 3DUUA 3TBYA 4ESKA 3DHJA 3EOBA 3KLHC 1NLBL 3EFDH 4JDZB 2VDML 3RZCC 3EKCA 5GGTH 5EOCJ 1NCCH 1MJ7L 3OR7B 3VFUA 3G6JB 1RSFA 5D7IA 3GRWH 4UV7L 4O02L 2OSLA 5CSGA 1SY6L 2VDKH 3GMRB 1QBLH 1TZGH 3QG7L 4G6ML 1V7NH 3U83A 3HE6C 4HHAB 4PJDA 5I1IL 2IPKA 1JRHH 4LPYA 3MLTB 1EHNA 4D0BB 1ITBB 1RURL 1KT2B 3PXHA 3VFPA 2X1WL 4YBQD 3V0AC 2K7QA 5SWSA 2Z8VC 1JCKA 1T6VN 4LSTL 4POZD 2LQRA 3RGHA 3GMLA 1MAMH 1IAII 4J8RA 3EO1A 4ZFOA 2MKLC 2P49B 4XVUD 4GW5B 1EX0A 1RZ8A 2P7TA 2HJLA 4NQVA 5DK2B 4P2OA 43CAA 4HWNA 3WUWB 4PGEB 5T3XH 4MXQD 4OFDA 5TFSH 3QCTL 5SX4I 3RZCA 1FIEA 4U7KA 1KBGL 3BIKA 5K33A 1M7IA 4PJEB 5HGDB 3MRQB 5IV2A 3EFFB 4PJAE 5C0NC 4Y19A 1GXEA 3QEHB 3QPXL 2J8OA 3WO4C 3WLBA 3X3FH 3EDEA 1KJ3L 5ITBH 4B7LA 4XNQB 4FG6C 1BD2E 2JCCE 3G5ZA 4YO0A 3HE6A 3CGTA 1SVZA 5CD5C 3FQWA 4MNHB 3LKQB 3CDGA 4G9FB 3LPFA 5C6TH 4FQXD 1GJIA 1W0VA 3TWCL 3KWWB 3EO0A 4M7ZB 4X6CB 1SYSA 1RPQA 3S37H 4ZFGH 3DROA 2LABA 5IF0A 2R2EB 4N0CC 2BSSA 3BZ4A 3CMOH 3S4SA 3DVNA 4IRJC 1CS6A 3ECBA 4JDTH 1ZVHA 4JRXA 5GISH 3F62A 1IKNA 1YNLL 3SO5A 4HS8L 3RGVD 4POYA 1CT8A 1A7QL 2ZCLH 4GLRI 5F96H 1QEWB 3KYMB 5D6CB 1HKFA 3CLEH 1QKZL 1UWXH 3EAKA 3IJHB 1CFVL 3QCVH 1GGUA 1NJ9B 1P7QD 3VXSE 3MC0A 3V5DA 2IGFH 3LKSA 3PL6B 1S9XA 2UVEA 1CLOL 5J13C 3MLRL 3GSUA 2ZUVA 1ZEAH 4M93B 4UB0H 4ENEC 1BZ9B 5D7IE 4JZJA 3F7QA 5I74C 5ENWB 4O2FA 2R39A 4K71B 3VGDA 5C71A 1EO7A 1MHCA 4WDIB 3O41B 1UYWL 1H0DB 2C1OA 5CEXA 4PGCB 4JN2B 3ZTJH 4PJDE 4HDIA 2F5BH 3V6OC 3NFPA 5CJ5A 4WHTA 2Z92A 4WWKC 2B4CH 1JNHA 2HJFA 4IM8A 5SWSE 1BFVH 2A2QT 5JQHC 1BD2D 4YDVA 1NBYA 5IR1B 1VACA 3TP4A 4MQ7B 5M7QA 1IL1B 4TNWK 4NHUB 1WJ3A 5TQ0L 6CGTA 3K74B 4KMTL 3VH8A 1V7ML 1AD0A 1VCAA 3MRMA 5ESVB 3DARA 1G0YR 4AQ1B 1I9JH 3BKML 1MFBL 1JGUH 1AI1L 3OAYK 4JRWA 1FNSL 5GGSY 3SCMB 4JFDB 1HZHH 3O2DH 4YFEA 4K7PX 1RIHL 3EDDA 4KPHL 3P0YH 3S97C 3MNVB 3QXAA 1IGYA 3ARBA 4Y19E 3BT2L 3RP1A 3MUHL 3WFBH 1NFDA 5EU4A 5I15H 1G0DA 4BJLA 1WBZA 3ALWA 1FJ1A 1YN7A 5I6XC 4WWKA 3DX7A 4QXGH 3VXNA 4R97B 3VXSD 3N1PC 1A6VH 4GQ9H 2Q6WB 4Y4KC 2BRQA 1FCCA 5TE4H 4WJ5A 1FFPA 3OKDB 1TITA 1ZV5A 4Z8FH 3MGTB 2X4PA 5DVOA 3KPPA 2YD2A 3GJEB 4JFPB 1T21A 2R0KL 4O2CB 4XZUA 4LSQH 4RDQG 1RQ5A 4JRXE 3ROOA 4U05A 5ALBL 1UB5B 2HFFA 5TPWH 4NN5B 5IBUB 3TPKA 1TFHA 5HHXL 1AXIB 2HG5A 3BEWB 3DSFL 2Z8RA 1CDIA 4LLVB 5F6HI 1R5IB 1E28A 1IGFL 2X70B 4TUJB 5SWSD 5FV1L 4DUVA 5K9QG 1KN2H 3BAEL 5JO5B 3C6LC 4XBGB 1JWMA 2V5MA 3CH1B 1W2KT 1KCLA 2C3VA 3F12B 2VDQL 3QQ9D 1KCUL 1OWWA 3KLHD 1BZ7B 3V2AR 1AIFB 4Y4KA 2XI9A 5CGYC 5K9JH 3RZCD 2V17L 4HQQL 1U95B 2VC2L 1PVHA 3CFDB 4LGSB 4AEIH 1PG7H 1GYAA 2VL5A 5FO8B 5IIEA 4AK1A 4Y19D 3SDDC 4TSCL 3GSVA 3QAZB 1YEHL 4ZPVB 1K85A 4RISH 5BW7C 4M8QA 4OFPA 12E8L 4CVXA 2FSEA 3HAEG 3HE6D 5FM4A 5CIPH 3GI8H 4H25A 4Z95L 1MF2L 15C8L 1AGEA 1S7VA 5C0BA 3QQ4A 32C2B 4GSDL 5JR1H 3VFGL 3Q6FB 4E0RA 5EN2A 2ICWA 4MS8C 4UDUB 3VXUA 4QXWA 1MI5B 5DS8B 4F9PC 4F7TB 2V5TA 3U48A 3HUJB 4LCWB 5F3HA 4APQA 2BSRB 3DX8B 1NAMH 4JRXD 3ULSA 2DQGL 3OX8B 1NFDE 4JO1L 4P5TB 2ARJQ 4OZFG 1ULVA 2GI7A 5DRZA 3QUKB 3GGWA 3MRHA 4WNQB 4UT7L 2CDFA 1IC4H 4HLZG 3CXDL 3DI3B 3V6OE 5C0ND 3D87B 3SJVE 4Q0XH 5ISZB 5D5MB 3P4MB 4QOKB 1G1YA 5L7XH 4PJAF 3MV7B 5BW7A 4FG6D 2YXFA 3TBWA 3MCKB 5D9SB 4KTYA 4ETYA 1AQKH 1PY4A 4TN9A 3NH7H 4XNYH 2VDRL 4MA3A 3UTZA 3FT2A 2JCCF 1RU9L 4ODVH 2GTWA 2H6PB 3EYQC 4R2GB 2GAZB 1V3JA 5HGHB 5K9QI 1GPOL 4UQ3B 4RZCA 3R8QA 4P9HC 3E6FB 3KPQB 1FN4A 5B8CB 4N0CD 4F9PA 3RKDC 3ILQC 4K2UH 2R69L 4IRJD 3BZEB 1MREL 3AFLA 1F4AA 4UILL 2JLLA 2HVKB 3I50L 4PJIA 1GH7A 5DJ6A 5HDLA 1Y6MR 3FL7A 3CUPB 4TULL 1DR9A 1RFDL 3H7LA 3BKYL 1UWGH 5EC2B 3VXMA 4CKVX 3P2TA 4KRMB 1CBVH 5TE7L 2P5EB 2OK0H 1CXHA 5I0DA 4FFYH 1IAOA 4Y7MA 1FGNH 2H32A 4DVBA 1MHPH 3VFOB 4GAJL 1IC5H 4ZO9A 2NXZC 4G8EB 4MMXC 1C5DA 5E1AA 2BNQA 3K7UA 1JGVL 4ENED 3BE1H 1JHTA 1I4FA 1ORQB 2ZKHL 2WM0A 4JR9L 4XPGL 2KZ1B 3ZDXE 1RI8A 4HKJB 4Y5XA 5FUOL 1F2XK 2EC9U 2Q7YA 4J2XA 5D7IF 2IG2L 1KPRA 3HG1A 2X4UA 3QJFA 2X1QA 4X5WB 4Y89A 1UWEH 5IOPB 2EKSB 4FFZH 2A6JB 3SJVD 1S8DA 5C0BE 4WWKD 2E6JA 1A3RL 4PJDF 4K7FB 4XGZA 1P2CB 2BSTA 3V6ZB 4HIJA 3QUMB 1GC1H 1KLGA 3B9EA 5GRVK 2J5LC 4YDIL 3H9SB 4G7VL 4XHJD 3T1FB 1ZVSA 2D03H 4DN4L 2K3TA 1H8NA 2GFBA 5DQJA 3BPOC 1R3HA 3KHQA 4IMKC 4YUEL 4Z7VA 4TTDC 1MFEL 2I24N 1AGBA 4JANA 4FS0A 5JPMA 5DGQA 4Z78B 4OLEA 1TLKA 1SJEB 3BDXA 3BVNB 4IBLT 1XCQA 5GGVL 2QADD 1OP3H 5GS2H 1KN4L 3N1GC 1MCKA 4HJGB 2AXHA 2CXGA 3A6CL 5FECA 1XCTB 1JNLH 4HWUA 3QNZB 1X4YA 1JTOA 1KXVC 3BMWA 4ODWB 1HHIA 4KHXL 4WW1B 3STBA 3CLFH 4ZG1A 3SY0A 3RL2A 5I0ZA 1S7RA 2H8PB 4Y4KD 4OT1H 5BXFA 1KEMH 1OGAA 1ZHNB 3MNWA 1D5BB 3BHBA 3FT3A 3DVGB 2D7NA 3X11B 3HZYB 1QFWL 2ZZUT 4PJ9C 