2MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 37
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg102
4PJFE 2A38A 4B0MM 3CVHB 1IEBB 2G75A 4DCQA 3G5ZB 1IEBA 2G75B 2F8OA 4WVRA 3V8CA 2I9LB 2HA1A 5ITFA 2ZSVB 1GC1H 1XGTB 4LCIL 2XRAL 1QBMH 3QNZA 5DWUH 4P2RD 1DN0B 4X9FA 1TCRA 3VG9C 1IARB 1OQOA 4D0BB 4GRMB 1LEKA 1WZKA 3D9AL 1ZHBA 1NGZB 4M48L 5F7DA 5BQ7A 3MRFB 4B41A 1JNHA 3IYLW 3D9AH 1A5FL 3MRHB 5IROC 4CN4A 2YXFA 1B0RB 4KRPC 4DKFL 3ARYA 4G5ZH 1R5VB 1CD8A 4JG0H 2EXWC 4Y19B 3Q6FA 4M6ML 4M62H 2EE9A 3QHZH 3DMMC 4HCRA 1PGRB 2CUIA 4MNQB 3DV4B 4ZXBD 5T1DH 4LVNC 3NAAH 4L9LC 1JI2A 4L3EB 1K4CA 2VOTA 5EOCL 3KS0J 4DKAA 1FSKB 1FVDA 1U8LA 3ARBC 2CQVA 3T1FB 4TSBH 3CGTA 1X44A 5IBTH 2B8OT 3RWDA 3PF2A 2BVPA 1MFNA 1GC1C 1YECH 1NCDL 1CXFA 3IU4L 2XQBH 2V5SA 4XH2A 5KTEL 1ADQA 3PWVB 4P59H 2XNAA 4JRXD 5JW4R 2OZ4A 4K9EL 3KHOA 3UC0L 2VAAA 4JFXA 3QJHA 1YEKH 5FOJA 5JW4Q 4DKDC 1ZT1B 1I1FB 2DWEA 4ODUB 4A2LA 4LSPH 4NKDB 2J8UF 1MJ7L 4DZBA 1MFBL 1CZ8L 1KEGL 5BVPL 3SDCB 1EK3A 4MB4A 5E6ID 2HT3D 4KHTL 1FZKB 3C8KA 5H8DA 2V2XB 1WBYA 1DP0A 2B2XH 4I8DA 4KZEH 4NN7B 2H1PH 1QEWA 3Q6FB 1DQDH 3HC0A 4HPYL 1OARH 1T4KB 1G7PA 4YEFA 3I2CL 4P2QE 5FHAH 3EIFA 1E6OL 4RMSA 5I17A 2G2RA 1EX0A 3TO4D 4MNGB 2CKBB 4EJ1C 4LLYB 4X4YB 3OXSA 2C3GA 2FATH 1JHLL 3QPQC 2EKJA 3GSQA 4GW5B 4Q9QH 3TJEH 4C55A 1FNAA 1KCSL 1EGJH 4OT1H 3M17A 1FL6B 1ORQA 1F6FB 2J4WL 3RI5K 3MRLB 3DVGB 4JY5H 4Y4KB 4YHKL 2H8PB 5E8PA 3H9YA 3QDMA 1T7XA 5T1LD 2B1HL 1WQVT 4X99B 1RAMA 4LVEA 3PV7A 4Z7WB 4LVOC 1MQ8A 1T21A 1CVRA 4EIGB 3QO0A 4GKOA 3GSWB 1I8MB 3MV8B 3SEPA 1LO0H 2RJMA 1UA6L 3C8KB 4OQ1A 3CXDH 3A6CH 2R23B 2AGJH 4ALAH 4NWUH 4BFIB 2ZNXA 1NQBA 4JRYB 5D4QA 4ODXA 4YXHH 1J0ZA 1F58L 2RCSL 4HQQL 3V6OA 4Q6IA 4TUJB 5IFJB 4CW1A 3KXFA 4JHAH 5GZOC 3MOBH 5DYOB 5LGHH 1DFBH 4NQXB 3V52H 3ZSTA 5JA8B 4NQXA 3QUXC 3RWHA 3BP7A 3KYNA 4K55A 2CIKB 5FF6A 3EGSA 4GS7B 4PJ8A 1J10A 4HIEA 2R8SL 5IIEB 5JIPA 5GS2D 1MFEH 4R90H 1FNFA 4OCXH 5EU7C 1NJ9B 4L4VB 3BDBA 3WFZA 2QHLA 5EORH 1HH6B 1RPQA 4OLUL 2DIJA 4ONHA 5GRJL 4MVBC 1RZGB 2Y07H 3QIUD 3ZKSD 1LNUA 4JM4H 4HF5H 4IOFC 5EU6D 4ZO6A 2NY5H 2O5XL 5E2UH 4QXTB 4ZFZA 4AM0A 4G8IB 5KANI 1I8MA 5GQBA 4K8RH 1YMMD 4HKJB 4L29B 1CE1L 1EVUA 3O41B 1VDGA 2DQFA 4W6WB 3X3GH 1G9ML 2QQKL 5FYKD 5T1LA 4G9DB 5D93C 3T0BA 4KJQC 2OSLA 5E2VL 3BIAX 4RIRB 3BE1L 5GSVB 1QSVA 4WFED 1UADC 5HHNB 4WV1A 5JXEA 1LO4L 4PTUB 1RZ8A 2CK0L 4MJIE 1QSFA 1FC1A 3MOAL 4LOUC 2KL6A 2IPKB 2H3NB 4XCCH 5JLZA 1N59B 4OZ4A 5IIEA 5KN5A 5CSBA 1TZIA 5CGYD 5FECB 4ZOBA 1FVCA 3C6SB 3IAGC 1KFAH 1A1OB 3ECBA 3MRJA 2DKUA 2QJDA 5FFLA 3K8KA 5EBMB 1HHJA 1WEJL 5E1AA 2FYYB 4OAWA 3L3GA 4Y1AE 3T08A 4Y5VC 5K59F 4YHYB 3CDGB 2YRLA 3S36X 3ULVF 4LARL 3CDFA 1FAIL 1XIWD 1F11A 4N1CA 3H3PH 5HHQB 4M1CC 4NFDA 4E9LA 5TE4H 4IRSC 1L9NA 5J6GB 3H0TA 3P77A 4QYOA 1AP2B 1FH5H 4JY4A 3SGJC 5A3IC 1I8KB 1O7SA 2IG2L 1V3KA 5C6TL 4FXKB 1JVKA 3H42H 1SBSH 3ILPA 3CH1B 4NHUA 4R26L 4QXGH 1VGEH 1QHOA 3BJLA 4ZXBA 5K9OB 3PNWA 2XFXA 1FORL 4PGBB 1KLGA 2LAGB 2FX8H 1A7NL 5HI5D 4D9LL 1EMTH 4WW2A 4U1GB 1NL0H 5L7XL 1DBKH 4NRXB 3TVMC 1N3NB 1F8TL 4NN5C 4N0CD 3G08B 1AGCA 1XIWB 1NGYA 3MXWH 5EZLA 1YPZB 4HX1B 1NBZB 5F7DB 4Z76A 2F5AL 2DYPB 3RVTD 4OZIE 5B38B 3MTRA 4Z0BL 5GGVH 4E42A 4KDTC 4CJ0A 2CIIB 1N0LA 3C9NB 1DBKL 3SHSA 3WFEH 4YHNB 2CLZB 4RFOL 5E24E 5DK0B 2GTZA 5EOCJ 2NXYD 4OLVH 1QQDA 3X12B 5KVEH 4LIQL 4M6OL 1KPUB 4RWYH 2BVOA 1X9QA 1YQVL 1HYSD 1T5XA 5C7XH 1HQRA 3PWPA 5IB3B 5KVMC 2GEEA 4LPTA 5J8OA 1WBXA 3QCTL 4KHXH 3H42L 1GAFH 5DF0A 2D31B 3QUZB 4XP9H 2IG2H 3CX5K 4ZPTB 4KY1H 4NOBA 2VIRA 4NKOA 4KU1A 1DQQB 1KG0A 4NKOB 1PSKH 1R3LB 3HS0A 4FFYL 3VFGL 1OOAA 1X3DA 2NX5E 1XGYL 2CK2A 2VUYA 2VNCA 3MMEB 3TF7C 4D8PB 1X5JA 3BUYA 3OPZL 3ARSA 4LVHB 1FAIH 1H3WM 3N50A 4FABL 1D5BB 4PJFA 2VAAB 1PFCA 1H5BB 4YE4L 5E08H 1WSST 2GT9B 1J8HD 2H2PD 2AJVL 3DROB 5B4MC 4P49A 5CKGA 1AJ7L 2NY0B 7FABL 3NIGF 2PTUA 5D1XC 4MGXA 1P4LB 4HWEL 5CJQH 3LS4H 4XXDB 1UWXK 1MCQA 2CO6B 3KYMA 3U7YH 2MPAH 4NQDB 5CZVH 1KYOK 1XGUA 2DI9A 3IFPB 3SCMB 4M7KH 3K74B 3VXSB 1EHAA 1JF6A 2IAND 2VDPL 3HPJB 4GO6B 3VXUD 5F9JA 4OI9A 1ZV5A 4Q97A 5GSRA 5JQHC 5DQ9A 2X4PB 5GGSY 4F7TB 4FQCL 1AD0B 1UJ3C 5J7CC 3QQ3A 5IR1B 4I18A 3VXPB 5T33H 1A1MB 1JZ8A 5T1KD 4GW5A 4GXVH 4KV5F 1LO4H 1GGUA 5JORA 1Q0YL 2Y4SA 1CU4H 3WFHA 2O93L 5E4IA 3X14B 2ZZUT 1Q94A 4PJ7A 4I5BA 5F3BA 3F7PC 1UWEL 1OAUL 1MWAA 4I3SH 1U2CA 4QHUA 1EZVX 1WV7T 4XVJH 4CDGC 3Q5YA 3ZKQD 2YXMA 1W2KT 5ETUB 4K7PY 4L3AA 4QTIH 5DC0A 3WBDA 3UCRA 1MREL 4PJBA 4XX1E 3MLWL 3BXNB 2I60L 3P9WB 1XIWC 4K23H 4G80B 4XNMB 4ZPVA 1C1EL 4NQDE 4OLUH 2AQ3A 4IBLT 1AGEB 3SJVA 4I3GA 4EI5D 1OLLA 2X4OA 4OQTA 3FT3B 2I07A 3EOTL 4OLYL 4E41D 5J1SC 5DXWA 1BQSA 2R8SH 4LDLB 3ZT7A 4M9OA 2LABA 4Z18A 3S37L 4HZLB 3QIWA 3T09A 1A7BA 2P46B 1JFQL 2LAAA 3GMOB 5DRWB 4XCFL 1X5FA 4HS8H 4K3DH 2QHRL 2JIXB 3VI4F 2HT2D 3BESR 5BRZD 1C16A 1S5IH 4X4MA 4MQ7A 1F58H 2RCSH 5DMIL 3CXHJ 3BHBA 1NSNL 3GNML 4RZCA 3TJHD 2VLKB 5DRXA 3QPXL 5KVFH 2FLRT 1YNLL 4GXUN 3FFCE 1HKLH 3UYOD 4EI5B 4F33A 1K3ZA 4Z7UE 2CUMA 2VRAA 1VADB 5T3ZH 2CDGA 3REVB 