1W72H 2NY7L 4WU5A 2HAZA 1ADQA 2VERN 4MCZB 4IMKA 2DLFL 4NZRH 5FK9A 2IADB 4HIXH 4E41A 2I60H 3VFVA 1MCLA 4OCWH 4WI2A 4JGMA 4OF5A 4EUPB 1A7RH 2XRAL 1GZQA 3OKLB 1JWUA 4G8IB 3QFJA 1MJ8H 1HSBA 4UINL 1LEIA 4G8FB 2FATL 3VXME 5C0BD 3MLXH 3L6FA 4NUJB 4MB5A 5KVEH 1MHEB 2ATKB 2BXZA 1G7JA 3MRDB 4U1MB 1KG0A 4PD4K 3C6LD 1J8KA 2APVA 1CU4L 5E2TH 5I17B 5EU3B 2BNQE 2JJWA 4MJIB 4NJAH 3ILPA 3D2UB 4S1SH 1TVDA 2EDHA 4MA1C 4NQXA 4APQD 2D7QA 1IC1A 1M4KA 3T08A 4DZBA 3LQAL 2G5BA 4PD4J 4R7NB 3JTSA 4K7PH 5CGYD 4DW2L 2RCSL 2E7LC 1RJYA 3J8F7 3TESA 3HG1E 1KUMA 4PS4H 2DQDL 1X9QA 1QLEH 1DBJL 1QLFB 1MCRA 4F57L 5JOPE 4GAYA 3BKCL 1JPGA 1JJUA 3MPCA 5DVLA 1XFPA 4NKIH 4BK4A 2XWBA 1AFVL 3PUCA 1D9KC 4DUWA 4QHUB 3TBSA 3LEXA 4D0DB 3H3KA 5IEHB 1F90H 5E2WH 1WBYB 2YPVH 2DWEB 4O4YL 4MS8D 1QPPA 4Z7VE 5DJYA 4WUKL 1ZKAA 4M5YL 3MRBA 4LRNH 3RI5F 5HYQA 2AV7B 3E6HB 4DKFL 1BVZA 3AXLA 4JKMA 5FA4A 1BQLL 4HWZA 2RBLA 2PW1B 4P57A 4XCNA 2OP4H 4U1KA 4YGVB 1KYOK 4Z7OF 3QUYA 3I2CH 4Q6IC 3IXAA 3P0VL 4AEFA 5I18L 4EXKA 1RMFL 1OAXL 1NFDF 4F33B 3VXMD 2CGRH 3OGCB 4EQ3A 2EIZB 1KYOJ 4U6HA 2D0HA 1T7ZA 5E6YA 1FGVH 5K9OB 3KJ4C 4RAHA 1MLBA 1D9KA 2Q8BL 1EUUA 1N2RB 4KHTL 1L7TH 4PRAB 4OQTH 5CJXC 1A7OL 1HH9A 2I9LA 1EV2E 3VU2A 4LVOB 1EIBA 4AENA 3QWRA 3EYQD 2QQNH 2Z8WC 3D39A 1KNOB 1UVQA 3G04A 1NCDL 3S34H 3WUWG 1I1FA 2QHRL 4XB7A 5JW4Q 3CSGA 4S10A 4P23C 4E41E 3HG1D 4G6FD 5JW4M 3WKNA 1FFOB 3QFJE 2Z4QB 3RKDD 3ILQD 5JOPD 1B3JA 4ZFFB 1N8ZA 3IJSB 3CDYA 3MLZH 1OOAA 1KFAH 4XRCA 4N8CH 1J88A 4QCIA 1MIEH 2HJKA 1C16A 4CMMB 5F9DC 4EI6B 3I75B 4ZUTA 4H88H 1FVEA 1M7DB 3IGAB 1K8DB 1K8IB 3G9VA 2FIKB 2XN9B 3A6OA 1SBSL 1A6ZA 4LLUA 5DMKA 3WIFA 4YHNA 5EZJA 4NT6B 1IGMH 1S3KH 3MLVL 2NXZD 1T5XA 2HVJB 5SWQB 2P5WA 1BBJB 5CJXA 5H35B 3EYSL 1UQSB 4L3CA 2VN7A 1EBPA 1OGTA 4P23A 5K9KB 3ZDXF 4QWWD 2FHFA 4PJ5A 3MJ9A 4RWYL 1U3HB 2FJFB 3KLAA 2DLGA 5JLZB 1G9NH 2CQVA 3OAYH 1CFQA 3BEVB 1HINL 5ACZB 4MAYC 1R5VA 3VRIB 1A7NH 3P77A 3QDGA 3IDJB 1QACA 2VAJA 1NUGA 4L8BB 1J11A 4W4NA 1FE8L 3V4VH 1E4XH 1YPZA 4FP8L 5DD6B 2ESVB 4MCYA 4E41D 2GSIB 4TTDD 4U1GB 1U2HA 3QFJD 2FX8H 4C83A 1FG9C 3OAUL 4PGDB 4Y2DA 1IZJA 2X9YA 2V5SA 3VFSA 3IYLW 4JJHA 4BM7A 1G9ML 1WWWX 4XWGL 4FQJH 1RY7B 4NWTH 1G6RA 4OV5B 1EMTL 2W07A 1I3RB 1X5KA 3HNVH 3H3PL 4HUVA 1X7QB 3V8OA 1L0QA 1UJ3A 4RIRA 2BOCB 3BP5B 4KMQA 4XX1E 1XGYH 4PB0H 3D39E 3EJZD 3NFSL 1A9BA 1QLRB 4HLJA 1JHLH 4MAYA 4OFYD 3L7FA 2R2BB 5EBLB 1V05A 1GGBL 4PJ9D 1EJOH 3THML 5TQ2L 1KGCE 2UWEF 4PRNB 1J8HB 2MPAL 2VXSH 3WE6A 1J1PH 4MA7L 2WW8A 4YQXL 5DFVD 2GJ6A 1Q9LA 2BFVH 2UYLA 4PJIF 3TIEA 5A2FA 3VFMB 4ZNEA 2XY2A 1E0OB 3JWNC 4MSWA 3GSNH 4OGYH 4NZJA 4HWBL 3ZHKA 1C5CL 1WVZA 2XXMB 4J6RH 1OAYH 5KSBB 3VGFA 4X4YA 1UG9A 1N3NA 1T5WA 2AK4B 3VMPA 5AD0A 3HZKA 3O3DB 1FNGA 2P5WE 2CKBL 3INUH 3F7VB 2D7OA 3LDBB 4YC2B 4XC3L 4NQCB 1KC5H 4HIHB 3IRPX 3QO0B 1YECL 3V7AE 2FLBT 1CFTA 1FZKA 4HAGA 4M61A 4HFWB 1P5UA 2AJXH 3MLUH 5EUKB 4YX2L 3VFWA 5I9QC 4KKCC 3HZMA 4PJ5E 3CIQA 1NGWA 3MV8A 4U1IA 5IBUG 1FL5B 1EERB 2F19L 3HS0B 2E6QA 3H0TB 5F93C 4OM0H 3QHFL 1Y0LA 3I6GB 1KJVB 4ZDHA 3CFBA 3UBXB 1D9KD 4YDJA 1RUAH 1XGPB 4XPAL 3OKMA 3QDGE 4LLMB 4X98A 1GGIL 3T4YA 3GHBH 2OXHA 3QWRD 5E8DL 1FP5A 5E5MB 3D39D 4MJ5A 1JUFB 4OZ4B 2OJEA 1KPUA 2PO6B 2EIDA 2NY0B 1YPZE 1D5ZA 1NGPL 1TNNA 3H9ZA 5HTSA 1PW3A 5DEFA 5LGHH 5EFIB 3LIZH 4Z7VF 2PTVA 3FONB 5IROC 3PGFH 1KGCD 2ADIB 5C0FB 2VB5A 5JA9A 1ODAA 2MJWA 1PKQA 4RX4A 5D7SL 1HHHB 1ZSDB 2DTSA 3ME0A 5F3BA 3VRJA 3JWDC 3NIGE 5EG6C 3RY5A 3X17A 3O11A 4NP4L 5F7EL 3VA6A 3ZHLA 5J12C 3CK0H 1A6PA 3QISA 5DJZA 2VDLL 2CKNA 3MOAL 3VDAA 2MFNA 3VE0A 5DDHB 4TUKH 5T5FL 4HLZH 1U58B 1F4WH 1D6VL 3LKRB 3UJJH 4R96B 1OD9A 4YLQT 2P5WD 2DBLH 3ZT6A 1JMXA 2Z0BA 3QZWB 2Z35B 4OFVA 5J1AA 3AGVA 2ZG2A 5E24E 1JF1B 2H45A 3R8BB 2ADGB 4EN3C 3BJLA 5DFTA 3MTRA 3PP4L 4P23D 4DWHA 5JNYA 1MHHB 5CEZE 2GJ6E 5I8KL 1FQ9C 4I3GA 1YQVH 4C4KT 4PJ5D 5KJRL 1BMGA 4NN6C 5CJBA 1ED3A 5GRUH 3QWOB 4ZNEE 3Q6GL 5IROA 5L8JB 3D25B 3TBTA 2QV2A 2PKDA 1I3GL 2OR9L 4XPHH 3FRUA 5HDQH 2N56A 1BBDL 1C12B 4U7SA 4AM0A 1TZHA 2BVPB 3QUXB 4YZFF 3QDGD 3NGBB 5B4MC 4E5XB 1MH5B 3EGSA 3SKJH 1L0XA 3S96A 4PREA 3FO2A 3CX5K 4X6EA 5I76B 2FEEL 4KU1A 1I8MA 3E8UL 3ORJA 4QHLB 2NX5A 1DE4A 3SDYL 4PRHA 4JKLA 4QLRA 3QDAA 4MD0B 2BJMH 4HKBA 4Y2DD 3CX5J 1LEGB 1OAKL 2YD4A 4LAQH 1IARB 5FYJH 1EO8H 3V5HA 1A7PH 4G43B 3EW3B 1WCQA 1YDPB 3V52H 1NCBL 1LO5B 3SQOH 1F00I 4XPFH 4JM2B 1AXTL 3RU8L 3TPUA 5EOQH 5TGBA 1JYWA 3ARTA 3V6FB 5KVGH 1G7HA 1VGKB 4Z5RA 3C9NA 4K9EH 5IK3A 3I85A 4CDGC 3IDGB 3SBWC 1MPAH 4DN3L 1FG2B 1XF5A 3AREB 4MAYD 4OKVB 3L3KB 1MRCL 4EEEA 1KCRL 1WFOA 5JHLL 2EDDA 5JPNB 4JB9L 5DMJB 3RWDB 4YBLC 4FQLL 4RSVA 