2IQ9H 4PJXB 2FR4A 4P9MH 1U9KA 3H7BB 1Z6JT 2A0LC 1K4DB 3IFNL 3CZFB 3B3IA 3O11A 1UYWH 2NY7L 4LEXL 5E8OA 1HZHL 3IDIB 3MR9A 4NOFA 5H94A 3I50L 5L9DH 1GOFA 4HULB 2D7PA 3T2NH 2AAVA 4HGMA 4WFFD 2AABH 4JRXB 1MCOL 5EU5A 4NN5B 3QDHA 2JJWA 1PLGH 4AT6A 3TT3H 3MBEC 3FQUA 1E6OH 4GQPH 1YN6A 3E1F1 4LLAA 3UDWC 1YMMA 4P9HC 1F3JA 3WS6C 1M7IB 3H9HB 1I7TA 1LEGB 2EDLA 2GIYA 4PY8J 3MPCA 3K3QA 2F53A 4B50A 3LQZB 2H2PC 1VFBA 3T2OA 2YPVL 4NKIH 1VFBB 4RGMB 2QBWA 3GSUA 2EDRA 4QXTA 1NAMA 2BSRB 4C56E 4IRJB 2FL5A 3NCMA 4O5LL 4TULH 1CIUA 5BRZA 4OFVA 1R3IL 1BECA 5I1AA 3ZO0A 2Q8BH 2EDKA 2FR4B 1OP9A 2BNUB 1I9RH 3OGCB 3P9MA 1AGDB 1P2CA 4MD0B 4PLJD 3D87B 4K9EH 5IG7B 5C9JA 4P23A 4G8GB 5C0DB 2IC2A 3BZFB 1G7LB 2YN3A 1QSEB 3UTPE 3G6JF 2VISA 5KS9E 3JV4B 2YD7A 2J5LB 4Z7QF 2PR4L 3B5GA 2JJTC 2F54B 2W91A 1N59A 1GXEA 12E8L 3K4ZA 4Y16B 2LV4A 4TUKL 4JQIH 3O3EB 4GRLB 3ZE1F 5K9JH 5L88H 4CVZA 5EU6A 2VR5A 4LLMB 4CVZB 2VZUA 1J1XH 1IM9B 4IRJD 2FCBA 1MCWM 3FO1B 5K33A 3BOVA 1J8HB 15C8H 3ZE0E 3ET9F 1XGRB 2WV3A 32C2B 1I7ZA 5IBLC 3VD4A 2ZJSH 5AEAA 4OGXL 3BDYH 2DQTH 1JPGA 3P0YH 2ZSWB 3RTQA 1T5WB 5JXAL 3WS3A 3SE4A 1NGQL 5C3TA 3TA3B 5DWUL 3JV0A 5IB2A 3IDGA 5C9KA 5D7SH 3UTPD 3ZTJG 3O45B 3ZT5A 3SDDA 4N0RA 8FABA 2EDWA 4NO0A 5C8JB 2AK4A 5HHPB 2MQ3A 2CIIA 2W92A 4LSSL 2AJXL 2JELH 1UWXH 4JANB 3S34H 2BXYA 3ULUC 1D6EB 2FECL 5CLTA 3L3OA 3D2UD 1WZ1L 1KT2B 4JFEE 3FQXB 4F3FB 5I16A 2WMPA 2MWCA 3M1BA 5CCKL 2R56L 4N0UE 3PQYD 3VCLA 5LG1A 4P5MB 1QVOB 3A0OA 3FN0L 2YK1L 1AGBB 3LN4A 3MA9L 2CGRL 2YBRB 4KROD 3HS0B 5INCB 4LK4A 3CSYA 3SDXB 3FQWA 2AKRB 5D1ZB 1MCRA 5EOQH 1H9VA 3GRWH 1DQLH 3HUJF 3MRRB 1HQ4A 2A0LD 1RUMH 2IPTH 5IHZB 1SYSB 2DLEA 2DM2A 2XA8H 2ERJB 3MV9E 2F15A 4KKCD 3UBXB 1FJ1B 1Q0XH 1P4LA 3LPGA 1YY8A 1D5IL 3W39B 1FZKA 2VDLL 1BJMA 4KK9D 5KG9B 2VXQL 3T0WA 5JUEH 1RUKH 2EDFA 4TN9A 3P9LB 3K8LA 2WANA 4RGOH 2HVJB 3MO1B 2VLLB 4Z95H 3BDXA 5L8LB 3V0VA 1QO3A 3IDNB 2ZOLA 5I6XC 3DV4A 2ZCLL 3UTOA 4YO0B 4OD2B 4TTDD 5E4EB 4L5FH 4UBDD 3CSGA 1T7ZA 3RY6C 3MREA 3KPQA 3ILQD 4X6FB 4P57B 1A64A 3HZMB 3DI2B 3HZMA 1GGTA 5LCVL 1EUUA 1QVOA 3OJDA 5CUSL 4PV8A 4XCNA 2VLRE 2RGSA 1EUTA 1P69B 1BQHB 3M17B 1OAKH 5A3ID 4KKLD 4Z7UA 4WEBL 2HTLD 2A1WH 3T65B 4HWBH 3HNVH 1EO7A 4HHAA 5FUOH 4G42A 2Q7YB 3GUTA 1T7VA 1YC7A 4XXCA 5FGBC 5L6YH 1XGUB 1GGYA 2MJWA 5FO7B 5D8JH 5IEHA 1YDPB 1U3HB 3O2DL 2QADD 3CSPA 4JY6B 5SWSE 1JUFB 3JTTB 5BV7H 3IJSA 4DEPC 5IT2H 3SE9H 4CKVX 2Q3AA 3AMKA 4YAQB 2DBJA 5J1TC 2Y06H 5FEBA 1DQTA 4CVUA 4G80A 3KXFE 3JWOL 4EDXA 2R4SL 2V9QA 1MRFL 4PGCB 5D7KE 5HD8D 2ZNWA 4L9LB 2ZP0T 5I76A 3ZKXB 3MRGB 3AS3A 3TNMA 4AK1A 3KXFB 4PS4L 3UYPA 5B39B 5DJ2B 3N9GH 3VXRA 4L3EE 3GJFB 3BWAA 1A6UH 2DYPD 1E4WH 1ZKAA 1J7VR 4G8EA 5HYQB 4K3JH 4K2UL 2YD9A 2D7QA 2I27N 4DVRH 4XPBH 1KB9J 5KSVB 2Z35A 3U2SA 4KGJA 2OJZL 1OAQL 4M5YH 1NEZG 3Q1SL 2UWEA 1NLBL 3BEWA 4X6CB 4YFLF 4OLWL 3BEWB 5A2KH 1ADQL 4KJPC 4J1UA 5DK2B 3UYRL 5LGJA 2BY3A 4KJWD 1JK8A 4M7LL 4HD9A 1YEEL 3MLYH 5ID1B 2KQMA 4BKLB 5SX4I 4G8IA 3NZHH 3AAZA 3MA9H 1JPSL 1M05B 2ED8A 2NZIA 3KXFD 1CDIA 1TPXC 1MHCB 3SKJH 2F54D 1OGTB 1MHCA 5JO5A 2GAZB 2HT3C 1PAMA 2NR6D 3HAEB 5DVOA 3EDFA 5I0ZA 3O8XC 3RY6A 1CLCA 5DHYA 1PG7H 4R3SB 5J9PA 4LNRB 3THMH 4QOKD 4BSJA 3CFEB 4XC1L 1YMMB 3ZE2E 2YMXL 2SEBA 5BS0A 1XF2A 2HVKA 2EIDA 1DE4B 3NN8A 2BSTA 4MJ6B 5I6XB 4P3CL 1UQSB 1CGSL 2HRPH 3CLEH 4HXAH 4XHQA 2R1WA 2V5MA 5CILH 1HWHB 2P8LA 1KN2H 1LE5B 1RUAL 1PX4A 3MYZA 2X70A 1A1OA 1UM5H 2W0PA 4XNUH 1BQLL 1HDMB 4R4BB 5HGAA 2AJZA 4U3CA 5F9OH 1BVLB 5DUPH 3P0YL 4HMEA 4WWID 4ZTOL 3NFNB 3NFNA 3QUYC 4P3DB 1OAXH 3T0XA 3OG4B 5L8JB 4HJGA 3CMOL 5E1AB 2YRPA 4G43A 4RDQF 4N8VB 2ID5A 1QG3A 2PXYC 2FSEB 4JQIL 4MA3A 5L88L 2VDRL 1R3JB 1BMGA 2AK1L 1NMBH 3RAJH 1J5OL 1R3JA 3VFRA 3G9VA 5HHQA 2ICCA 3Q6GL 5DJDA 1S9YB 3O3AA 1U8MA 3F7QA 3LZFL 5DK3A 3BT2H 4J7RA 4LLUB 3OJMB 3IJYB 2EIEA 4C4KO 5F9WC 5JR1L 3KNBA 2VXUL 4MQXC 4R4FH 2EE3A 4KKLC 4IDJH 1JHKH 3IXAA 2QTEA 3N1FC 4PJGF 1I9RL 1IC1A 2RIKA 5EO1B 4JCLA 5H2BB 4P46A 1H3UA 1WWWX 1XCQB 3VWJB 5EZIH 5DZOA 1M4KA 1XCQA 3VWJA 4TULL 3ECBB 1F4AA 4LSUL 1S7WA 4AG4L 3UJIH 1UWGL 3FT4B 4YPJA 3A6BL 3AFLA 2EEDA 1DN2A 1XCTB 5C07D 2ED7A 1FNEB 4ZNCD 4LAJH 2H41A 3B9KB 1B4JH 1DLFH 1XGQA 4YHNA 2P5ED 4QHLA 4S1DD 2YR3A 1PLGL 4PG2C 6FABH 3GM8A 3BMVA 3MFGB 4DAGL 2MTPA 5JTWA 4KRNA 4DTGL 4BUGA 1LMKA 4HKXA 1U8LB 3F7RA 4HFWB 4CAGA 4IMLB 1QPPA 4PGDB 4NYLA 1JHTA 1FN4B 4JPWL 3ARPA 5DMYA 3DUUA 3I6LD 4KTDL 4TVPE 3VXUE 4X7SH 5JNYB 3GJEB 1R24B 3WNNA 3HMWH 2ZSWA 3RTQB 1JF5A 3TBSA 1HHGA 3LQMA 2VXVL 3RNQB 4M9PA 1CD1B 43CAA 3QUYA 1JZ2A 2NY6C 3MLUL 4NO3B 5KJRL 3CU1A 2YBRA 3MRRA 1HKLL 4ODUA 3T4AA 2QKIB 5CKAA 2X1OA 1D3CA 5CSZA 1I4FA 3PHQB 1ZEAL 2I25N 1HSAA 4LAQL 1I7RA 3CVHL 2AV1B 1NSNH 1UENA 1Z0MA 3B4NA 1G7HA 4LLVA 3LKOA 1CDJA 1KJ2A 2D2OA 1UEYA 1J05A 1T20A 1V8HA 1FJ1A 4NN7C 4ZFOA 2X4SB 1ACYH 1HH9A 3VXRE 3O2VL 1E6JL 2YPLB 1RZIB 2HFGH 4J4PA 3PL6B 2UZXB 3GMNB 4JGMA 1NUGA 4XPHH 1TNNA 4ZFFA 1S7SB 2YUVA 1HHIB 3VRLF 5IQ7L 1HHIA 3ZTNL 3VE0B 1E4XL 3GSQB 5LKNA 5C86A 5T5FH 2CXKA 2VLJD 4OIBA 1A4JA 1OD7A 1BEYH 5JOFB 4K23L 