5F7MC 1N6QH 3W82A 1PKQE 5I1KH 5CEZD 2GJ6D 2XG4A 1FZJA 4UOW0 3ETBF 5D2NA 2Z91A 2YD7A 4G8GE 2JELH 1R3JB 1XF3B 2OCFD 5C6WH 2FB4L 1PQZB 4Y5VC 3TJHD 1S7WB 3LKNA 1FAIL 2ERJB 4GOSA 5LXGH 1NSNH 3BP6A 1X5GA 5ITFB 2HWZL 1I7UB 4HFUL 1DP0A 5E03A 4MNGA 4U1LB 3KJ6H 1G9EA 5I16B 4ZFOL 2EYRB 2Y36L 3SBWA 5F7FA 4ZPTA 3TFKC 3IB4A 5DLMH 2XZZA 5DJ2B 5TDNB 2W9DL 5JW3L 4FZEH 5BZWB 2YZ8A 3DXAB 3C5ZC 4JHAH 4F37F 2Y5EA 4G3YL 4JAMB 3D0LB 3CSYA 3N0PB 1I7RA 1RUPH 3OXRB 3GBNH 2VXVH 3DTXB 3VJ6A 1ZOXA 2YPLE 4KZDL 4NBXB 3RUGA 2VZVA 2PXYC 4JVUA 1F11B 5T5NG 2Z31B 4MNQA 3TC9A 4DCQB 4DUXA 3TT3H 2NW3A 2X4RA 2ZUQC 2VISA 4Y5VA 2EICA 1TQBC 4OB5L 1B0RA 4S1RH 3BDYH 3GMQB 4NDMA 5J06A 3RX7A 1LDPH 3DUSB 1I9EA 2NX5E 5BZDB 3B9KC 2RQ8A 4MD5B 5D7JC 2X7LA 1N7ML 4JCLA 1ZWIB 3RZWA 1NGYA 1CLYH 1FNAA 2VZ1A 4RX4D 1Y6NR 3R0MA 1DL7L 1K5NB 4PUBH 4KKCD 3C5ZA 3GIVB 4PV9A 4G8GD 3HC4L 5FCUL 4FN0A 1IEBB 3UO1H 5DR5L 5DQDH 3V79C 3MSPA 4DZ8A 4FQ2H 3G6DL 2IQ9L 4L3AA 4BH7A 3LMJL 4HT1L 2PXYA 5DUPH 5E8PA 3U82B 3R1GL 1VFUA 4X6BB 3BKJH 5L0QC 1EAPB 1UKSA 5DJXB 1PYWB 3IU4H 5C0AB 5ILTH 2HFGL 4ORGB 4ONFL 1HQRB 4ONGL 1XAUA 3IFNH 3B9KA 1OPGL 1T22B 1F13A 5D2NE 3SOBH 3UPAA 4KGLA 2DIAA 3PHOB 2QEJA 1UFUA 2J7LA 1JE6A 4PYHA 2AS5M 2Q1EA 3KLDA 5HBBA 5HHMB 3WHXB 1JF6A 1UM5L 4N68A 1OAZH 3NTCL 2YPLD 3EYFA 1S9YB 2YA1A 2HKHH 3DRTB 1X5LA 1PSKL 4LFHG 4L8SB 4MNGE 1AE6H 4PTUB 1BJ8A 5IGXL 1IEAA 3KPMB 2QQLL 3U4EB 4OLWL 2C9AA 5E6IB 1QFWM 2NX5D 3HAEA 3NCJL 3QEGL 5GIRA 3WFHA 1P5VA 5CCKH 2ZUWA 1AGCB 5IFAL 1ACYH 1P84K 2UZIH 2YEZA 1XH3B 1RUKL 2VLLA 2XWJA 5BO1H 4AY0A 3N9GH 2CUMA 4BH8A 4LEXH 3RUGE 1BFOB 4A6YA 5EIQA 5GGUA 3PGCA 4FQIL 4IHOA 4U1HA 5A43C 5MHSE 3JVGC 4W6XB 4ELMB 4OZFA 2FR4A 4I5BA 3R4DA 3E2HC 3VFTB 4Z9KB 3Q5TA 4Z7NE 4ODUB 4QNPE 4B41A 4OCLC 3GSXB 4NO2B 4R7DA 1ZXQA 1CDYA 4ZUVA 3UJIL 1EO5A 1V3MA 1SEBB 4F7MA 3IAPA 3IDNA 1JHKL 4R9HA 2AXGA 3QA3B 2MKWA 2A6DB 2IQAA 4Y16B 1BIIA 5ESQB 3BYYA 4IRSC 4GXVH 2IPUG 3A67H 1MFDL 1R5WA 3RWFA 3VA2C 3G5VA 3HE7B 3IDIB 4KUCD 3LSOB 4CN4A 2ADFL 5I1AA 1NC2A 3PXJA 3IFPB 4I3SL 2R56H 3FN0H 3JVGA 3UROR 4G7YH 4JFEA 3BGMB 5FGRA 5F1IB 1U8QB 3KS0J 3EUUA 5GSVB 3BN3B 4P99A 1MRFH 4XAKE 4OD3L 1EUTA 4OF8A 4N8VA 3U9UB 2CLVA 3KXFA 4XMPL 5I1JL 3DYOA 1YQ2A 1U6AL 4GRMB 3UTSA 3TYFB 2AJUL 1FL6A 4JHBA 1SJHA 3QHTC 4X6FA 4RA3A 1JWSA 4BSVA 2AJSL 2UZXB 1QVOB 1QRNA 2RAMA 3STZA 5MHSD 8FABB 1EH9A 4IRSA 1NMCC 3UP1A 5HYJA 3O2VH 5C08B 1LO0L 4S1DC 1U8KB 3CFCL 3QJHB 4N5UA 5F6IC 1T20B 1CZ8L 5GS1B 4ZAKC 2VDOH 5EIVA 3O3EA 3P9MB 3NFNA 3VXSB 5BQ7B 3TBYB 5IJVB 4UNTA 3EOBB 4KQ4H 2CO6B 43C9B 3VG9B 5FF6A 4Y4FC 5JORB 3IETA 3C08L 3T2OA 1KIQA 3OKOA 3PV6A 3TFKD 1YY8A 1WUNT 4GRLC 5HYIA 3BGAA 2OSLB 3C5ZD 1S5HA 2AJZA 5DVMA 5GHWH 4AL8H 3EYVA 5IWLC 3KHOA 3I84A 2VAAB 3W0WB 2C4XA 4OTXH 2EDTA 5LJYH 2DLHA 4PJ8C 4OUUB 3QPQC 4Y1AB 4HC1H 5D8JL 5FKAA 2PXYD 3GMNB 1CXIA 1WEJH 2DQTL 3QRGL 4DKAA 1MFAL 5SWSB 1T7YA 2R4SL 2R0ZH 4Y5YB 3QHZL 4L5FL 1KB5B 3UXFA 3PGDB 2FYYB 2BNRA 3EO1B 4J8RB 4JQIL 1DQJA 1OT1A 4WU7A 4ZFOB 1L0YA 4XVSL 4ZAKA 1A5FL 4MZ2A 4XAKD 4OLXL 2IBZY 3B9KD 2CMRL 1T03L 3CDFA 3ZKNC 4RAUA 4JO4H 4L8CB 4LCIH 3RZCB 4X6DA 3WSQL 3BIKB 4Y4FA 5MERB 2R0LL 4P4RA 1KIUA 1FSKC 2XKSA 4MVBC 4ZOCA 4ZD3L 5KSVB 3S88H 1MVUA 5FO9B 5DZOA 5IV2B 4GRLA 1QSZA 2ENYA 4NNXB 3B8YA 5DHVH 5FHBL 4Y19B 5CKAA 4YE4H 5LCVL 3FO0L 1YJDH 5IWLA 4NHCH 1VA9A 5IB4B 3QYCA 4HXAL 3HE6B 4GG8B 4JFEE 3DX9A 1NGXA 3TVMA 1JZ2A 3B2VH 3WIHH 3VD9A 2ICES 1RZJL 1G7PA 4U1JB 4XBPB 4OLZH 4CVZB 2FO4A 3KXFE 1UM6H 3KPRB 5J9PB 4RGOL 4WHYG 1U93B 2BSSB 3BZ4B 5M94B 3UTSE 4QYOA 3WS6C 1B0GB 1MJUH 4X4XA 3ULVH 4ZUUB 4NQSA 4UBDC 3IDUA 1YEEL 4P9HL 4G5ZL 1QRNE 3AU1A 3GSQB 1A3LH 4NQDA 5TDOA 3TCLB 5IHZA 5HYJE 4C58B 4M7LL 3WFEH 2R4RL 1FDLL 5GJSL 2R1XB 1ETZA 1S5IH 4H5SA 3P11L 1E4JA 3HI5H 5SX5K 3UBXG 5IB2A 4ZFZA 4K94H 1A1NB 3V5DB 3GSRB 1DEDA 1A64A 4KUCF 5EPMA 3ZL4L 1T0MA 5GS0H 1JNJA 3MODL 3GSUB 3OKKA 5IKCA 2YN3A 5F1NB 2X4NB 4N1CA 1KENH 3RQ3A 1B6DA 3D85B 2AEPH 4WHDA 4Z0BL 1CL7L 2YUZA 1LO4L 1YY9C 2VDMH 2C1OB 4ZYKB 1MJ7H 1GIGL 1U8OB 4JDZA 3WS6A 4IRJB 4Y88A 3OR7A 1BFSA 2HJFB 1NC2D 4JO3H 3G6JA 4M6ML 4WI7A 5IESH 1TJHL 4LDLB 3QDMB 1BQHB 3DOSA 3WNKA 4G6MH 1RHFA 4JFED 3GMRA 4HK3N 2BNRE 4TRPL 3U2SB 5I1IH 1IGJB 3L5WB 1NFKA 1BJMA 1RURH 2PYFA 2YHGA 1CGSL 5F7WC 4HHAA 4P59L 3MRMB 1HH6B 3MLTA 2J8HA 1F45A 4U6VH 4D0BA 4LSTH 3QZWG 4NRYB 1KT2A 4X6DE 4Z7NF 5J13B 2H2SC 4M7ZC 4NZUH 4U1NB 3REWB 5C09B 2VJXA 4MD4A 5JHDB 3UTSD 1ADQL 1WK0A 3L3IA 4JHZA 4MWFB 5C0IA 4J3WA 4X9HA 2APXA 1QRND 4GW5A 5DK2A 4UTBH 5B39A 1QFWI 3QCTH 4IRSD 5HYJD 5HHOB 4JY6B 3WUWA 1WBZB 4LK4A 4PGEA 1KBGH 1IC7L 1PGRB 5I30L 5KSUB 2VQTA 3O8XB 4RDQF 2Q3AA 3SJVB 4LVHC 4P3DB 4WV1B 4PJEA 4OCRL 5HGDA 3MRQA 4QHMB 4V1DB 3QPXH 1CGUA 3EFFA 7FABL 4WJ5B 1KJ3H 4NIKB 4IRZH 2RR3A 3I3EA 3QEHA 3QBTB 4GAGL 1CDJA 5HY9B 3KPPB 5CEYB 1T21B 4HBQA 4TSBL 4XXDB 3ZKQD 4XNQA 2QSTA 3PL6C 3UBXI 1JBJA 4Z76B 4LF3B 4MNHA 3LKQA 4G9FA 1ZTXH 2C1PA 5FYKE 4M93C 4NRZA 1U2CA 2HFFB 3KWWA 4F58H 4NQDE 2UZYB 1FH5L 1T1WB 4X6CA 2IF7A 1DBBL 4LQFL 4K71C 5F70A 1JI2A 3MLWL 2R2EA 3RIFF 3SHSA 4JQXC 1ZHKB 4NSKA 5FDWB 3HN3A 2OQJB 5FGBA 1YNLH 3W2DL 4KFZC 4HS8H 3OF6A 4S1DD 1FC2D 3WKML 1VHPA 2BNRD 5I6XB 2P4AB 4ZAKD 2LU3A 2ZUYA 1QKZH 2C3GA 4KI1A 1UEMA 3UCRA 1CFVH 1OSZB 4PJXE 3B6SB 1QEWA 3CCHB 5DC9B 5D6CA 3IJHA 3NAAL 4NKMB 4Y4FD 1CLOH 4HIIB 3MLRH 2H26B 5B3JE 2R8SL 3LY6A 3WNOA 1YZZA 4LHQB 1DTUA 2VL5B 1K6QL 3PL6A 4GRLD 4LPWA 4YFDB 3SCMC 3FOLB 3G6JE 1BZ9A 1PDKA 2YOCA 3MACL 4CVXB 5ENWA 5B21A 2FSEB 2ZNWA 3F6LA 3RL1B 3VMOA 3QPQD 5LWYH 1BVKB 4Y2OA 3RJQB 3CD4A 4H25B 3DX6A 1X4ZA 2AW2A 1NEZB 1JGDB 4WDIA 3O41A 3RVTC 1H0DA 4JQXA 3X3GL 4PGCA 4JN2A 4E0RB 3HZVB 2P46B 3L9RB 5CINL 5JMRA 3C6LB 3UX9B 4NQEA 3WFCL 1OT2A 4R97C 4KVNL 1MAKA 2FIRT 3CH8A 1QBML 4U6TA 3ET9F 5IR1A 1HILB 4R6UA 4MQ7A 5EC1B 5FYKD 1MUJB 1V7MH 2XZAL 4NQDD 2ATPB 1TJIH 1SVCP 1MFBH 2VABB 3KR3L 4MVBD 1AI1H 4KKAC 3FB5B 4W81A 4YHKH 4CU7A 1FNSH 3AC0A 5ESVA 4NN5C 4F2MB 4KPHH 3SCMA 3TJEL 2I5YH 4JFDA 3SDDB 4PJEE 3BT2H 2OJZL 4NZTL 1JMZA 1BGXL 3LD8B 3TV3H 1CGXA 3C5SB 4HS6B 1YA5A 5IHUH 4EOWL 4MQTB 4YXKL 5J7CC 2M1KA 3QUZC 2QTEA 3QI9C 4G9FE 1ZANL 3K2MC 4RZCB 3PWUB 1L7IL 2FECI 1CGVA 2VL4A 2MHAB 4OGZA 4X6CE 4U33A 2Q6WA 1H3XA 3TH4T 1AJ7L 3OBAA 2R0KH 3OKDA 5AYUH 1LMKA 1XR8B 4UBDD 2W91A 3L3JB 5TE6L 3GJEA 3MJ9L 3GBLA 5ALBH 3EIFA 2XA8L 2Y06L 4ZS7H 4F8TA 3VXMB 3QAZC 4DGIH 1S9VB 3HMXH 2YKLH 2BP3A 1IGFH 4PRDA 1TQCB 3KPSB 3SKUD 1G7QB 4LLVA 1CVRA 1VFMA 5IHLB 1R5IA 3BAEH 4C4KO 2X70A 4KDVA 4TUJA 4WI9A 3QDHA 2AI0L 4K3DL 5FYLE 3RVUC 3TYGL 1OHQA 2VE6B 5D2LA 2D4FA 1CR9H 4PJ7B 5JO5A 4ZSOB 4XBGA 2HT2C 1OCWH 2VDQH 3CH1A 3QUZA 1YY9D 1KCUH 1I9RL 4U31A 4R4NC 1HDMB 2V17H 4HQQH 4L4TE 2OZ4L 5D96C 4G80B 1BZ7A 1F6LL 1WFUA 3BUYB 5E8OA 4LLDB 3HI1A 2V2WA 1U95A 3IS1X 5GQBA 1RZ7H 3LRHA 5FO8A 1YEHH 4P2QB 4GW4A 3VXQB 12E8H 4G6KL 2Q76A 4NQEE 4U0RC 4U2ZA 1FLTX 2VITB 6FABH 3MLSL 1UM4L 4ZPVA 3S9DB 1TETL 2CK2A 1MF2H 3SKOB 15C8H 3RIAF 3MYJA 4YHOL 2QKIB 3HLAB 4K3GA 5AAMA 4G9FD 3VFGH 3PIQA 4EZMA 1L6XA 3TLRA 32C2A 4O2EA 2H2SD 1SHMA 5T3ZE 1AGBB 3Q6FA 1FPTL 3JXAA 4UDUA 5E94B 1MI5A 4LCCB 5DS8A 5CEZL 1XCQB 4JFDE 5FKPB 5EO1B 2X1OA 4F7TA 3HUJA 2WWKO 2BSRA 3DX8A 4JO1H 1UZ8B 3OF6D 3UYPA 2Y23A 5FUZL 1SY6A 3OX8A 3A6BL 4UT7H 3OZ9L 4P5TA 3CXDH 4LBEA 4HWEL 3QUKA 4WNQA 4X0KB 5C92A 1IAIL 4AG4L 4FXLA 3BHBB 1U42A 5ISZA 5D5MA 2DTMH 2J5LB 4U49A 5FYLD 2GCYB 3MV7A 3G5XB 1N5YH 2V7HA 2EZ0C 2VDRH 4D3CL 3PL6D 3BPLB 3MCKA 1RULL 5D9SA 1RU9H 3BPOB 2IH3B 5DD0L 3VFVB 4NFBA 1GPOH 4J3XA 2H6PA 4L4TD 1LEIB 4PGBB 2GAZA 4AH2B 5HGHA 2MQ0A 4UQ3A 4OLUL 1AXSB 2R69H 3E6FA 1ERNA 1E6OL 5B8CA 4P9ML 1G7JB 4XMLL 3P40A 5IB1A 5F7DB 1A4KB 3BZEA 3LEYL 4NQED 4U6YA 2HVKA 4M5ZL 1UACH 1IKFL 5D2LE 3CUPA 4F3FB 2P1YA 1KLUB 3LQMA 5F7YC 5EC2A 2CUHA 1DSFL 5TE7H 5E7FA 4JPIB 2GITB 2BRRL 1NL0H 5T3ZD 2E27H 1RZIB 2P5EA 1HYRC 4GAJH 4M43L 4PJ9B 1ZT7B 1CD9B 2EC8A 2EDOA 2ZKHH 3SCMD 4G8EA 5B3JF 4JR9H 4JFDD 4XPGH 1DBKL 4NNPL 5FUOH 3MZGB 3V6BR 3RWCA 1ORQA 2IG2H 4H1LH 5H8DA 2D9QB 3S5LB 4GRWH 4HKJA 3GHEL 4JG1L 3G6JF 1JPSL 4PBWD 3RY4A 3TBSB 3UAJC 3DBXA 5JZ7C 3AM8A 3RVTD 2V7NB 3MO1B 4X5WA 2WUCL 2XQBL 2F58L 5IOPA 2EKSA 1JP5A 2A6JA 4KY1L 4K7FA 1P2CA 2DN7A 3F5WB 5GGRB 3V5KB 3V6ZA 4YDIH 5BMFL 2ZWLT 4G7VH 3QUMA 1QQDB 4G9DB 4DN4H 2RFXB 1JI1A 3H9SA 5DK0B 3HUJE 3T1FA 4YUEH 1MFEH 4KKAD 2ADJA 1ZLUK 5KS9B 1X5HA 2FHBA 2G75B 4U6HB 3RTQB 4HCRA 2OXGA 5A2IH 3JWDL 4ZO7A 1MLBB 2NY2B 2F53E 1SJEA 4S0SD 1SEQL 2J6EL 5ISZE 4PJEF 3BVNA 5D5ME 3VRLE 1KXTB 2Y6SC 1HH9B 1CE1L 5E2VL 3QO1B 3KYKL 4AENB 2D0FA 2JJTA 4KHXH 3QNZA 1P4LB 3QUZD 1I1FB 3QI9D 4HF5L 3MA7B 4ODWA 2R23B 3BW9B 5DD5L 1VFAA 5EO0A 4PLNC 4WW1A 1NMBL 1OQOA 2QQKL 5SX5H 2J8UB 4YWGL 5I19L 2H8PA 2FWOB 3IKKA 1ZHNA 1LVEA 2NY7H 3EDKA 4X6CF 3DVGA 4PG9B 3X11A 1AKJD 3HZYA 4PLJD 3ZYJA 1F3JA 2DLFH 4Q6IB 1CE6A 2GK2A 2UV3A 1Z0MA 5LGJA 2HJKB 1UADC 1RIVL 3GIZL 3HC3L 2XRAH 4MCZA 4UINH 2IADA 2KBGA 5JIKA 1FHGA 2FH6A 4EUPA 4XH2B 1FVEB 4DAGL 3OKLA 4G8IA 2KH2B 5SWZA 5C0RL 4G8FA 4P46C 2L4OA 4LLUB 3L95B 1DBML 3OGOE 4NUJA 3U30B 1NANI 1MHEA 4LLWB 2ATKA 2P8LB 3RVUD 5CZVL 1CU4H 3FFCA 1DN2A 4U1MA 5ICZB 4XNXL 2HT2D 5EU3A 3LQAH 3D2UA 2XACC 4R4ND 4DW2H 5HD8D 1J7VR 4AJ0A 2RCSH 1IGTA 2HN7B 3NMEA 4LIQE 4M02A 1IAMA 4R7NA 1DBJH 4PJGB 3LCYA 4W6WB 2YC1B 3QULA 1F4YL 5C6PB 