4FQQA 4JFDB 4P2OC 3RWEB 2A74B 4DK3A 1CG9B 2GYSA 1MRCL 3SKOB 1KGCE 4Y4HC 2GSIA 1QSED 1FZOA 4Y2DA 4PP1C 3WDIA 5C0CD 4M3JA 2WLYA 3DECA 2NZ9D 5DFWH 5ISZB 2D03H 2R2EA 1NAML 1WIUA 1MCSA 1J0IA 1UWEH 1JUFA 3BGAA 1OL0A 3TVMD 3ZTNH 5EUOF 3WLWD 4OTXL 1RIHH 4PJAF 4XPHL 5EUOB 5CP3A 2ICEA 3H2WA 3ZT6A 2AXHA 1FYTA 3IGAA 2HT4D 2QQNL 4J12A 3QG7H 3AXLA 3MRNA 1EIBA 2VE6A 2GJ6D 2EYTA 1G0YR 2H26A 5EDXA 2WK2A 4DUWA 5DJ2A 3QDJB 4LF3B 1XF5B 4OF8A 2BOCA 3EJYC 1RZKH 2CDFA 1IGML 4IIQC 4BZ1L 3H9SA 4Z7QE 4ZUSB 5FUZH 5HHOB 5KVDH 4I77H 2BVQA 3LCYA 1C08A 4YUEL 4L4VE 4F57H 3ZKXC 5B39A 5DVNA 3V6FA 2HFEB 1JNJA 3ZE1E 5MEPA 3OG6B 2VXVH 4QRQA 5I66A 1BZ7B 2ORBL 4ZNEE 2W0FA 3C5ZA 4QGTA 1J0JA 1GIGH 3A67L 4IOIA 3F5WA 4JPWH 2X42A 1EXUB 1ONQA 5I8CA 2EIZB 3FFCA 3RVXD 4KK6C 3ZL4L 4FABH 3HE6A 3RGVA 3FB7B 3FO2A 3VWKD 2Y36H 1N5YH 4MA1C 3ABZA 4FFYH 4YBHA 4Y2DD 4IRZL 2ATKB 2YN5A 4H1LB 4XGZB 3VJ6A 1JRHL 2IWGA 4I4WA 3GSNL 4ODHL 3ZDYF 3I3BA 1ZMYA 3VFMB 2NY1D 1DANU 1RULL 1DZBA 4PJHA 3L9RB 5MP6H 5C08D 5BV7C 1PJ9A 3KHQA 5E6IA 4KKCC 4KK5D 2FHCA 3GMPA 4LDEB 4WW1A 1IGCL 3IDJB 4ZUTB 4N5UA 4KK9C 3UJIL 5DGRA 3ALXA 2MCG1 2GTWB 2Y9RT 2GW5A 2GTWA 1F4XL 4FFWC 3NZ8B 4BELD 3FONA 1MLCB 3CAFA 4GG6F 1D9KA 1P1ZA 3MXWL 4R97B 3O8XA 4U1MB 5C0FB 3E6FA 2FL5B 2VERN 3S7GA 1ZSDB 1CDGA 4NUGL 5IB1B 4F80A 3QEQB 4NC0B 4PJ5E 4N8VA 4G6ML 1DDHB 5K9KA 4WTXA 5JW5B 2UZIH 4P23B 3SE3A 3DGCR 5D2NC 5I8KL 3RWJA 3ARDD 5I1DB 5C6TH 4PUBL 5T1MA 3U0PB 2VISB 3FB5A 5E6ZA 1MEXH 3D18A 5JOEA 3ZDXF 1WC7A 3CSBA 2ARWA 2CR3A 1P7QD 4HH9A 4U3HA 1JWUA 4LARH 2P8LB 2PW2A 3O3EA 3MGAA 4GRLA 5T5NF 3C2AH 3EYVB 3K81A 4Y5XA 5DQJB 3T3ME 1BOGA 4JM2C 5HD8C 1C7TA 4WW2B 1I1RA 3TO2A 3SDDC 5CILL 1FIEA 1KIPB 4IS6B 3O2DA 5EULV 5F6HJ 3KLAB 3TJHC 2H9GB 2HRPL 2C7UA 1QFWL 4HXAL 3LPWA 3K4DA 3K1DA 1T5WA 3SY0B 4U6TA 1S9XB 2PKDA 4ETQB 2J5LC 3BX7C 3BSZH 3MLRL 1ZGLB 1VFUA 3NIDF 4OF3A 3I9GH 3MRCA 4F2MA 3KWWB 4HUVA 5K9KB 4LSVL 2VLME 5I74C 4OZFA 1HI6A 5JPMB 3EOAB 4AEIH 1XF4A 4XCYA 5JHDD 3GI8H 3B9KA 5GGRB 5A43C 3DGGA 3PWPB 1YJDC 4QKXB 4C59B 4GBXB 5DRZA 2W9LA 1BJ1H 4MWFB 5F97E 2G60L 4FFZL 4CL7A 2V2TA 3KYAA 3MLYL 4KKBC 4ERSL 5D7JC 3P4NB 3ES6A 3GMRB 4N8VG 4U6XB 5HGBA 1U95A 2BC4A 4NQUA 2HMID 3DX8A 4OCRH 2VL5B 4TNWF 5C0CB 3Q1SH 4Q6IC 3STLA 3VGGA 5MEOB 4NO3A 3IFOB 1TJGH 4TQEL 4J3TA 4E41B 2ZKHH 1ZS8A 5GRUH 4JM4L 4P4KC 5IWLC 1AGFA 3NMEA 3WUZA 4KI5C 2EEBA 3V5KB 1WCBB 1JTOA 1SQ2N 1AH1A 4RWHA 1TXKA 4PJ8C 1JNNH 4ODSL 1U8QA 3O6FD 5F89B 4NKDA 5DT1L 2K9UA 4YHOH 3UZEA 1FL3A 2X40A 4I3RL 3H9ZA 1LO3H 3JWOH 2JCCE 1A7QH 3TBTB 1E28A 4MD4A 3LN9A 2WINA 1T5XB 4OFKA 1WITA 1Z2KA 4KK5C 3ZDXE 4WEMB 4QTHB 5IT2L 4K9EC 1WBXB 1J18A 2WM0A 3G6AB 4TVPL 3VXME 2WP3O 2ZOLB 4JDTL 1UCBH 5J13B 4XBEH 4FFWD 1P5VA 3S5LB 3MRPA 5EU3A 1X5XA 4CU6A 4EI6A 4WI3A 2A1WL 3VRJA 3V7MA 5SWQA 4UIKL 1FZOB 3DSNA 2WUCL 43C9B 5DI8B 5C70A 2JK5B 3CUPA 5CJXC 4Z7UB 1P84J 4ONFH 1OB1B 1FZMA 3T2QA 5C0EB 4Y2DB 4UU9A 5GPRA 5HYJD 2ZCLH 5D1QB 1EGJL 3F7VA 3SKUD 4YNYA 1GZQA 2HAZA 3F7YB 2J88L 1ZGLM 3MZTA 1RD6A 1RZIA 4HCRH 4O4YL 3FHAA 5F21B 4X5XA 4S1RH 5DEFB 2ATPB 3BEVB 4PRDA 4DQOL 4JM2F 5FHAL 3L1OH 4J23A 1INEL 1Q0XL 4L9LA 5IR1A 4OUUA 4HPYH 1XH3B 4LLWA 4MA1B 4TOYH 2QADB 3G5VB 5ID0A 4PIRF 1HCFX 1DVFA 1DL7L 1QFUL 5I15L 1WFOA 2Q76B 5F88A 3TNNA 2FHFA 1S7RB 4AIZA 1BZ7A 3KYOA 4YWGL 2P4AB 3HC4H 3IDXH 4D0CA 1FGNH 5CEYA 4X99A 2N7BA 3QCUL 4QHUB 2EDQA 4LP4A 2HFEA 4UT6L 3STZB 1KELH 3LN5A 5ICYB 1JGDA 5CCKH 3AMLA 2OR9H 1IJ9A 2AEPH 5SV4A 3FRUB 5EUOA 2VQ1A 1L7IL 4JZOB 4DN3L 2EH8H 1JJUA 1J1OH 4PJBB 1NANH 5KTEH 4JPIA 4JPKH 2PYEA 3F58H 4JKMA 1BD2E 1YECL 2GK0A 4HAGA 2MHAA 4ISVA 3BGFC 3MUGA 4FQ1H 4NJAL 1L0YA 5EOCH 1GJIA 2B7DT 3EO0B 3SO5A 3UPAA 4PJEB 2B4CH 5FDYA 4NM4H 3VFMA 5GISH 5J4MA 4MZ2A 3SCMD 4XWGH 1YN6B 1B88A 1EAPA 1S7XA 2CJUH 2P45B 4DKFH 1A5FH 3L3DA 3C2SA 4X4XB 2C9AA 3BDYL 4OD3H 2F19H 4NZTH 2ZJSL 2W9EL 3AY4A 1C5CL 1DEDA 4HIEB 4M7JL 4OZ4B 4P4KD 1EFXD 2DLHA 1IEAB 1EV2E 2IFFL 3FFCB 1CE6B 5FO9A 5I1EH 2XA3A 1MCPH 3VXQB 3UJTH 4PRHA 4FQIH 4P5KB 5ADOH 2EKSB 1MFDL 4M1DH 1PZ5B 4R96B 1K6QH 4A2MA 3KPSD 3OB0K 1D5XA 3EYOB 1SJXA 4ISVB 5IHLB 1HHKB 4LSRH 1BLNB 1F4YL 2B4CC 3RZCD 1P7KB 5BOPA 4YZFF 4KROB 5L2KE 1VFAA 1BP3B 4I0CC 3WNPA 3VU2A 2YC1B 5I73C 2DQEH 5FOBB 5C07E 3WIIH 3BP5B 1U8MB 3TN0B 1JGVH 4QYOB 5I1KH 1R3IH 2MMXA 2ZUQB 5I2IB 4QRPD 3DNKA 3H8NA 3S96B 1A7OL 4XWOD 3DV6A 3VD9A 3DUSB 1BFOB 1BGXH 5FM5M 2FJHA 1MIEL 3IJHA 4K94C 4O02L 2YPVH 4OM0H 4YK4B 2OTPA 4OIAA 1M7XA 1BOGB 2FBJL 2MKLC 5IB1A 1BM3L 1U58A 1BZ9B 1ZLSH 3FTGB 4NHCH 5IJVA 4OCSL 4WW2C 1CXEA 1I3GH 5EOTA 4FXLA 3U46B 5DS8B 5DR5L 4EI5C 1FNGA 2QSCH 3MACH 4OZFB 4AQOA 5C0DA 1MWAH 1MCOH 4WWKC 2F58H 2AEQH 5DC4B 3TN0D 1MHPL 5GRVL 2J8UB 3U0PA 5KSAA 3D3VE 1AD9B 1T6WA 4NQEA 1HZHH 3S37X 4LEXH 1IQWL 5JDSB 1OP5H 1ZVYA 5FDWB 3RVXC 1A3RL 3NABL 1F3DJ 4U0RC 1FNLA 4PLKC 1GZPA 3HMXA 3L7EB 5T3ZD 1PX3A 4NO5A 2IQ9L 3L7EA 1OPGH 2BNRA 1XMWA 4KQ4H 2VUOA 2F9BT 5JHLH 5F1KC 3V0AC 4F7EB 3OKDA 4HWZA 1U3HD 2VAJA 3DV6B 1X5GA 4V2CB 4PTTA 3IF1A 4HFWA 4MJ4A 3STLB 3OB0H 4D9RE 1A7PL 2YRZA 1D5ZA 4Z7OE 3U0WL 3EFDL 2DLIA 3QPXH 4V1DB 1DBBL 5HGBB 1I7ZB 1X5YA 3MV8E 4GRWB 1LD9B 1PKOA 5MENA 2DF3A 4Z0XB 1NCTA 3VFNA 4Q2ZB 3VRLE 3IKCB 2ZSVA 1ZHNB 25C8H 3QZWB 4AEHH 5D96B 4RBPH 4U1JB 4QEGA 1TLKA 4K3DL 4WHTB 3GHBL 4X6BB 5C0JA 1EGJA 1QRNA 4G9FE 4XPFL 3QXVA 1ZA3B 1U93A 3EDEA 4MXWH 3MRKB 2E5EA 3QFDA 4HAFA 4XPFH 1A47A 4EZMA 2V2XA 1M71B 2J8UA 4JKLA 3LKOB 4XVUC 4X7TA 1JP5A 3BGFB 4J3VA 4KRMB 2VLLA 5KOVC 5IK3B 25C8L 1CFQB 3QA3B 1RVFL 2W60A 4I2XB 1X5ZA 5HVFB 2PYFA 4V1DD 4Y4FB 3QRFM 3MLWH 4F8TA 5C0IB 5CSGA 2ZUXA 4N5ED 4AMKL 3U0WH 4F7EA 5EU3B 5ACMA 2X89D 3S35H 1AD0A 1YA5A 1FO0B 4OKDA 4H0IA 5I1CL 4WNQA 5SWZE 1FDLL 4XVJL 4JFZL 1H3PH 3LD8C 1KYOJ 3QULA 4KQ4L 1FL6A 5A2JH 3S5LA 5FUCE 4DZ8A 4F9LA 2AEIT 3T0EC 3ARDB 1OW0A 5FYJU 1NMAH 1CU4L 2B0SH 4BH8B 1TETL 1AHWC 3G5YB 1JV5A 3QDJE 4QRTA 5D1QA 1T03H 3JTSA 2AEQL 3PHQA 3V0WH 2VLJB 5KSAC 4WI6A 2A6DA 2QSCL 1ND0A 3B43A 4FQCH 3PJSA 3Q5TA 2YA2A 4MB3A 2BNQE 2VXTL 3PABA 3L3IB 1NFKA 5CBEA 1TZGH 3AB0C 3W82A 5LJYH 3BEVA 3F7VB 4N0CC 3SGEI 2X09A 3V2AR 3MCKB 1BBJA 4GKSA 1AI1L 1CTOA 3L7FA 3S4SB 1SY6H 4YHLL 3VI3E 3U7YL 5I17B 4OM0L 4ZFFB 1OP3K 3J7HA 3QI9C 1KN4L 1VA9A 4Q9RL 5CLWA 4HXBH 4JVPA 1PKQB 4HWEH 3TNNB 5FYKE 1GVIA 5E9DA 5E99L 1T7WA 4YXLL 4CGTA 2DTMH 5CEYB 3WIHL 4U1NB 1MHEA 4ZTPL 3SKMB 5ACZB 5ID0B 2EECA 1G7JB 5IFHL 5E08L 2X4UA 1CLZH 4YE4H 3BPOC 5DHVH 3CDCA 5LQBL 2HKFH 1SJEA 4M1GL 3T65A 4XZUB 3QDMB 2BY1A 5C0EA 4GUPB 4KKBD 2ZCHL 5ESAA 2V5TA 3OKMA 4IOIB 4WWKD 3JTSB 1GZQB 1IGTB 2HFTA 3F7YA 3HAEG 4GLRI 1GYAA 1RIVL 4KHXL 3HE6B 1FGVH 1EO8H 1K6QL 3ARRA 3QUXA 3OKYA 2Z31D 2I07B 5SWSB 4OZHE 1MFDH 4TUOA 3RA7H 1AKJD 3LKNB 3TBWB 1MHHA 3IFLH 1TJIL 1BBJB 5ICXB 3VWJD 4PJHE 2A6JA 4C57C 3RKDC 5E7FA 3P4OA 5KZCD 1UB6B 1WT5A 3QWRD 4CVXA 2C3VB 1FQ9C 4BSWB 4PJHB 4Z0BH 2E7CA 3T77A 4F9LC 4OD3L 3OXSB 3E2HC 1W0VB 4ZFOL 1MFCH 3WXWL 4TPRL 4KRLB 4AH2A 4ZUUB 3K2UL 4ZUUA 2CJUL 2PCPA 3V6OC 4WFGD 1BD2D 3IVKB 2FB4L 1T22A 3BPCA 2EDYA 4AL8L 1VESA 3ARVA 3VA6A 1TVBA 1G0XA 3VXQA 2QV2A 1JK8B 5C2BH 2VDKL 4J1UB 5DK2A 5LGJB 1MNUL 1H15B 2ICWI 3E6HB 3F5WB 1F4HA 3FJTA 3P0VH 3I02B 1A9EB 4UB0L 2PO6C 4L29A 1GGIL 2C1OA 3CPLB 1IM3A 3GZKA 1N8ZA 1S9KC 3MR9B 4G6JL 5CZKA 4P5KA 4UT9H 3HNSH 3H7BA 5D6CA 3RQ3A 1I8LC 5HHMD 1EFXA 2BCKA 4I4WB 4X8XA 4BSVB 1I9EA 2BNRE 3RWJB 3UTTB 2P5EE 3ILQC 1IC4H 1YEHH 1AHWA 4EDWH 4NNPH 1CQYA 3NCCB 1ZWIB 3QCUH 3U9UB 1I7TB 3WFCL 3QEQD 3IDXL 4RBPK 1C5BH 4OQTH 4ZUVB 5E8DH 4RFNB 1TZIB 3CVIH 5I15H 5FYKH 2A73B 4WENB 1G1CA 2BSRA 1LEGA 1HHHB 2DRUA 5HI4D 1MJUL 4HIIA 1INEH 2VITA 4A6YL 4HIIB 1D9KB 1N6UA 5C09A 4DQOH 3CZJA 2B5IB 4NCC1 4S1RL 1NFDB 2BOBA 2Q20A 4URTB 3LRGA 4LASL 1NFDA 2JJVA 3MOAH 4JJ5B 1QRKA 3WN5A 1OGAD 5CHNA 3TPUB 2XN9E 1INDL 3CDGA 1V05A 1MRDL 1CDHA 2OMNA 3EYSL 3PDOA 1J0KA 2OL3H 1P9MC 3LVEA 5TQ2L 3DETD 4JDVB 1XGPA 2HP4A 2EH7L 1QSEA 3RL2B 4YDLB 3EAKA 3F62A 3X3GL 3RGVC 2BNRB 2YEZB 4MAYA 1JL8A 1U6AL 5C92A 4M43L 2HG5B 5E2UL 1NGXB 2FZ3B 1BHGA 3MGOB 4PRHD 2EDTA 4F7CA 3P4MB 3D25A 4NN6C 3IXAB 1G84A 2R0ZL 1UCBL 3CNKA 4OFPA 2APBA 4D8PA 4KJYA 5EBLA 1TENA 4KUCF 3KR3H 4P2RE 1I1AD 3CCHB 3B8YA 3HCVB 5HDLA 5ITFB 1H5BA 4QRSB 4O9HL 1CQKA 3QXAA 1UVQB 1EHLH 2YKLH 3NACL 5DC9B 4BYHA 3MBED 4OZIA 1U8IA 4HPOL 3P0GB 5HHVH 1DQMH 1YPZA 4HX1A 2F74A 3GMMA 1IFHH 1AGCB 1XIWA 5DJ8B 4XRCB 3SY0A 2Z31C 4PY8I 4NO0B 1LO3L 2IMNA 4S1SL 4G3YL 4XC3L 2R69H 3MOBL 1KTRL 5AD0A 4ODSH 3WDJA 3EDJA 4XPAL 3ALPA 2E9BA 4PJCA 3WNKA 2A83A 5D1ZD 3SO3B 4ZQKA 2R2BA 5F72S 4ALAL 4ZQKB 2AGJL 4F15B 2ADFH 1QA9B 3ARFD 4P4KB 4TNVK 1TJGL 1KEMH 4M43H 1HN1A 2PYED 4PLJC 1SYVA 1Q1JH 1NGPH 2Z9TA 2KUTA 3O6FB 1X4YA 1UZ8B 5DMKB 3FL7A 4ZPTA 1JZ5A 1NLDL 4YHZH 4YO0A 2J1KA 4V1DA 5EIIA 3GJEA 1MLBB 5JNYA 4P5TD 4ERSH 2VDQL 2XACC 4Y8AA 3CCHA 3HCVA 2V2WA 3S9DB 2AI0L 4Y8DC 4LSTH 2GSIB 4X9BA 4YHKH 3RY5A 3RZCB 3FOMB 1T1ZA 3PHOA 4U4BA 4Q9QL 5IMOB 4L3CB 3HFMH 3BZ4B 3TCLA 4LASH 1JMXA 4H0HB 1NUDA 3HZYA 3OHXB 4M6NH 3KYMB 4PJ9A 3UO1L 1Y6KR 2GCYB 3P73A 5CBEB 2P5WE 1CLYH 4GG8A 2HKHL 1A2YA 3QXUA 4O58L 4QRPB 3FO9B 4L1DA 3QUZD 3FZUD 2OI9C 2A6DB 4WHCA 1NCAH 3U7AA 4FOMA 4GRWF 4XTRC 4LQFL 2X44D 2CH8A 1FVDB 4OQTL 4G6KH 3VXPA 1C5BL 3QG6B 3QXDB 2X4TA 1W8NA 5E0QA 4OF0A 2UWEE 3C8HA 3TWCL 2GSGA 3EKCA 3U7WL 3L7FB 4TNWK 3S4SA 4GH7B 4LSPL 4X0KB 3PWVA 1QRND 1S8DA 3O6LL 4P2OB 4JQVA 3WEXA 2A74A 1INQB 1FC2D 4PJXE 3K4AA 1QSEE 1FE8L 3HC3H 3X14A 1IC5L 1MH5B 5CD3A 3N1PC 4U1IA 3NIFE 4HIHA 5LAXA 4CU8A 3NPSC 5JHDA 2XQBL 5E94B 4WDIA 3BO8B 2BHYA 4PUBH 1G9NL 3U1SH 4MAUH 2OZ4H 4XP5L 4PLNC 3TH2T 5I8CB 1A6AA 4PB9H 4UB0H 3AREB 3OKEB 3T0DA 3FAWA 3IDYB 2FD6L 4WI7A 4UQ3A 3BP6A 3EUUA 1HINL 1PQZA 1HNGA 3VG0H 3MODL 1FFRA 2EXWD 5DJ6A 2WQRA 4AL8H 2R0LH 3VXSA 5BJTB 4M62L 2R2HA 3SDAD 3DYOA 4R8WL 4G5ZL 1YMHB 4ZOAA 1QD0A 3DIFA 2Y5TA 3UXFA 3WXWH 5C0BD 1MFCL 3W9EA 1FNSH 2IF7A 5J12C 3H9SB 3QXDA 5HPMB 2VZOA 4NGHL 1MHEB 5AZEH 3SKMA 3KPSE 2PF6A 2XZAH 4N68A 4XVUD 1NBVL 4MNQE 1DVFB 1NC4A 1QBML 5HYIA 2JIXA 3OMZA 1KULA 3GSOA 4HS3A 5B21A 5DJZB 2ZCKL 4Z7VE 3WO4B 4X4XA 5BS0D 5MEPB 4PJAE 1NBQA 1TVBB 2DJSA 3UMTA 5JHDB 4TTDC 4M5ZH 1UH2A 