4PJFB 3BKCH 1QLFA 5MEOB 1NFIB 2F53D 3S3SA 1AFVH 2JK5B 5ISZD 4O51B 5GZOC 1QOKA 3ZYIA 2KUTA 3QSKB 4N0YH 3QIBB 3RPIA 1EEUA 1Y6KR 3LZFL 4QHUA 1WT5C 4P46A 4D0DA 1YPZB 1PLGH 5IEHA 4LVOC 3H9SE 4O4YH 5DUML 4Z0XB 5MEPB 2NTFB 5KVMC 1WBYA 4M5YH 3VI4E 2DKUA 2DWEA 4DKFH 2DMKA 4UT9L 2H3NB 1FLRL 5JIIA 1UH4A 3T3PF 2AV7A 3E6HA 4KRPC 1H5BB 1INDL 1P4BL 2WUBH 2RJMA 4IJ3C 4OBRA 5ACMA 2PW1A 5I18H 4XNUL 4YGVA 1BQHG 1RMFH 5CP3H 1PJ9A 1N6UA 1OAXH 5I1HL 1G9NC 4CVWA 3O6FB 4LVNB 5ALCL 1MCQA 4TQEL 1ES0A 1RUML 3MCLL 4F33A 5F7UA 3OGCA 2Q8BH 4Z7UB 4EVNB 4ELKB 1NLDH 5K9OA 3AMKA 3C2SA 3SDXF 2EZ0D 4AMKL 1A7OH 1N2RA 4DGYL 35C8L 3VGBA 3CFIC 1WT5A 4PBXA 5AAWA 3V9FA 3NBNA 1NCDH 1J12A 2QHRH 3BX7C 1CF8L 1KNOA 5LAXB 1BLNB 1MRDH 3LH2L 4MSWB 3RI5K 5EZIL 5IQ7L 1FFOA 5SWZE 1MIML 1U3HC 2Z4QA 3DUHA 5IW6B 4ZFFA 4H0HB 3ZO0A 5E4IA 4XVTL 1U9KA 4XP4H 2WQRA 4XTRC 3FFCE 3LS4L 1E4KC 4CMMA 2BHYA 4Q9RL 2AK1L 4EI6A 3I75A 4X7CC 3H9SD 1FC1A 1M7DA 3IGAA 3PNWA 1K8DA 1SBSH 2O5YL 3VFWB 1K8IA 3MLVH 2FIKA 2JIXB 2XN9A 3UJTH 3WJJA 1J05B 5EH1A 1VESA 4NT6A 3MA9L 4U1GC 1EZVY 3EYSH 2HVJA 5SWQA 1WZKA 3V0WL 1BBJA 5DT1H 2W9EL 5H35A 5CKGA 3CFBB 1UQSA 3BO8A 4RWYH 5F88B 3UAJD 4D94A 1E4WL 4YHPB 4X98B 5JZ7D 5K9KA 5BJTB 1U3HA 2WSKA 2FJFA 3Q1SH 1NEUA 5CLWA 1U92B 1KPUB 1V3LA 2IALB 4ODHL 5JLZA 1CI5A 4WCYH 4UQ2B 3BEVA 4MXVE 1II4E 4RQQB 3T09A 5ACZA 2L0DA 5EOTB 1FE8H 3MBXL 3P9LB 4QTIL 2V2XB 3IDJA 4L8BA 4KC3B 1BOGB 3WHE1 1Z3GL 3ARGC 4FP8H 2ZOLB 2CR6A 1T7WA 5DMIH 2FD6L 3MX0A 4X8XA 4G8GB 2ESVA 3HUJF 5DD6A 3VWKB 2GSIA 3OAUH 4JM4L 2M2DA 3MYZA 1NEZG 5SWZD 3IFLL 1G9MH 2C3HA 4XWGH 4NBYB 5E08H 3FCTA 1S7UB 1CGWA 3H3PH 2Y6SD 1MY7A 1IQDB 4OV5A 5GGQL 3FFCD 1I3RA 4X99B 1U8NB 2QR0B 1X7QA 1MCPL 4N0UA 1QNZL 1KELL 1FZOB 2X4TB 3NFSH 3D2UD 2BOCA 3BP5A 4OZIB 5J1SC 3G08B 5DYOB 3ZYOA 1ED3B 1QLRA 3T0AA 3B5GA 1GGBH 1GZPB 5TQ2H 2R2BA 3WEXB 5F9WC 5EBLA 3WLWC 5BOPA 2YPLB 2MPAH 3ARGA 2VKXA 4M62L 4QY8B 2JJUA 2YN5A 3ZDZE 4PRNA 4X80L 1J8HA 1RD6A 2FGWH 3HI6H 4UTAL 2ICWJ 4LFHD 3VFMA 1P9MC 4HWBH 2CO7B 1I8MB 4P46D 1YEIL 2GK0B 1C5CH 1N6VA 4V2CB 3RFZC 4XWOC 4XP1H 3TBVB 4P48A 1A9EB 3MR9B 2XN9E 2NY0C 4HKBB 5KSBA 3O0RL 2CKBH 2WANA 1HKLL 3TO4B 3HPJB 2YBRB 2AK4A 4XC3H 2KKQA 5IHBA 3O3DA 4EN3B 1KJ2H 2WNGA 3F7VA 3RVXC 1F4XL 1FNFA 3VXTB 4NQCA 5A40E 4HIHA 4OM1L 5D1QB 2N7BA 3QO0A 4QRQB 3WIIL 1DQLH 1WZ1H 5EZLB 1OARL 2EDYA 2F19H 4LDEB 4J3VA 5IK3B 1FL5A 2NW2B 3QHFH 3KDMB 4JREC 4Q9BA 3HS0A 1XF5B 3H0TA 2ED8A 1I1AB 1TXKA 4TOYL 1U91B 4OBSA 3KNBB 1EGJH 1FFNB 2XFXB 1RAMA 5CLTA 4XVJL 3I6GA 4XPAH 3ZSTA 4DFHA 5GZOD 1KJVA 3UBXA 1EA9C 1GGIH 1XGPA 3KLSA 1MWAB 4OQ1A 1P9MA 2IH1A 5E8DH 4X8JB 3C09C 3IU3B 1NGPH 5E5MA 5E0QA 1JUFA 3IDMB 1F58L 4OZ4A 3T65B 5ESAA 4GUPA 2ESVE 4OCSH 1BFTA 2F74B 4KRPD 2CH8A 5EFIA 5F7HA 1O0VA 1EVUA 1TMCB 3FONA 2J4WL 5D7SH 1EFXB 2ADIA 5C0FA 4LEOA 1KIRB 3BP6B 4YHYB 4NP4H 5KTEL 5F7EH 5J6HB 2VDLH 2LTQB 3MOAH 2WBJC 4ALAL 2X1XR 5T5FH 4X5LA 3NGBC 5L88L 4N0UE 1REIA 5T5NF 4ZPTB 4CVUA 1D6VH 2YSSB 5DDHA 1SM3L 2QL1A 1HHKB 4OGAC 4Q6YA 1U58A 2XN9D 2XNAB 3O4OB 4GMTL 1CD1B 1IFHL 2OI9B 3LKRA 4R96A 2ED7A 3CSYB 4YBLB 4P0DA 1P6FA 1MCCA 3QZWA 2Z35A 3PP4H 5C0GB 5CS7A 1JF1A 3MLPA 2DQIL 5I8KH 2ADGA 1J8HE 2FEDC 3NCMA 4LPTA 1ZGLB 3WXVL 1MHHA 3FRPG 3Q6GH 4XAWL 3TEUA 4B0MM 4WI4A 1KIPB 4OAWB 1U3HD 1DZBA 3QWOA 1I3GH 2OR9H 2ILLA 5M95B 1BBDH 1H3WM 1IRAY 1QRKA 1RJZB 4XTRD 4AEHL 4PB9H 4QT5B 2BMKB 5KSBE 4XT1C 3T0WA 1C12A 3MXWL 1N64L 3F7RA 4E5XA 1MH5A 3E8UH 1J10A 4P5KB 1H3GA 3QRFM 1D5MB 4U1SB 5GGTL 5I76A 5FYKL 1RK1B 4X7EC 3SDYH 4PV9B 3QIUC 2ESVD 4YNYB 3O3BA 4LSVH 1OAKH 2VXTL 5T1DL 1CWVA 2DJSA 4MD0A 3WCYA 4BH7B 1KTDB 1LEGA 2X2YA 2X4OB 1V7NL 4G43A 4X7SH 2LVEA 3OJMB 2B0SL 2OL3H 1S7QB 1YDPA 1AXTH 2ERJC 2EE3A 3HTLX 1LO5A 1U8HB 1TQBB 4JFOB 4JM2A 3GKZA 1AQDA 4IS6B 1ZLUH 2OLDA 1CICC 4MLIA 5GRJH 3V6FA 4DN3H 4PG2A 1VGKA 1MRCH 1EXUB 1A47A 3RWHB 1KCRH 1A1OB 3TA3B 1FG2A 5D7JB 4OKVA 4JPWL 2D7PA 4F7EB 5JHLH 1WLHA 2BVOA 4MXVF 4M00A 3ARGD 3MV01 2DKSA 5JPNA 5DRXB 1JV5A 1CL7I 2F8OA 3RWDA 2EEDA 3ARFC 1IJ9A 2GSGA 1J8HD 3S5LG 3WNMA 1PAMA 1FORH 1IAIM 1N0LA 2FB4H 2Z31C 4LSRH 1OF2B 1LILA 1R3JA 1XF3A 4JCMA 5FOBB 1FAIH 3OKYA 2D4DA 3LQZB 1S7WA 2WQ8A 5CP7B 5L0QB 1G7MB 3GJFA 5C6TL 2HWZH 4HFUH 2I26N 1CQKA 4LPUA 5ETUB 5EBWB 1ZHBA 3BPCB 5ITFA 3QEQA 2AJVL 2Y36H 1I7UA 5EB9A 3X12B 4OGXL 3VWJC 4U1LA 5BVJB 5I16A 2EH7L 2EYRA 2W9DH 1T1XB 3O6KH 1OSPL 2Q20A 4Z7WB 4LSPH 4DGVL 1FAKT 4XCEB 3ARXA 3CMOL 4JZNB 5TDNA 4G3YH 5BZWA 1XIWB 2YD1A 3WLWD 5GISL 3MFFB 1CDCA 4JAMA 1C08A 1J9CT 2KZWA 3D0LA 5IW3A 2GY7B 3GI9L 4HMDA 4KZDH 3OXRA 5F96L 1JYVA 3ZDZF 4JFFB 3L5JA 5I8CB 2Y07L 2W0FB 3Q3GA 1F11A 4QXTA 