4N5EC 4X80L 4ODHH 4OGYL 4UNTA 3SDAB 3VGEA 5CJ5A 5FO9B 1O0VA 1RUPL 3FB7A 1YEGH 1GPOH 4YX2H 3CK0L 5GGTL 2BX5A 3QRGL 5J6HA 3BXNA 1V7NL 4LCCC 3MLVL 2Y36L 5TH2B 4HIJA 4X7EC 5JW4M 5IM7A 5IJKA 2CRZA 3CZFA 1EAJA 4XGZA 3V5DA 1WISA 4S1QL 2HKFL 1LP9F 3DIFB 1UG9A 5FIEA 3VW3L 3K46A 1U8KB 5CD5D 5SX5K 3OKOA 4X5LA 3A67H 5I1GL 1GIGL 2YZ8A 5E99H 2QADC 4XP6L 5D93B 3BKCH 4QWWC 4PJEA 4P5TA 3FQUB 3QIBC 4K3GA 1LHZA 4YHLH 1T80A 2BDNL 1UJ3A 2OJEB 1SY6L 1AI1H 2NW3A 1NJ9A 3F12A 1XF2B 2CLRB 3DARA 5ALCL 1EEZB 4Y4HD 2HTKC 3LQZA 3AS0A 1OSZA 3HUJB 5ANMB 4YQXH 1J1PH 3QDGA 4R97C 5F9WB 4R9HA 3MYJB 1AFVH 4WHYH 2W07A 4XVSL 4JR9H 4C56A 3MLSL 1NPUA 4L8DA 5A2IH 5F7MC 4GG6B 4P46D 2FEEI 4WY7L 1UT9A 3QEGH 1LP9E 2NXYB 5DMGD 1GHFH 5IJVB 4K8RC 3U30C 1BZ9A 4NQCE 3ZE0F 3GBLA 3RWFB 2MCPL 2MFNA 4I2XE 1PD6A 4ODVH 4HV8B 1YNTB 3TC9A 1PG7W 4MA3B 1CL7H 3PDOB 4MDJA 5EIQA 1XCTA 4WTZG 5E2WL 1TNMA 1A1NB 1VFAB 3T0EE 3TH3T 4FXKA 2P5EA 3GSVA 4JRXE 5TF0A 1VHPA 1VGKA 1AC0A 3BGMA 4NQEE 1T83C 3Q2CA 1MRCH 2R15A 3QWOB 3BGMB 2V7HB 5J6GA 1JWMB 3RL2A 1WFUA 2IH1B 5D72L 2OJEA 2DS4A 3D69B 3UTSB 3VGAC 4P46B 2DN7A 3PIQA 2Z8RA 4KQ3H 1ULVA 1T66D 1KENH 4MVBD 2XN9D 5JXED 2NY1B 3HUJA 4YDJB 1R5WA 5ICZA 3KLDA 1UVQA 1ERNA 4PRBA 1JYWA 3PNWB 1KIPA 1EZVY 4IS6A 5JMRA 1JGUL 1WZLA 1L6XA 2D4DA 3V5KA 3WNLA 1XGTA 3VWKC 4H88L 3VXSD 3MA7B 1V3MA 5F7HA 2NY2D 4NBZB 2CLZA 1WUNT 1U93B 4XRCA 3GO1H 3Q48A 1NUFA 3ZDYE 3W39A 2IQAB 1TVDA 2EDBA 1T2JA 3EFDH 5I75C 4ORGB 3MUHL 3ZKNC 3QO1A 4EUPA 3D85D 3RX5A 2VN4A 3O3DA 3QUYD 1EPFA 4RX4A 3SOBH 5KJRH 5GGSB 4LOUD 4GOSA 1ZTXL 1FFOA 4MSWA 5HYSG 2YD1A 2FJFA 5FGBA 1HQRB 5E70A 3BH9B 4X7SL 4NRZB 5EU6B 4ZD3L 1HSBA 2CSPA 3HE7D 4WUKH 1MI5E 2BVTA 2ADGA 1NCBH 2H6PB 1CGYA 5T1KB 3GMLB 3VGFA 4S0SD 1MHPH 2AKRA 1GSMA 3DROA 2VC2H 4N8CL 3CSYB 4ZOCA 1A8JH 2XNAB 1R3HB 1KB5B 1JWSB 2N1KA 3TCLB 5AWNL 5HYSB 1WCBA 4NC1C 4EIZC 1I3GL 4PPTA 1FSKC 3LSOA 4OCSH 5FYLH 4L8SA 4P2QA 4XB7A 5H35A 3IAPA 2X1PA 4ENED 1B4JL 3K0WA 3JSSA 2J8HA 4TSAL 2VABB 2FBJH 3OKLA 4B7LA 1GCFA 5CD5C 1K8DB 3EO1B 3H9SD 5DJXB 3TT1L 2GCYA 1FZJA 1MIEH 3X13A 1KNOB 5DEFA 4OCYL 2J7LA 4P23C 2FGWL 5FCUH 2Z93A 4LSUH 5DD6B 2DJUA 1JRHI 4YDKH 1ETZA 2BHZA 1A1MA 1I1YA 3QDME 3KJ4B 4R0LB 4ZDHB 4X6DB 3WIIL 1WAAE 1UH3A 3V6ZA 4IDJL 4KRPD 1VEPA 5HYJA 1XF1A 2QSTA 4WHDA 1BAFL 2MQCA 4XCNB 2F5BL 2X4UB 3RHWK 5GHWH 1IGJA 1RZKC 3V4PL 3LZFH 1CK0L 1CDCA 1R0AL 4UOW0 3TBYA 1J5OH 2XTJC 1JBJA 4QRQB 2AK1H 3HI5L 4Z7WA 4MXVE 3BAEH 3KPRE 4XAWH 4JFPB 4JHBA 3UJTL 1MCPL 4NNXB 5E03A 2MQ0A 3V4PH 3GSWA 3QO0B 5GRYA 3SJVB 4JY6A 4JAMA 1QLEL 2IFFH 2ZOKB 1ES0B 3ARGD 1I3RA 4YAQA 2WZPD 2X4NA 1ZAGA 5KG9A 1NH6A 1VCAA 1JI1A 2WUBL 2X4NB 4M7JH 3PABB 4WO4B 5SWSA 3WL9B 1VSCA 1P6FA 2F19L 4NZTL 4EN3B 2Z93B 4PRDB 3MNVB 1FLRH 1BQLH 1HIMH 2GSGB 3MCG1 1DEEB 3FQRB 3KPRA 4LCCB 2WWMC 4CVXB 1OGAA 4UQ2A 3P4OB 4U6VH 1CF8L 2R0KH 1UZ6F 1NMCC 2YSSA 2Z31B 1CGSH 5C0NC 3UPRB 4HUWA 5D1ZC 3GMOA 3DBXA 3OJDB 3SDCC 3RWGB 1I3UA 5DJYB 5DTFB 5KSVA 4GAGH 2CRIA 4ZSOA 4XC1H 3AUVA 3VXMB 3MRBA 5FYLL 3O4LD 5J3HC 3THML 4FTVD 3GBNH 1JF1B 4XZUA 3ZE2F 4MA8H 5I66B 2F8VA 4S2SB 2D7MA 5ESAB 4P9HL 2EH8L 4R2GC 1L7IH 3KYKL 4R4ND 3MNZA 3O8XB 2AEPL 2BSSB 2FEDD 2GK0B 2PYEB 1I1CA 3VH8G 2VH5H 5HI3D 1FG9C 5D70L 4P2YA 3CXHK 4UT6H 4V2BA 1YEDA 5EB9A 5ESQB 1SEQL 2G5BA 4M7LH 1FGNL 3S36H 4YWGH 4APQA 3Q3GB 1EEYA 5DRWA 2L7UA 4LNRA 1ZTXH 5EFIB 2UUDK 5DHYB 5MENE 4GMTH 3SOBL 4CADB 1IZJA 5F6IB 2JCCA 5ELIA 3BWAB 4IIQA 2P47B 2JB6B 4KZDL 4PRID 4YHML 3AY4C 1WBZA 4AIXA 4RZCB 35C8L 3GO1L 4AT6B 4J3UA 1RJYB 2FIKA 4Y16D 1KTLA 1JGLH 3U2SB 3U4AA 4PS4H 1NAMB 3W2DH 2O61B 3HI6L 4R4BA 5HGAB 3LKRB 1ZHKB 4HH8A 4ONHB 1FIGL 1RK0B 4HT1L 5E8EA 5ITBH 3KPLA 5E8EB 4XMLH 5HDBE 1HHJB 1K4DA 3OGCA 3P9MB 4NNYA 4UNVA 4LCWD 3SE9L 1BQUA 3L5WA 3OAUL 1SHMA 1IEHA 4N1HB 3JWDC 3QIUC 4M7ZC 2X4QB 4UIKH 4G8GE 1AGDA 4OKVA 2APXA 2XKNB 4IOFD 3HNVL 1AY1H 2NNAA 2P24B 4HWBL 4LHJB 3PQYB 2HT2C 3RWCA 4IRSA 1ZT4B 4L4JA 4TVPH 3RNKB 4YBLB 2CDEA 5CUSH 5F1NB 3DSFL 1NEZA 1PYWB 1WBZB 3B9KC 5LCVH 4DGYL 1S3KH 4OD1L 1FFQA 2FIKB 3WMSA 2UZYB 5B8CC 2X1QA 1IL1A 4XPTH 5I1LA 5I75B 3VDBA 4MAYC 1UACL 1U2HA 1CFSA 3TO2B 5HJ3A 4U1JA 2DJ4A 4ZOEA 2WIIB 1G6VK 4C4KT 3B6SA 3DRTA 1HXYA 4UV4H 4JFFA 4MQSB 5DJ8A 3ARGC 5KSUA 4EUPG 2VLJE 1J1PL 3LKPB 1IGFL 2L0DA 5BQ7B 5CJBA 5EBGA 4E42B 3WN5B 4S11A 5KSAB 2DLFL 1I7UA 4CNIA 4Y19E 5AD0B 2NW2A 1QQDB 2WW8A 3BD5A 3E0GA 2BDNH 1IAKB 4LQ1A 1Z9OA 4PYHA 3SDDB 3LEXB 4HUMB 4M7LT 3E3QC 2FRGP 1Y18A 5BXFB 1TFHA 5I1GH 3LB6C 1S7SA 4DKEL 2XY1A 3VW3H 1RUQL 2XWJA 1WTGT 1W72B 2VLRB 4JQXC 3BKMH 2CRMA 2CLVB 4CMMB 1R5WB 3MV8D 3O6FA 4LFHG 5JIIA 32C2A 3D25B 1HXMB 1F5WA 4HG4K 3UBXI 2P7TA 3WFDH 3ALWA 3VFNB 3INUL 1KB5A 2ESVD 4ZODA 5FYKU 1GPOL 3SE8H 1YEGL 3OGOE 3VCLB 4HIXL 4RFEB 1YYMH 2BRRL 4R4NC 1DN0A 4M5ZL 3G08A 1HWGB 1ZHLA 2QKIA 3FCTA 1UKSA 5IMOA 1BFVL 4PBVC 5IQ9B 1N0XL 5IHUH 5KW9H 2ZCKH 5L0QB 1E28B 4MD4B 5D7SL 3GDBA 3ZMRA 1PG7X 1DBAL 2PTTA 1TZHA 1CDBA 3FMGL 4P46C 1T1WB 1U8HB 1KCUL 3C2AL 2DQTL 4K8RD 1G0DA 4OJFL 3WHE1 5C0IA 3CFBB 4Y0GA 5EN2B 4BH7B 3ULUE 2ATPA 3DX6A 5DD6A 4FZEH 4P5MA 1L0XA 4TYUA 1UEMA 1B0WA 4FZ8H 3VFVB 4ZSOE 5EUKA 2R0LL 3FQTA 5AYUL 3CFJB 2FO1A 3MODH 1D9KC 4FQQB 4JFDA 4X6DA 3VG0L 1HINH 1BVZA 2DQUH 3MMEA 5I8KH 1HE7A 2VDNL 2V9TA 3QQ4A 4Z78B 3ARDA 3O6MH 5J89A 4G6MH 1MH5A 3OX8A 3SDXF 4MAUL 5CD3B 2LVEA 4JFPA 2HLFC 4MD5A 5AYUH 5HDQL 4MD5B 1JIBA 5M95B 4FZ8L 2PO6A 2HMIC 1RZFL 5JXEC 4XXDA 3GSXA 5D96C 4GRLD 1HEZA 3MZGB 3L3KA 1NC2A 1HEZB 4U49A 4PREB 4QOKB 5DMJB 1G7PB 1QEWB 3RPKA 4FNLH 3FMGH 4DUXA 4Q6IB 4TUJA 3L3JA 2H26B 1DBAH 5E5UB 9CGTA 3NCBB 4UINH 2DB8A 4G6KL 3RIAF 3VXRB 2NY2C 4PJGB 4QXWA 4NKIL 4FMKA 4LIQE 2DQGH 4GRWH 3MQIA 4RSVA 2Z8WC 1HOCB 5E9DB 3C6LB 5TGBB 1OGAB 1ORQB 4LL9A 4UT7H 1Q9KB 4YPGB 1ZLVK 3AREC 2BRRH 3MRBB 5DJZA 3TT3L 3HLAA 4MDIA 4HIXH 5F88B 1CXHA 4UUJB 1QSFD 4OCLC 4G7VH 4RNRA 1LDPH 2DDQL 5GS1A 4X6CE 3ULSA 4X98B 5B39G 3T2NL 4UMGA 4EQ2A 5C6WH 4QGYA 2OBGA 5ISZE 4Z5RB 3ROLA 1RUQH 4DKEH 3MV8A 4I1NB 3SGJA 3BQUA 2VDQH 4JZOA 1QBAA 2W9DH 2J6EH 3T0VA 4PRHB 4TUOB 3MNZB 1NC2B 2CD0A 2P5WB 4QRPE 5F71A 1XR9A 3LKQA 4PGCA 4X9HA 4P99A 3NIGE 4QNPE 3CFDB 5EO9A 2KQNA 2PUQT 4DEPB 3AGVA 2BFVL 3G5XA 5BMFH 4OI7A 3DLQR 2AXFA 4WGWB 4UBDC 2OQJA 1P7KA 3RWHB 1A22B 3EOBB 3LRSB 1KCVL 1W72H 5E6IB 1IGMH 2R9HD 1DBML 1CICB 1X5HA 2X9WA 4UV4L 2XKUA 3B5HA 4K71B 2DM4A 1S5IL 4P2QD 2YZ1A 5TDPA 5EA0L 3LMJH 2OXGA 2JCCB 2R69L 2QHRH 4NO2B 3NZ8A 1S78D 2HTLC 4G3YH 4XNXH 3PDDA 3BHBB 1YEIL 2IAMC 4YC2C 3WKNA 3TO4B 2VO5A 4XPTL 1PKQE 3L5IA 3PGFL 4FFVD 4HPOH 5HHVL 5D7LB 4OD1H 4BKLA 2YKLL 3KLHC 3I02A 2H9GA 5KSAD 1X7QA 3EOTH 4OLYH 5AYQA 3SDAA 4DGYH 3DSFH 1AXTL 1J0YA 4NQSA 5DZLA 5IW6A 1BWMA 3UROR 3V5HA 2OP4L 2I60H 1A6ZA 3FRPA 1T83A 4YHYC 1DSFL 1LE9A 1FBIL 5T1LB 4FQXC 1AY1L 5HVHB 2XWTB 4HJGB 2RB8A 4ZYKB 5FOBA 2JJSC 1BEYL 5MHSD 3PXHA 4CVWA 1U6AH 1CIDA 1UM4L 5T5FL 5DDHA 5IVXA 1OT1A 7CGTA 4U6YA 5IQ7H 1UQSA 5TQ2H 4BQ9A 5JLZB 2OL3L 1CI5A 4PB0L 4HMDA 4MS8D 4HC1L 3FRPG 2CLRA 2VL5A 1KIQA 1QBLL 2APTA 3BJ91 3WUWG 1JMZA 1WAAF 1F6AA 4Y5XB 3U6RB 2H2SC 2B1AL 2O5ZH 2Z92A 1CFSB 5T33L 5DVLA 5DD5H 2XPGB 2EC9U 4QXUL 4EN3C 3DXAB 3KDMA 1CXKA 1AE6L 5I1LB 3HKFA 3T2PA 4YHMH 4KZDH 1U58B 1PZUB 4TRPL 1IM9D 2KBGA 5CHNB 3MCLH 1BPVA 3IDGB 3W11C 1N6VA 5JQ6L 3HMXH 1FAKT 4PJCB 3GHEH 3GSRA 3RKDD 5CJQL 3LHPL 5IB4A 5IGXL 2XIDA 4D3CL 3ORJA 1DQJA 4N0UA 5DURB 4NZUH 1T6VN 1AJ7H 2ZUYA 2DWDA 3Q0HA 4QRRB 5DSCB 3JV4A 5DGQA 1Z3GH 4EDWL 2D9QB 5DJCA 1DVFC 4JO1H 2F54A 2XN9A 5KAQF 1ZXQA 3ARED 3DUUB 4QRUB 4BK5A 2QQLH 5JIHA 4P9HH 4NRZA 2P7TB 4G6JH 1YN7B 3RL1A 4LVHC 2HRLA 3DX9A 4RCAA 1KLGB 3IF1B 3GBNL 2L4OA 2R2CA 1GGIH 2AJ3A 2R1XA 5IMMA 3QCTH 4Y19D 4CJ1A 3FOMA 1YEFL 3CU7A 3VFPB 1N5AB 5C0RL 4JFFB 1G7MA 1MY7A 2P8PA 4MB5A 3VDAA 4JFDD 1LD9A 5C0BB 5C7XL 4NBYB 1WGOA 1BBDH 4X7DC 1LK2B 1S7UA 3D2UB 4OCWH 2C4FU 2W59A 2WLZA 3MV7A 2R0KL 5DHXB 5F8QC 4GSDH 4Z7NE 4Y16C 4UU9B 4NQDA 4U0RB 3NFSL 2JIXD 4PJ5A 1TZHB 4JRYE 4DZBB 3GIVB 3S3PA 5GGVL 3VXRD 3GSRB 2BVOB 2YPLA 4WUUB 1XT5A 5DQ9B 4Y1AD 3VFWB 3B9VA 1NL0L 2EDJA 4HWUA 2H32B 5JR1H 2RFXB 1U3YA 1IRAY 1KF9B 4PR5B 4JANA 1NCUA 3BKYH 5EIIB 4EBQL 3KPQB 4X6FA 3QDJD 3HI5H 5EN2A 4MYWB 4MNGA 4Q0XH 1HHGB 3RUGF 4OV5B 4LCWB 2AXGA 5I1IL 5CGTA 1FGVL 2DQDL 1SBSL 4D0CB 4ONGL 1J9CT 1CCZA 1MCEA 5AUMB 5GHWL 4YC2B 3LKSB 1Q38A 3LS5L 3B8SA 1BAFH 1YYLH 4JO3L 3CC5A 1YY9C 2P5WD 1IKFH 2Q7YA 4PRPD 3GUTB 4HHAB 4S10A 1JPFA 4QRPA 5IEHB 3GGWB 3MFFB 5DUPL 4FMFA 4KROC 5IFHH 4HEPG 4ZTPH 2IEPA 1QPXA 2FH6A 3DRQA 4YXLH 1ES0A 2FGWH 1OTSD 1KN2L 5CP7B 4EXKA 5FA3B 2MKWA 1AIFB 5AAMA 1G6RA 4EN3A 1X5AA 2ZUQC 2CKBA 4P3CH 4JHWH 1QRNE 4G9FA 2XXMB 4PJ9D 3NH7H 3WNOA 3ZYJA 4YPGA 2D7OA 3K7UA 2FX7L 4F7PB 5KSBF 3GJFA 2EC9T 3AS1A 3BQUD 4XCCL 1HOCA 5I8OH 1KXVC 1MI5B 4N8CH 1KXQE 5GRZA 4EN3D 4JFYA 3P40A 5BW7A 4ZAKD 5FKAA 5DO2D 4JPVL 1SJEB 1IEAA 1NMAL 1P84K 3BE1H 3N85H 4Z5RA 3WXVH 3NZHL 5EG6C 2E7LC 3DMMB 5C3LD 1YEEH 3FRUA 4UQ3B 3FO2B 1NGWA 5DHVB 4NNXA 1G9MH 1CFVH 5GJSH 3ZZ1A 4OF6A 3DUHA 5ADPH 2R39A 4JFZH 2A77H 1FDLH 2MHAB 3AAZB 5HHXL 5AG9A 3QI9B 1I3RB 1XF3B 1OAQH 4RISH 4HC1A 4XPBL 1CS6A 4AMKH 2OQJB 1NDMA 4K3JL 1K2DA 3LKNA 2WQ8A 2UUDH 1A6UL 1FPTL 1KJ3H 4P23D 2V7NB 3OAZH 5E00B 4OCXL 4R90L 1KUMA 4UDUA 4RMRA 4HS3B 3GSOB 5IUSA 1FVEB 3RPIB 3TZVA 2Y72A 3EJZD 3NA4A 2E6JA 1CD0A 3BD3A 4GKZA 4IMKA 4AIZB 5F9DC 1JGUH 4Z7WF 4YFDB 1MQKH 1RIUH 2KZWA 3T4YA 1M7DA 3RDTC 1B9ZA 2EDOA 2VDOH 5E1HB 1RJZA 4ODWB 1LP9B 1DFBL 2EO1A 2FLBT 5BV7L 5BZDA 3QI9D 1WWBX 1KENL 4GW4B 4NQCB 4HQQH 4JDZA 4F15C 1RQ5A 4KQ3L 4PJ5D 1CFBA 2F53D 4S2SA 3U30B 3LD8B 4W6XB 5D72H 2XTJD 3CXDL 1KCRL 5DHVA 2BNUA 3HI1B 5J6HB 3HRZB 1A0QH 2I5YL 2ZG1A 2YD2A 4LPCA 1BF8A 1ZSDA 3T0EB 4HDIA 5KS9F 1OAKL 5IF0B 1TVHB 3TPUA 3G6JA 4ZFGL 4KJPD 3EJYD 5FHBL 1R5IB 3GFUA 5L8KB 3B2UC 3MJ7A 4N9OB 4R7NA 3WO3B 4ZS6C 3PWLB 5J56B 3KPOB 3UTTA 4JY5L 1KIRB 2XZCH 2Y25A 2NTSP 3D0VB 1KCSH 4OT1L 3VXOA 3OKDB 3TJEL 4XMPH 4JCMA 3VXOB 3QEGL 3WHXB 3KPNA 2CDEB 1F6AB 2F53B 3N06B 3MACL 5CBAB 1EEQA 1NUNB 2COQA 1IAMA 2P8MA 5C08A 2X4RA 1AFVL 3GSUB 4N0YL 5ANME 3B5TA 3NTCH 1QHPA 1TJHL 1MUJA 3I2CH 4NHCL 4NZDA 1F45A 5J3HD 1DQDL 2H1PL 4MQTB 