2Z31A 3VD4A 2ZUUA 2EE9A 1CDBA 3BSZL 3SO3C 4XWOD 2AXGB 1B6UA 2CDGB 2APBA 3GMQA 5T1KD 1LO3H 2NY0D 1BIIB 1J1XL 1ZEAL 3DUSA 4X9IA 4UB0L 1JZ4A 3T1WA 2EYTB 3B5TA 5BZDA 1I1CA 1Q38A 5HGBB 1N7MH 3SE3A 2XQYG 4KXZH 1Z5LB 3G5VB 5FA3A 3T0XA 1DL7H 4CAGA 4OD1H 2K9UA 5ELIA 3VI3E 1JTTA 3WYRA 2F5BL 4JFQB 1K5NA 3VCLB 1NBVL 3GIVA 1UGNA 4F37K 1B4JL 3C87A 1BFVL 5GXBB 3G6DH 2IQ9H 3E2HB 3F7PC 5DC4B 1IEBA 2V6HA 3LMJH 4HT1H 4J3TA 2HH0L 3T4AB 4OFKA 3R1GH 5E6IC 2H1PL 4ZO8A 4ODSH 4JKKA 2NY1C 4F80A 4X6BA 5IG7A 1NGQL 1T6WA 1EAPA 1WC7B 1QFHA 4ONFH 1N4XL 4ONGH 5DJXA 1PYWA 5C0AA 1FL6B 3ZYZA 3GK8L 4GKZB 5J57B 1OB1B 1OPGH 2EIEA 1HQRA 4JQVC 5MI0B 1T22A 3AS2A 4CW1A 2YRPA 2V9TA 3SE9L 1JIBA 1FNEA 4M6NL 4RRPG 1UM5H 1IMHC 3B3IB 3PHOA 2CRYA 3WFBL 1YMMB 4IEFB 3NTCH 3MXVL 4GRWF 4MLSA 3NFNB 2AVGA 2Q3ZA 4HUWB 4XBEH 1S9YA 1EHLL 3IVKB 3O45B 2WBJD 3DRTA 4PV8A 3RWEB 5BS0B 3PWLB 3QEQE 4PJCF 1KIQB 3OKOB 1XF4B 3PV6B 4I4WB 1YY8B 3UYRL 1VEMA 5TE4L 1AY1L 4PTUA 2VSDA 3P4NB 4OGAD 3MGAA 3QEGH 1S5HB 3KPMA 5A2LH 3U4EA 2C3WA 5E6IA 5T3ZL 3MRLB 1AP2A 5DRNA 4LSQL 5JDJA 4HK0B 2CIIB 4Y16C 5E8NB 1AGCA 5DHXB 4RNRB 2C7UB 2FEDD 4L4JA 5KSAC 4JQVA 1XH3A 4KTDH 1T7VA 3HE7C 1QFUH 1BFOA 4YPJA 3HRZB 4U0QB 2BNRB 1HXYA 1TCMA 5F6IB 4ZAKB 3VDCA 1KCSH 3FT4A 5HYSB 3S35L 4HBCL 3U7WL 3OKNB 4ELMA 3EOAB 2XIDA 3RBSA 3WL9B 4X6DB 4L4VA 5TF0A 2N4IA 3VFTA 4P4RB 4ODUA 3UJIH 4BZ2L 5KSBF 1MVUB 4CMHC 1OVZA 3SGKA 2ICEB 4I0PB 3GSXA 1JHKH 4NO2A 2IEPA 1SEBA 3L3GB 5F7LB 1U36A 4WVRA 3QIUD 4HPOL 2DQFB 4TVPE 4Q7DA 2W59A 3QA3A 3O4LB 2A6DA 4PJ8B 4XCCL 2JF1A 4Y16A 5HGGS 1MFDH 5ESQA 4LL9A 5TDPA 3PWPB 1S7TB 1TVBB 4RFOL 2L7JA 2BERA 2HT3C 3PABB 5KSAA 1B88A 1LO2H 2ADFH 4JLRB 5GS1C 3HE7A 3LSOA 4I3SH 1H8OA 3QEQD 4HJJH 3Q48A 3IFPA 1FCGA 4QYOB 5C0AE 3VG9C 5D1XC 3BGMA 4OD3H 5F1IA 5GSVA 4NC1C 5I1JH 2XTJC 5IHZB 2QSCL 5IEKB 1FSKB 1NAML 4UAOC 5GGVY 4WUUD 4PLKC 3U9UA 3RWJB 3RY6C 2V2TB 3EOYG 3MUZ1 1U6AH 5JOEA 1ZGLM 4MJ4A 2AJUH 5HHME 4PRPB 1CGYA 2FLRT 5FAAA 1RZKC 1IC4L 4WY7H 3TYFA 2X10A 4Q0XL 4M7JL 2A83B 2Z31D 4PJBE 4LPCA 1QVOA 1S78C 5L7XL 1CDUA 4UIKL 3T2PA 8FABA 2HRLA 3CSPA 5JW5B 1CZ8H 4PJXB 5C08A 3LB6C 4QRRB 3LPWA 1BM3L 3QJHA 4C55A 1W8OA 1T20A 5GS1A 3H3BC 3P9MA 3VXSA 1MCJA 2WWMD 1Y18B 4ODTL 5IJVA 5JUEL 3ULVC 3T77B 3VFNB 43C9A 4KGJA 3U4BL 5JORA 5I75B 4TVPD 1LP9B 3ZT5A 4HKZB 4D9LH 1VPOH 1E27B 1F3DJ 1FVDB 3RY6A 2OMBA 3OMZA 3W0WA 2VAAA 5D8JH 3KPLB 3B8SA 2PYFB 4OUUA 1WQVT 1AGFA 4Y1AA 2DQTH 4ELME 5MP6L 1MFAH 4PIRF 2NY3C 1ZMYA 4P2CG 2R4SH 3GMNA 4L4VE 3KPTA 1DBAL 3QHZH 4L5FH 3BPNC 1CBVL 2OK0L 1RUQL 4S2SB 2QSQA 4K3JH 4FFYL 4MD4B 4D2NA 4Y5YA 5C0AD 8CGTA 4XVSH 1MHPL 1KB5A 3L3IB 1XT5A 2PTUA 3ES6B 4OLXH 5DRWB 3RWGB 1IC5L 4BA8A 3PGDA 1YMHB 2FYYA 2CMRH 5C0IB 4YEFA 1OWRM 1KULA 4U2YA 3JV6B 1QSED 3K8LA 5B39B 1J0HA 2VLKA 2NPLX 3WSQH 1IAKB 1B2WL 1IGIL 5C9JA 4L8CA 2VR4A 2AEIT 4ZD3H 3PJSB 1IGCL 5HHMD 5MERA 5F1KC 5KSVA 3RDTB 3R0NA 5FHBH 1NUNB 3JTTB 3KYNB 2WV3A 5FO9A 5CSBA 5LCVH 1ZAGA 3MUJA 4NNXA 4QRTB 2R1YB 4HXBL 3QXDB 3VI3F 3WUZA 1F02I 5IB4A 4JM2F 3U0WL 1L4IA 1UH3A 2XZQH 3KPOB 5ADOL 3MMEB 4GG8A 3TN0C 2YRLA 5E6ID 2C1PB 2V9QA 2H32H 4NRZB 2NY1D 2D03L 5DUBB 2ZUTA 1E6JL 1G7LB 4U1JA 4XBPA 4CVZA 4L1HA 1JN6B 4BFIB 1XGQB 5D6DC 3KPRA 5J9PA 4GFTB 4NSKB 1U93A 4PLOB 1YEEH 4P9HH 3CPLA 1B0GA 4LIQL 4Y8AA 5A16B 4ZUUA 4G42B 4M7LH 2R4RH 5HYFA 3GSQA 5GJSH 3MROB 3ZE0E 3TCLA 4LVHB 2CD0A 1N26A 5C08E 1GOGA 4RMWA 2R1XA 2FDBP 1CIDA 4L4VD 5CJQH 5F9OL 3CLFL 1A1NA 3MODH 3GSRA 4GS7C 4OT1L 4WEBL 1FNHA 3QUML 1KEML 3K46A 2P8MB 2E6PA 1EK3A 4Z0BH 1KPVB 2ZG3A 4NNYB 4MDIB 5F1NA 2X4NA 5HHPA 1CXEA 4NC1E 3T3ME 1PZUB 3D85A 3BZFB 2XTJE 4FTVA 5HVWA 4XMKL 4L4TB 1MNUL 1VEPA 4NZRL 4R8WH 4Y16D 3GSOB 4HIXL 3DX6B 2I60L 4HCRL 4OCWL 2BDNH 5D6DA 1GIGH 3W0WE 4L29B 2EYSB 4JJ5B 1TENA 3U79A 3ZZ1A 4B7IA 5KSAD 3BZDA 4Y1AE 4ZYKA 3CVIL 3O8XC 1MCDA 1U8OA 3VG0L 3HE7D 3MOBL 4IRJA 1TJHH 4NQEB 4YDKL 3K1KC 3MGOB 4WV1C 4CUCA 1DVFC 3SDCB 2ZNXA 1YNKL 4NO3B 2D7TL 4RMVA 4TRPH 3QDMA 1BQHA 3TNMB 2O5ZL 5HPOA 5E2TL 5C8JB 1PEZA 2BXYA 1CGSH 3U2SA 4NJAL 4P59H 5DGRA 4Q9CA 4S1SL 1IGJA 3H8NA 3L5WA 1C7SA 3T0EC 2VLKE 4LU5L 4RMRA 1HH6A 4GKOA 3S8WA 3ULVE 1NUDA 1GGTA 3B5HA 4NRYA 4HGWB 5F6HJ 2ITCB 1RV6X 2EEAA 1ADQH 4U1NA 3REWA 5C09A 2EDXA 3EYUL 5JHDA 1NQBA 4N0FA 4MWFA 4R90H 2IBZX 5H94B 1IC7H 4MX7B 2VZOA 5I30H 5L6YH 3P3YA 4GKSB 5HHOA 4JY6A 5C08D 2CPCA 1F8TH 2HT3D 4TVSa 1JYNA 5KSUA 3O8XA 4OCRH 3V6OA 3U0PB 3SJVA 4GKNB 3P30L 4P3DA 3NA9L 4Y4HB 3V4PL 1L9MA 4F8QA 7FABH 4WV1A 2COQA 3DYPA 4XHQA 2YPVL 1MQKL 2DQEL 4QHMA 4V1DA 4PYGA 4GAGH 5D1XD 3KPRE 3LKOB 1NCAH 3BYTA 3W81A 5HY9A 3K4DA 5CEYA 4XXDA 2C3XA 5AZ2L 2XTJD 5KG9B 3T0EA 4Z76A 4OI7A 4LF3A 4WRLA 1FH5H 4OIIL 1FL3B 1DBBH 1U8PB 5C7XL 3W0WD 1T1WA 3MLWH 2DQJH 3FB6B 4Y1AD 5F89B 4PRDB 3ARRA 5CIPB 3NZ8B 1VENA 4NKDB 1ZHKA 4JKPL 1S78D 5FDWA 5D2LB 3UTPE 3WKMH 3IKCB 2OQJA 3LB6D 4J7RA 3QUZB 2X6MA 3SGEH 3QI9B 5DHYB 2W0LA 4OI8A 5DJCB 4U3CA 4QHNB 1Q9OB 1OSZA 3NAAH 2VLKD 4FTVE 3B6SA 4UT6L 3CCHA 5CZXC 4TNVF 5EWIL 4F7PA 1NAMB 3ULVD 1A6UH 2VXUL 3HI1B 4NKMA 2V2WB 2O61B 4ETQB 1AKJB 4DTGL 4HIIA 2H26A 3M1BB 3IF1B 4HIEB 4M9PA 2B1AH 4RGMB 1D5XB 5J4MA 1YYLH 4GW4B 2Q76B 3OPZH 2BNUA 3SE4C 3FOLA 5AZEL 5L2JB 1I9IL 5IFHL 4R4FH 3QDME 1MIEL 3MYJB 5DK3A 5TH2B 1FNLA 3LD8C 3RL1A 1BVKA 1A6AA 3DLQR 3X3GH 2NY3D 3O6ML 3PIQB 2X44D 1NEZA 5J1TC 1JGDA 1DQDL 5CINH 4O2EB 3RIFK 3TZVB 4ELMF 3WFCH 1TZIB 3HZVA 4KVNH 5I66B 3L9RA 3TH2T 3LS5H 5ICYB 4NCC2 1A4JB 1QBMH 3C6LA 3KPRD 3TIDB 4PY8I 5C09E 4WW2C 4NZDA 3U1SH 5FEBA 5JHDE 4F15C 1UENA 1HILA 5D96B 5IVXA 4MA8L 5EC1A 1MUJA 2DOCA 4X83A 3K8KA 4RAVB 2ATPA 4LBEB 5HHOE 2VABA 4MQSB 3LN4B 3FB5A 1DEEB 5I1LB 4F2MA 2F53B 1X5ZA 2OJZH 4NZTH 4XP6H 1HCVA 4U0RB 1BGXH 1G9NL 3SE4A 3SDDA 3UTPD 1HIML 4MDJB 1TQCC 2XWTA 2Z8SA 1RZJC 4GBXC 4V1DE 2V7HB 4WEMB 3QFDB 2EDLA 3TT1L 3L3HB 4EOWH 5CD5D 3C5SA 4HS6A 3DO7B 2KDGA 1Z9SA 3D85D 1ZANH 3LVEA 4FTVD 1Q9WB 1L7IH 3T0EE 1TCRB 2ZSWA 3DMMB 1AC6A 3MJGX 3V4VL 5EUOB 1RIUL 3PWUA 3IRZA 4RCAA 5DA4A 1AJ7H 2MHAA 4YHIA 4WW2A 5TE6H 5E2JA 3D69B 5IB1B 3MJ9H 4MZ3A 3V0VB 4U6YB 1XR8A 4ODXA 2Y06H 1F3RB 1JZ6A 3L3JA 4NWTL 3QDMD 1DLFL 4HZAA 4XNMB 5C0JB 2X41A 5DD3L 3ZE0F 1NBQA 3P73A 1BAFL 4N8VG 1S9VA 3N85L 1CCZA 3SKMB 4PB0L 5IMOA 2OTWB 1CFSB 2Y72A 5GJTL 3KPSA 4GMSH 1G7QA 3TNNB 3TYGH 3ZT7A 1D3CA 1MCHA 2R2CA 3V4UL 5DEGB 1TTUA 3SGDH 5C09D 2VE6A 1FRGL 1EJOL 5F71A 5JHDD 4PJ7A 3RWCB 4ZSOA 4XCYB 2CXKA 4Y8DC 4LCCC 2NY5C 2DBJA 1M05B 3T3MF 5FCSH 3EO9L 3DBXB 1DUYA 4I77H 1FYHB 1HDMA 5HHOD 1OM3H 2FX7L 4G80A 1HI6B 3JWOC 1G6RH 3BUYA 5EBMB 1JVKA 3O8XD 4LLDA 3VMNA 5A2KH 3GSNL 1WIOA 4OGYL 4BQCA 1I8IB 5HVGB 5B38B 3PDGA 1DVFD 1KEGL 4NCDA 3CFKB 4LARH 4V1DD 2UVFA 1UM4H 1TETH 4P2QA 3RVVC 3VXQA 4BSWB 2VITA 3P0GB 1SJXA 4HUXA 3SKOA 1W72B 1RK0B 3BPLC 3T0ED 1KC5L 2QKIA 3NPSB 3RNKB 1JZ7A 5IVXE 3HLAA 2ADJB 5HI3C 2VO5A 3QXVA 3F58L 1FPTH 4WIQA 4KV5E 3IDXH 3MLUL 5MEQB 2P44B 3K4ZA 5FIEA 4QO1A 5JIHA 5CEZH 4HMCA 3WNLA 3UPRB 5E94A 1XMWA 4LCCA 2VSCA 5FKPA 1OW0C 3O2WL 5FUZH 5EO1A 4Q58C 1QPXA 3WFDL 5FGSA 1UZ8A 1I7TB 4HGMA 2YWZA 3FRPA 2A74B 4HWEH 5HYSG 3NACH 1XGTB 1W8NA 1IAIH 3GHBL 4AG4H 5EO0B 1VFAB 5FGCB 5A2JH 2DQCH 4X0KA 5E8EB 2Y9RT 3G5YB 3QCUL 2ID5A 4D3CH 3MRIB 1RULH 2J1KA 3CNKA 5SX4H 2GCYA 3L5IA 2N1KA 1F3JB 4MB3A 3G5XA 1WISA 5DD0H 4AQOA 1KB9K 1CE6B 3RIAK 1WWCA 5LGJB 4LKCB 5JW4N 2FX9L 3K0WA 1NPUA 4DEPC 2ZCHL 2IH3A 4WFEE 3MJ8B 5EOCH 3EZJB 3TF7C 2F5AL 4PGBA 5SWZB 5KOVC 4JHWH 4QHKI 4AH2A 3MRKB 1E6OH 3GFUA 4MGXA 1KB9J 2NCMA 2PF6A 1AXSA 3JV4B 4M1GL 1X6LA 3FFDB 3LEYH 4LSUL 4HKXB 1Q9KB 4M5ZH 3KPSE 3FFCB 1VADA 1IKFH 4OF0A 1A4KA 5F7DA 2YK1L 1CIUA 1FFQA 3UJJL 3V95A 1AC0A 1FIGL 2DBLL 4OCXL 1N59A 4F3FA 2DMBA 1KLUA 4PJ7E 5DEZA 1DFBL 4ZSOE 1ROWA 1IGTB 3S3PA 1GRWA 5CZXD 4M43H 3MRNB 4JPIA 4OFYA 1FYTB 2GITA 3OKEB 5CJOL 5J89A 1MEXL 3QULB 1RZIA 5HI4C 4PJ9A 1ZT7A 3NZHH 4NNPH 3UEZA 4GLRH 2DIJA 2DMCA 3RTQC 3DSNA 4XPHL 3KYOB 3SDDD 3ARPA 3STLB 4JG1H 3PWNB 5D1ZB 1A1MA 2NY2C 4NO0B 3S5LA 3RPIB 4P2QE 4O9HL 1U3ZA 4P46B 2WUCH 2XPGB 5I1DB 2XQBH 2F58H 3SKJL 5C9KA 2V7NA 3MO1A 1DN0B 2YUWA 4KY1H 1URLA 1T4KB 1U3JA 4YHZL 4PTTB 5F72S 5DD1L 4UV4L 5BMFH 1S9WB 3F5WA 2BJML 5GGRA 3V5KA 4WTWA 5FYJL 2YA2A 1U8MB 2BY2A 2ITDB 1QQDA 4G9DA 2RFXA 3SPVA 3FKUS 4HUNB 4WFED 5DK0A 1VKXB 4CN6A 2E7LA 3SQOL 3ZTNH 1ES0B 4XPFL 5KS9A 1QFOA 4U6XB 5E9DB 5EOQL 4CJ0A 3QR2A 5BV7H 2G75A 3JWDH 2C5DC 4M1CC 3RTQA 3ULUC 2IPTH 1FO0A 4NOBA 2J6EH 1U8IB 3OSKA 1MPAL 2R9HC 3KPSD 5AWNL 2M8XA 4GBXD 2VZTA 1F2QA 2HFTA 1CE1H 3KYKH 3U30C 3QO1A 5F8RC 4HF5H 5DD5H 3MRPB 5B39G 1P4LA 4BZYA 2QQKH 5I19H 2NQCA 3MA7A 2R23A 2NY4C 3BW9A 3T2NL 4TPRL 2J8UA 2PR4L 4KRPB 1J87A 1PFCA 5JQ6L 1S9KC 1DANU 2E3VA 2FWOA 4IJ3B 4UUJB 4EIGB 5INCB 4KKBC 4PG9A 1GSMA 3WD5L 1T83C 3C5JB 3GIZH 3HC3H 5HVFB 5JIPA 3FB7B 2AEQH 4Q6IA 1QFPA 2VXQL 3BP4B 4P2QD 4GG6B 3DIFA 3PP3K 4DAGH 2FECL 5C0RH 4FQHB 4XH2A 3KJ6L 3PNWB 2NLJB 3QIBC 5AYQA 1DBMH 2IANB 5E5RB 1JRHI 2X40A 5CZVH 3GMMB 3L95A 4D9QE 4W68A 1XEDA 4LLWA 2R0WL 2P8LA 3L3OB 4JHAL 4N0RA 2E7HA 4B50A 5ICZA 1I85C 4QXUH 4FQ1L 3ZTJG 3NCYP 3BO8B 5DQ9A 3JBG7 4PJHB 1RUPL 1H5BC 3GBNL 4N8PA 1Q94A 2IC2A 4NUGL 5C0CB 2HN7A 5E1HB 4ZODA 2XZCL 4O00A 1F4YH 4XNZC 3TT3L 2X09A 1HCFX 3O6FC 4LVNC 4PJGA 2R2HA 4RRPA 2YC1A 4S1RL 1T83A 4PJFA 3BDYL 2P8PB 5MEOA 1NFIA 4YAQB 1Z9MA 2JK5A 2NR6C 