1FFPB 1S7WB 5BRZB 1BIIA 1A6ZB 3LH2L 4NRXA 3GRWL 1RK1A 3PP4L 3U46A 3SDAC 4YGVB 5JHDE 1BGXL 5B8CB 1NBZA 4Z76B 3L5XH 4P4RB 4O2EA 2D7NA 5HYJE 5A40E 5HI3C 3RIAK 5JDSA 4C54A 5DUMH 3MBEB 1T0NB 1E4JA 2W38A 5FM8A 3QFJE 1QR1A 2VDMH 5KBNC 3O3AB 4P59L 3CK0H 5GGTH 5K9OA 3UTSA 4ZNEA 3D69A 3IU4H 5M94B 3VI3F 4PGZA 4L8CB 3M1BB 3GSNB 5C0CA 4QLRA 4X80H 1JN6A 1SYVB 4WTZA 1CDYA 1EJOL 5C0AD 3P4LA 5TDOA 4M1DL 4XH2B 2DOCA 1CFNA 4ZMAT 5GS1C 1KG0B 1RURH 3NAAL 5D7KD 1P4IH 1KV3A 5T1DL 5CJXA 3LEVH 3QHZL 3ARFA 5C0GB 3O4OC 4RA0C 4M6MH 5I1EL 4JG0L 3OKKB 5A16B 5IMLA 1RJCA 2GHWB 1NBVH 5J12B 2ZUVA 2NY4B 4OZIB 4FQHA 1Z9SA 4H25B 5AZEL 2C3HA 1LEKB 4GRMA 1MAML 1C5CH 4YGVA 2W9EH 2DKMA 4OLXH 5GGQH 2DI8A 1HSAB 3D2UA 3KPMB 1MAMH 3TBTA 4N9GA 3ULVD 4OZIF 1A14H 2YPKB 3ARBD 4LRIA 2VWEC 1UB5B 3MRHA 1S7QB 3O3DB 4XWGL 2XRAH 4R8WH 3QA3A 3O4LB 4LKCA 1LWRA 1T4KA 3QEHA 4JHZA 4PR5A 3QUZA 3WJJC 2CUHA 1ED3A 1P4IL 4TUKH 5K9JL 1MI5D 2NY6B 2XI9A 3QCVL 3MRIB 1QTYT 3ULVH 3L3HA 4HWBA 5F1OB 2UYLA 2PR4H 3RDTD 3VE0A 5IMMB 4JFEA 1YUHB 3ARUA 4QHKJ 5INDA 3F58L 4JPKL 5JOFA 1CGTA 1A4JB 3DMMD 3RVWC 2VXSH 4DZ8B 5E6IC 3IRZA 2YPLD 3TBYB 4CDHA 3EDDA 1FE8H 4L9DA 1QUNA 1OM3L 4ZS7L 4K3EH 2JJUA 3GIVA 4HJ0D 4PJGE 3TWCH 4BQBA 4AENA 3ULUL 4KVNH 4AENB 1JTPA 3ZYIA 5J11B 1P4BH 3GBML 4AY0A 4PV9A 3OF6D 2FECI 4N1EA 5F7UA 4IHOB 5DLMH 2NY6D 3KAAA 1KJ2B 2X4PA 4X6CF 3UBXG 4BZYA 1RHHB 1FV1A 1ZT7A 4IMKC 4N0FB 4OM1L 4H20L 2YA0A 3VFTA 4ODXB 3GKWL 1CLYL 2HKHH 2YOCA 4F9PA 2PYFB 4Y4FA 3NTCL 4PJGA 3GMNA 3PL6A 4M6NL 4N0YH 4M8VA 3WEXB 3ZYZA 5IFAH 4LF3A 4RMTA 1T66C 4X4YA 5L2JB 5I9QC 2Y5EA 3UPRA 2BVQB 5FYJD 5GS0L 4YHPB 2EXYD 3MBXL 4QNPF 1T1YA 1JYNA 2XQYG 2J2ZA 4OFYD 3K8MA 1UYWL 2NY7H 2AI0H 5IV2A 5ICYA 4U2YA 1B4RA 3IFNH 1HH6A 4O51B 2X6MA 1U36A 4HUXB 4BQ8A 1I9IH 1CN4A 4XAKD 3L5HA 4HUXA 5DURD 1MWAB 1MY5A 1GRWA 5CIPB 4G42B 1NLDH 4YHZL 1IBGL 3O6FC 3AU1A 3E6HA 2WUCH 1ONQB 3EW3B 5T3ZL 1NGPL 1U3ZA 1FLTX 1UM6H 3R0NA 1IC7H 4YDIL 1QNZH 2FNBA 4JLRB 4ELMB 5B3JE 4M93C 2VJXA 5C09D 3ZKMD 1CT8A 2OR8A 4HIJB 5EU7E 4D9QD 1WVZA 5IP4A 1J0HA 4NP4L 5I1JH 5D5MF 2BCKB 3O11B 4UDUB 4FXGA 4HS8L 4FXGB 3QQ9D 5FYJE 4XCFH 4BSWA 5D2NB 4WI8A 4S1SH 4OB5H 1OLZA 2CDFB 1SM3L 5FKPA 1NAKL 5TE7H 3GMQA 5F1IB 4LHUA 1IFHL 2NTFA 3DXAE 3QDGE 2B20A 4XB8A 1DQML 5CEXA 4YHOL 4F37F 1FP5A 1JGDB 4QHKI 2E3VA 3WE6A 4P2RA 3W9DA 1WIPA 4PY7B 3ISWA 1MJ8H 4PY7A 1HK6A 4RNRB 3BIKB 1BX2B 1F90L 2W0FB 4R2GB 1NGWB 1C12A 5D2LF 2OTUB 2ZKHL 3OR7A 1NDGB 5D7LA 1EFQA 2OTUA 3IS0X 3MLTA 1IKNA 4QRRE 2XY2A 2HLFD 3CPLA 1M05A 1NC4D 1U42A 1WF5A 5HHXH 3RGVB 3EYUL 4OCRL 3FB6B 4ELME 2Q7NA 4Z7NF 1D5MA 4PJDB 1DUZB 2NX5D 3N85L 5CGYC 1E4KA 2VZVA 1ORSA 1BLNA 4KK6D 4JPVH 5H94B 4BZ2L 1EHNA 1RZ8B 4GXVL 3SJVD 2WIMA 3WHXA 2VL4A 3CLFH 4HW6A 4R0LC 5IVZB 1OSPH 4AEIL 4JFHD 4V1DE 1AQDB 3HZVA 5D71H 4KMTH 1JWMA 5FECA 5HVHC 5KN5B 1CLOL 3D6GA 1CE6A 2VDPH 4NO2A 5MI0B 5IESH 2DL9A 2OX5A 1N64L 3BN9D 3BSZL 3MXVH 4M7KL 2ZUUA 4PJ9C 3ELAT 2AJZB 4JEGB 4JHWL 2APVA 3C5ZC 1BIIB 4C56B 2OTWB 3B6SB 3DRTB 4M1CD 1HYRC 2CMRH 3ARBB 1JPGB 1C7SA 2FYYA 4RA3A 1FNEA 2OI9B 4JJ5A 4XVTH 1AO7E 3PWJB 5D6DC 3JWNC 5AG8A 1IC4L 4H1LG 2NPLX 1AD9A 4LGRB 3D39D 2C3XA 4HUVB 5CGMA 1LE9B 4PD4J 2OS7A 3G6DL 4PJEF 3O45A 1RY7B 4KKAD 3LEXA 4U1GC 4JFDE 4WU5B 5ABDE 1MSPA 4XHJC 4Z7UF 3H0TB 3P77B 1E27A 5FAAA 4GAJL 5I2IA 5DA4A 1UFUA 1MCIA 3PQYE 5DRZB 3BH8B 4G6AD 4HWZB 5SX4H 2EXYC 1M6OB 2H3NA 3P0VL 5I1IH 2LU3A 1A7RL 2KPNA 1AQDA 4UV7H 4NM8H 4I48B 4UZGA 3VDCA 1TTFA 5JMOC 5D2LB 4L8BB 5J11C 4WJ5B 1SMOA 4LRNH 1OAYL 5EUOE 3GJFH 4RWYL 4M6OH 3FOLA 1D5BA 4PJFB 2VITB 4OLVL 2IBGA 5D2LE 3LAFA 5CIPH 2XPGA 5DD1L 5I71C 1AGBA 2A9NL 2Q8AL 4HBCL 1SEBB 4OF7A 2WBJD 4PLOB 1B0GA 3NGBB 3O3UN 4XCEA 2HTKD 4HGWB 2IAMA 5L7XH 1IILE 2WWKT 1B0RA 1JZ4A 5DD0L 2WAHA 3FO9A 3TBVB 3S88L 1J05B 4KXZH 1A7NH 1TJIH 5BRZE 4LKCB 5DZNA 4HS6A 5GIRA 1FORH 2EYRB 4JM2B 2WINB 5DMGC 4QRRA 2G9HA 3DURB 3LOWA 4ORGA 5MP6L 4NM8L 1YEFH 4U2ZA 3I6GB 4JKPH 2K1MA 4YFEA 1JRHH 2NXYC 4IRZH 4KFZC 5IHBA 4Q58C 5B4MD 1J86A 4AQ1B 1T04B 1A6PA 4EQ3A 4LU5L 4FN0A 1X5LA 2J12B 2QQLL 3MRIA 3AROA 3SPVB 5IOPB 3RWIB 3BUYB 1A9BA 1ZHNA 3QZWA 4MS8C 4ZS6D 3RWDB 3C60B 3JVGA 2V2WB 1P7HL 4JB9H 1CLZL 2Q86A 1MCCA 4YJZL 1G7QB 1Q8MA 4Y4KD 5CSZB 5SWSD 1AQKL 1MCKA 3GI9H 3HNTL 3CUPB 4D3CH 4PJXF 3KPMA 1OCWL 1KN4H 1T3FB 3TIEA 4Z8FH 3GSXB 1JPFB 3GHEL 1YEJH 1K3IA 1TQBC 1HQ4B 3MLZL 5F9AC 3HUJE 4WHYG 2HJFA 4QCIA 5GJTL 5KZCB 1KFAL 3MXVL 4XP4H 3HAEH 1N64H 4LLDA 1R6VA 3KVQA 1CLOH 3O3BB 3T8XA 2KKQA 1SY6A 1TZGL 4LPXA 4WUUA 5FA3A 1RZKL 2VXTH 3SE4C 4X5XB 4JG1H 4PJ8D 1P9MA 1WT5C 1ETZB 1YUHA 2WP3T 1X5KA 5BZWB 1UZ8A 4R6UA 5DMKA 4HWNA 3FFDA 4UAOB 1TETH 4HC1H 4ZDHA 1TCMA 5BO1H 1Q94B 4OIIL 3FAXA 4JFXB 5HYFA 2AERT 3BP4A 3EBAA 5E94A 3CMGA 3ULSB 1T1ZB 3GRWA 5LAXB 3TM6A 4CMHC 3PP3K 5DEZA 3G5YA 1UM4H 1BIHA 1EXUA 1ZVHA 2H8PA 4K8RL 5E8PB 5I1CH 5ALBL 2ZOKA 1OB1A 1DUYB 2O5XH 4BJLA 4Z7VF 5GZND 4Y4HA 4JLRA 4ELMA 1FBIH 3SE3C 4MJ5B 3SDYL 1DSFH 3REVA 3HZYB 3OHXA 2VQ1B 1A6WH 3W0WE 4E5XB 3CFKA 3BZEB 2Y07L 2APFA 2FBOJ 4XHJD 1IAIM 4LCUA 5EORL 3LKQB 