3RVVD 1JF5A 2ORBL 3FQTB 4O51A 3LZFH 4XCFL 1H3VA 4HW6A 3QIBA 3T8XA 5GS3A 1LGVA 2WAHA 1NMAH 1TTFA 3BD3A 4Z0XA 4PUBL 5MEPA 2NTFA 1FLRH 4KV5F 2LAGB 5KS9E 2O5XL 2OZ4A 1CYGA 4DFIA 5FOJA 2H3NA 1INDH 1P4BH 1I85A 4ZNCD 3FCTB 4WFHE 4BQ8A 3GSNB 3MOQA 1H5BA 4XNUH 4FQ2L 1CVSC 1GOFA 2D31B 1M7XA 1QTYT 5I1HH 4OZGE 1LE5B 5ALCH 2F54B 5L9DH 4TQEH 4N0UB 2PNDA 1RUMH 2BVQB 3O6FA 3S36L 1JZ5A 1DQMH 2WLZA 5ILTL 2D7MA 1MFNA 4D9QD 5IT2L 4AMKH 4Z7UA 4DGYH 4EVNA 2J8UE 2B7DT 3SOBL 4ELKA 5GZNC 35C8H 1LNUB 1IVLA 2AQ1A 2J12B 1RZFL 3ARGB 1YNTA 3I3DA 3D18B 2VR9A 3REVA 2MQ3A 4TVPL 1CF8H 4GT7A 4R3SB 4LASL 2Y4SA 3LH2H 4CNIB 3C2AL 2AJ3B 5E2UL 5KANG 1HXMB 1MIMH 3VD3A 5LAXA 1BLNA 2AAVA 3ULUE 3D48R 4LLYB 5EIIA 4O5LH 4R4BB 4XVTH 5IW6A 2XT1B 1J18A 5EZOL 3LS4H 5ID1B 2I9TB 3QIWC 5CCKL 5IQ9B 3FQNB 4Q9RH 1SMOA 5FFLA 2O5YH 1S7SB 4PJ7F 5F9WB 3MLYH 3MA9H 1T0PB 5HI4D 5IUSA 5CWSB 4YIQB 3C60C 1I3UA 2JIXA 3VWKC 3W9EB 5GSRB 3S7GA 1J05A 5FO7A 4WFHD 1BJ1J 2W9EH 4HMEA 1BF2A 4PJGE 4KWUA 3RTQD 4BELD 4PJFE 2I25N 4L8DB 3DO3A 2EDRA 1AGDA 1SJVA 2NY2D 2HP4A 2B1HH 3AUVA 1IBGH 3BWAB 2IH1B 5F88A 3K2UH 2D9CA 4ZQKB 4YHPA 1WITA 2Y25A 3BH9A 3HAEH 1Z9LA 4L3EB 4POZC 1PZ5B 1K9TA 5DJ8B 5BJTA 4ODHH 4KKNA 1F42A 4JRYA 4OF7A 5T1KB 1U92A 1AHWC 5ESAB 1HWHB 4GUPB 1CD0A 2IALA 5EO9B 2FO1A 3EOTH 4JG0H 3T0DA 1A02N 4M48H 4OJFH 4QTIH 5ACLA 2JJVA 4UQ2A 3QIWA 5HHQB 2GUOA 1CXFA 4RQQA 2D0GA 5EOTA 1DQTA 4LEOB 4A6YH 1Z3GH 3P9LA 4GXVL 1LK2B 2V2XA 3A67L 3U6RB 1YEFL 1TNMA 1BOGA 2FD6H 2E9JA 2ZOLA 5C0DB 1BVLB 4JM4H 3C60A 3U7YL 3FJTA 4OZFH 4G8GA 4M6AA 1JNNH 4JREB 3VWKA 5AG8A 4M1CD 3ULUD 2Q86B 2W0PA 3FB8B 3D9AL 3JUZA 1G7IA 3A0OA 4G7YL 1YEKH 4S0TD 4L9LC 2R9HD 5GGQH 1S7UA 1JGLL 4Z7UE 3C09B 5KANI 3GNML 3IAGC 3UTOA 1IQDA 1MCPH 1QNZH 1U0QA 1UXSB 1KELH 4X99A 1U8NA 2A1WH 5FHAH 3TO4C 2QR0A 4AIZA 4AT6B 5KW9L 3D6GA 5GRXG 4YXLL 1FZOA 3WV0A 2X4TA 5T1MA 2OM5A 4E9LA 1CN4A 4OZIA 5D1QC 1X5IA 3G08A 5DYOA 1LEKB 4PY7A 1GZPA 4KKBD 5HHNB 4M62H 3WEXA 3JZ7A 2APTA 4QRPB 4K8RH 2F8XC 5L2KE 2YPLA 2WZPD 4QY8A 4UTAH 2FBJH 1WICA 2IWGA 5J0BA 1I1AC 1ONQB 5CAYB 2WBJB 4P2RE 1YEGL 2J6EA 2AKRB 3X14B 3GKWL 1KJMB 3W39A 5D93C 3QIBD 1T2QH 2ZPKL 4HPYL 2DM7A 2GK0A 3O3BB 1IE5A 2DDQL 1HKLH 4R0LB 3TBVA 1A9EA 1KLFA 3MR9A 3NABH 4AL8L 1MCSA 1GHFH 4DVRL 1XR9B 4YGAB 3TO4A 3HPJA 1F4XH 2YBRA 4FABH 2E7BA 4EN3A 2LVCA 4NM8L 3EZ8A 4NRXB 4YK4B 3WIIH 4M6OL 2X05A 3VXTA 5D1QA 1OARH 1JPFB 2OR7A 4QRQA 4YHYC 4YHLH 1AQDB 4MHHG 2DJUA 1BHGA 2FNBA 1YEDB 3O6FD 5EZLA 2V5RA 2FJHB 2LTQC 1TJGH 4TOYH 2NW2A 4JRYE 5LGKA 3KDMA 1EZVX 2WWKT 2VH5L 3UTTE 1I1AA 1U91A 2NR6D 1A21A 3KNBA 2CJUL 4GJTB 4KTEH 1J86A 2BVOB 2XFXA 1FFNA 4JO4L 3VW3L 2UY6A 3S35X 3O4OC 4TSAL 3MRRB 2OI9C 2YD9A 1JV5B 3H42H 2A73B 1MWAA 2GSGB 4X8JA 4HJ0C 3QIUB 1F58H 3BGFB 1GAFL 3IU3A 5IFJB 3HNTL 1NCWH 3IDMA 4X5XB 5JTWA 3T65A 1IILE 4C57C 4NHCL 2J4WH 4J4PC 2F74A 4J1UB 4ONOA 1RZKL 5KS9F 4OLYL 2I07B 2A77H 4N1HB 5L2KD 1PBYA 3ISWA 3GJFB 5B38G 5KTEH 1EFXA 2B8OT 1MLCB 3B2VL 3I9GL 3M17B 4AEEA 1KIRA 4P2RD 4ACPA 1ZHBB 3HNSH 4RMUA 3QEQB 4ALAH 1BWMA 1CICB 5J6HA 3CZFB 5L88H 1KB5L 1NC4B 2OR8A 2P43B 1WIUA 4FXGB 2VZSA 3UDWC 3VXRA 3MZTA 2ED9A 2YSSA 4GMTH 2K1MA 4OZIE 1HHKA 1IFHH 3TGXA 3ULVL 4NC0B 1J1OH 2XNAA 2JIXD 4WUUB 5GZND 4AIOA 3VGHA 1CD1A 1C08B 2AABH 2YD3A 4D0CB 2J8UF 3LN5A 3ARFB 4JFXB 25C8L 3BISA 2DQIH 4XP5H 2NXYC 3PWVB 1YC7A 3ROLB 1BWWA 2Y5TB 3L7EB 5C0GA 3WXVH 2XICA 3Q3GB 3ESVF 1XGUB 4XAWH 4QXTB 5EORL 3CSBA 3K3QA 2ARJB 1ZGLA 2ZP0T 5GS0L 5DSCB 4J4PA 4OSUH 5GGRY 1KIPA 4OAWA 3O6LH 3U46B 3BRFA 4JRYD 2VR5A 4FQQB 4PP2B 3UTTD 1KENL 2AEPL 1GGCL 5F97E 3UZQA 3C8KB 3MXWH 4WGWB 4XC1L 4N5EC 4MHHI 1N64H 4P2OC 1RJZA 3QIWD 3SDAC 3VWJB 4OUOA 4QT5A 3TA3C 2YZ1A 2BMKA 5FA3B 2R15A 2VYRE 5FYKH 3UDWA 1WTGT 2V5YA 4P5KA 2HT4C 1D5MA 4U1SA 3CFEB 4EUPG 2VXTH 1RK1A 3C60D 1QSFB 5T1DH 3VWKD 1YEJL 4JO3L 4YNYA 4NJ9H 1EEQA 5IESL 4DK3A 3PDOB 2F15A 3K4AA 4Q9QH 3LAFA 5ABDE 4PJGF 1KTDA 2B0SH 4BUHA 2X4OA 1KV3A 2FBOJ 2NNAB 4RGNB 1R24B 2NMSA 4PJFF 5IG7B 5ANMB 1S7QA 1NAKL 4BUGA 5IMKB 4YFLF 3TH3T 3SO3B 4ZTPH 4U6VL 1R6VA 3S6CA 4K3EL 1U8HA 5B3NA 4JFOA 4WI3A 4NM4L 4NZUL 1K4CA 4IS6A 3WN5C 1BECA 4H26B 1TTGA 3LKPB 1QSEB 1JFQH 4CW1B 1YUHA 1FNEB 4JPWH 4JDVB 1YPZF 1EXUA 3MUGA 3N1FC 3RWHA 3SDAA 2IFFH 1A1OA 3TA3A 2AJYL 5D7JA 1IKNC 1A14L 4UTBL 2Y7QB 4F7EA 1XIWC 4C56B 4UIMB 2A6KB 2YR3A 4ISVB 3IDYB 5DRXA 1UA6L 4PV8B 5I8OL 3OJ2C 4PJBB 4NBZB 4OCYL 3NIGF 4CDHA 4I18B 4IRZL 1OF2A 5FOBA 5LVEA 3VXRE 1A6WL 2NY1B 1AP2B 2C4FT 3QH3B 5DRNB 3LQZA 3ZE2E 4JZJC 5KN5B 5CP7A 3D3VB 4JGJA 1G7MA 4WWID 1ZTXL 2AJVH 5EU5B 4OGXH 4J3UA 5ETUA 3CFJB 3TO4D 4F58L 2IAMB 4Z7UF 5EBWA 3BPCA 3OR6A 4JPKH