3WLBB 3QI9A 4DFIA 5B3NA 3V5DB 3MNVA 3WSQH 3LQAC 2CR6A 3AXLB 3MRNB 2AXFB 1G9EA 2PW1A 3VXTB 3IDMA 3MV01 3PGFH 2BOCB 5F6HI 4HK3J 3QQ3B 1NAKH 3N1MC 5TE7L 3MJ8B 1YEIH 4NKQB 5MHSE 2HLAA 4YH6A 3JVGC 4H1LH 1K5NA 3MRGA 4WFGE 2JCCF 3C5SA 3ULVC 2H45A 2X41A 2BVEA 3LMJL 3DYPA 2AJYL 4FP8H 5I1JL 4PJ7B 3GJFK 1H8NA 4NWUL 4KC3B 4Q7DA 4LAQH 3NBNA 4X98A 1DBBH 1KCVH 1RJZB 2X9XA 3D85A 3OKMB 3VXMA 1IC7L 4YDIH 4QT5A 5KS9B 4LSDA 1QLFA 3DPBA 1QLFB 3LKRA 1WAAA 3C08L 2GITA 2IMMA 2M1KA 2ADJB 3QEQA 4H5SB 2YWYA 4X4ME 4M03A 4LP5A 1VKXB 4A6YB 3QUKA 3HRZA 2G5BB 2W9DL 4ORZC 5F7WC 4LCYA 1MHHB 3FO0L 2C3WA 3U9PH 4XBPB 3WLBA 2BNRD 1B90A 5LBSL 3DVNB 3L6FA 1XF3A 4PRAB 3HE6C 1N8ZB 3QWRA 3BRDA 2DQIL 1BWWA 5HHNA 3WJJA 2BJML 3MROA 3MBXH 4DTGH 5E5RB 1CVSC 2SEBB 5BS0B 4HJ0C 5CINL 1H0DA 2CIKA 2Z0BA 1B2WH 2DDQH 5AAWA 5HPMA 5FO8A 4U1LB 1Y6MR 4KVCH 2BY2A 5MEQA 4MZ3A 5F70A 2DMKA 3CD4A 3IVKA 1ZLSL 1KIRA 3U9UA 1N7MH 4G9FD 2O61A 4GKZB 4H20H 5HBBA 2DICA 3FONB 5DD3H 4OM1H 5A2FA 4DGVH 3I75B 2F8XC 4NDMA 2DQGL 4DJMA 2K7QA 2WWMD 5DLML 3IDYC 3X3FH 5T3XE 2Y23A 1H3XA 3V7AG 2HJKA 4Y1AB 1P4BL 5I19H 3QIBA 4E0RB 1HHHA 4KVNL 5BVPH 1UZ6E 1A7OH 1CZ8H 1OTTD 1LO5B 2E6PA 5C0ND 1KEGH 1H3GA 3QFJB 1A6TB 4DW2H 5I1KL 1JGVL 4JKKA 4PJBF 4A6YA 1OM3H 4KTEH 2E6QA 4JN1L 5I73B 5EIVA 5EOTB 4J8RA 2DMCA 1RZFH 1JZ3A 3EOAA 4JJHA 2VXSL 3T0EA 1ORSB 3OZ9H 5IVOA 4ETYA 2Y6SC 5GGVY 3V79C 1I1AA 1F4YH 1O7VA 4UDTB 4LSRL 2NMSA 1TQCC 5IBTL 1NFIB 5DA0B 2FEDC 2ESVE 1VGKB 3Q6GH 3O6ML 5EU5B 5IVXB 3OXRB 3UTSE 1WC7B 1NMBL 1VB9A 5GGRY 3RAJL 3HZVB 4X7FC 4OCMC 3SGDH 5ADOL 3EJJX 4PRPB 1RZJL 2IH1A 1IM9A 3MC0A 3OJVC 4L8CA 3PP3H 4EEEA 3UEZA 3CMOH 3MV9B 4FZEL 1JN6B 4EOWL 3U4EB 1A14L 1LO2L 1AKJB 2O26U 1R24A 1JNLL 4CMHB 1PBYA 1LO5A 1UM5L 1ZGLA 5GRWA 1RUAH 1KJ2H 3BPNB 5F89A 2B4CL 1Q72H 4H25A 1F11B 1VFOA 3LEVL 3LKPA 4I13B 1ZHBB 3CLEL 5KW9L 4UAOC 3L95B 4F7MB 3GEWB 2YD3A 5DJ0A 5D7IF 1Y18B 4CNIB 2EICA 1PDKA 1EJOH 4FTVA 1YZZA 4AEEA 1LK3H 3TA3C 4ZAKB 2XWJB 2XN9B 1VENA 2MOVA 3AB0B 2IANB 5IB5A 3VXNB 3WFDL 4M61B 2VKWA 4Q6YA 3F6IA 2JB5H 2VDML 2BC4B 1Z5LB 4F37K 1L7TH 2V17L 2DM7A 3ES6B 3GMRA 3SKJL 1NCCL 3FQXA 4PJIB 4CBPA 2IAMD 1KTDA 5DUML 4XI5C 2H6PA 4LGSB 3GIZL 3RBSA 1R3KA 3LN4B 1ZANH 4Z77B 1KELL 3TV3L 4QF1A 2IFGA 2ZPKL 1R3HA 4LHQB 4QO1A 4OI8A 3UYRH 2E9JA 3RP1A 4P3WA 1JZ7A 1A9BB 5DJAB 2AXJA 3QH3A 3MRQB 5T3XH 3PP4H 1LK2A 1S7UB 3B9KD 4PP2A 2DD8H 3QNZB 2Z91B 3LDBC 2Q6WA 2X89A 2GT9A 3MFFA 4TOYL 2NY3B 3R1GL 2GQHA 2GI7A 1GH7A 4F58H 1E4WL 3QFDB 1G9NC 3L3IA 3G9AB 5ESVB 4HCRL 3MNWB 1KJVB 1RMFH 1FO0L 4HUNB 3P2TA 1XR8B 2J88H 1F00I 2YD8A 4L4VD 2DKSA 4R0LA 3OR6B 1D6EA 3HPLA 4UQ2B 1R3LA 5F7NC 4RDQG 6CGTA 2FX9H 5L2JA 2XTJB 2Y06L 3RFZC 5C09E 3V6ZB 2WBJA 2X1XR 4KKAC 3BN3B 3PDGA 4MMZC 3TYFA 3WN5C 5I30H 5INDB 5T1KA 4GBXD 4ZFGH 1S8DB 5H37G 1LDSA 3VXUA 4HFUL 3QIWC 1KCKA 3LB6D 4L4TB 3U83A 5FUOL 5LWYL 2QSVA 1A6AB 1A0QL 2I5YH 3RX7A 3NCJH 1OVZA 1FZMB 1KCRH 2EZ0D 4WDIB 2D7TH 4Y5YA 3C6LD 4QCIB 3BZEA 4ZPVB 4GQ9L 1U3HA 5D1XA 5CJOL 4QOKA 2ENYA 5D7IE 5F9JB 4WO4A 3WL9A 3ARFC 2VDOL 4HJJH 5ESQA 5CAYB 5CWSA 4ZO8A 2CPCA 3WJLC 2FX9L 2X7LA 1K2DB 4KTYA 5ITBL 4NWTL 5HTSA 5ICXA 3P30L 4I3RH 1S7TB 3JWDH 4QY8A 5BZWA 2HLAB 3BW9B 4GJTB 4JZJC 3HI6H 4WEUD 5I76B 3W2DL 1IMHC 4OFIA 4KKNA 5CEZE 4P2OA 4JZJA 1JNNL 2E8YA 2ED9A 2K3TA 2ZG3A 2Y7QA 2Z31A 3CFCL 3KYNB 2VDLH 3K1KC 1U8JA 2FWOB 3NOIA 1MI5A 3V95A 2R1WB 1UCTA 4FHBD 1Q9KA 4WI4A 5C6PB 3W5NA 3RIFF 4ELKA 2UWEB 4J4PC 4Q9BA 1DQLL 2X70B 4LHUG 3T3PE 1MPAL 2O5YL 5T3XL 5EOQL 2R4RL 2DQCH 1MLCA 3G04B 4W81A 5CIPA 5HYEA 4BUHA 2NR6C 3TH4T 4GAFB 3OAYK 1ITBB 1F4WL 5KS9A 2YK1H 1G7IB 4KDTA 3DHJA 1T1XB 3ESUF 2CRYA 4NQSB 3IDIA 2ITCA 1NCCH 3V5HB 2JB5L 1J87A 3BPOB 4KJWC 5CEZD 5I8OL 4RIRA 3RZWA 4Z7OF 3NCYP 1ZA6B 1OP3H 4MA8L 1QP1A 3KGRA 3I9GL 3UZQA 2AJXH 3TFKD 4FRWA 5DJDB 2R29L 5GGUB 4PTUA 3MV9D 2C3VA 4XX1G 5TF1H 4UOJA 1TIUA 1KTKE 1N2RA 2XZZA 4MA7L 5FKPB 4LLQA 5F1NA 3D39E 2D3VA 2R1YB 4YDLC 3KNBB 4W4OC 5HPOA 3IDJA 4ZUTA 1CICA 3WIFA 3UX9B 1F6LL 1KLUB 1KCLA 2HH0H 3O8XD 3QB7C 1RI8A 1BREA 3NCYS 3QEUB 2XTJE 3ZDZE 3ZYOA 5IVNA 1G1YA 1MVUB 3TZVD 1WTLA 2BY0A 4LCYB 1MVUA 5LXGL 4PJAA 2EKSA 5AZ2H 4NCC2 3FQNA 2DM3A 1QLEH 3MRDB 15C8L 1TVHA 1MEXL 4GS7C 2PTVA 4HDIB 1I7UB 3C87A 5I1HH 1KB9K 3DHMA 5JO5B 3IU3A 1CGXA 3BAEL 4XAWL 2NLJB 4MQXD 4U7KA 2UV3A 2DQDH 12E8H 5IW1B 2PXYA 4U1LA 5IW1A 3FHQA 3GB7A 5GSVA 4WU5A 2OYPA 4U1HB 4ZG1A 5GZNC 1T89C 1G7LA 2EDHA 5J1AA 5T3XD 5GGUA 2GJZB 2YEZA 3EO9L 3HE7B 2UVEA 3WKML 2GJZA 3FO1A 1F2XK 4DN4L 3VGDA 4OZHA 3ZDZF 3OZ9L 4PGEB 2BSTB 4MJ6A 1RZ7H 3W81A 4HKZB 3QDGB 2V6HA 3QUMH 5ICZB 4ZAKC 1OW0C 4JN1H 4F8QA 1ZK9A 3KLAA 5D2LA 4U6XA 4D94A 1Z9LA 4DW2L 2BNQB 4JRYD 1W0WA 3QEUA 1F4XH 1MCJA 1HILA 4YDKL 1QYGL 2IH3B 1FFPA 3NFSH 3C09C 5B38G 1BJ1J 1U3JA 3KPLB 2WSKA 2C4XA 1FG2B 1SEBA 2BERA 3X3FL 2QSQA 5EBMA 1TMCB 1KJMA 1VERA 3IXTA 3U0TB 4DGVL 4YR6A 5IQ9A 4NZRH 1DQJB 5EBWA 5C0RH 1RULH 4J3SA 1N7ML 3E8UH 2YA1A 2NXZD 3NIDE 3WO4C 2XICA 4KUCD 4Y19A 3BVNA 4KVCL 3QEHB 4GKNB 2XG4A 1B2WL 4N0UB 2JJSA 4Y4FC 2AABL 1TTGA 2DQJL 2WBWB 4GBX