2MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 37
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg102
4M3KB 5FGCB 1SMOA 3NBNA 4BJLA 4M6OH 4JO1L 3P30H 3B9KB 2IANA 1IAOB 3F6LA 2A9NH 2P47B 4R4NC 1EHNA 5I76B 1CGUA 4PTUB 3EIFA 1A0QL 3WSQL 3JV0A 3T0BA 2BJMH 2BVYA 3GSVA 4NRYB 1KLUB 3OB8A 4JO1H 3ABZA 2NY7L 3LQMA 4YAQA 3P40A 4OBRA 4MJ5B 2PXYD 1T7VA 1NBQA 2DQTL 3CDGB 1NGXB 3ULUC 3KXFA 1CGWA 3PE9A 3U46A 1NGYB 1IC7L 3CDCA 5BO1L 2FJGB 4KUCD 4LBEA 4KDWA 3MRKB 3QFJB 4HKZB 2VQ1A 2BNRD 3VWJD 5MEOB 2ZNXA 1CGYA 3L3HB 3PL6A 4UUJB 1MHEB 3PHOB 4RX4A 4JG1L 1MHHB 2V9RA 5A2FA 3ZE1E 4XVJL 2XWTA 2VAAA 4DKEH 3PHSA 5FHBH 3SKOB 3U7YH 1J0JA 4X5XA 1GAFL 1U3HA 4GBXB 5JW3L 3L5WA 5D2NC 4KMTL 1I1AB 1NFDA 2CR3A 5FHBL 2ZPKH 3U7YL 1LO4L 1DBBH 3BKJL 2I60L 2JJSC 2DKMA 1EEZB 4HC1L 2Z92B 5GRJL 3WJLA 1G1CA 3QJFA 2A73B 4KQ4H 4H8WL 4CMHC 4N90D 5BJTA 4J3WA 1QFWH 1MREL 3GBLA 2BVQB 2PN5A 1UH3A 1CLOH 4TTDD 1KLFA 4UIMA 2ZOLB 3MBEC 5ABDE 3LPWA 5FYKE 2W0PA 1SBSL 1NC4B 4LLWA 2VABA 3VFTA 4RWHA 1MCOH 4RDQF 1W0YT 1DDHA 5K33A 3NPSC 1D9KB 3AUVA 5BMFL 1UXWB 3T0EE 1ADQA 2MCPH 4MD5B 1VESA 3ZHKA 4UIMB 2VDOH 3QDGA 3ZKXB 4NO0A 3RY6C 2VMFA 1MJ8L 1IGJB 3LD8C 4MB4A 1ZGLM 2R4RH 4NCC1 1JTTA 3AY4A 2VLRD 4QNPE 3BGFC 4PRIB 5BS0E 1S78D 2E7HA 4GSDH 3MLRL 3RVTC 3RGVB 4NQTA 1EH9A 3KLSA 5DRXB 3KPSB 2CJUL 2IWGA 3S5LB 4DKDC 4NRXA 1BFTA 2XY1A 1I1AA 1NFDB 3O11A 3MCLL 4YGVB 2F74B 1S3KL 4AENA 1F4YH 1MAJA 3RIAK 5C70A 1LEGB 3O8XB 3VGEA 5GS2H 2J6EL 1SQ2N 3R06A 4LFHD 1RUAH 1MOEA 3FB5B 2X4TA 2VAAB 2O61B 4U3XA 4NNXB 4OM1H 4HK0B 1EK3A 1DL7H 1KNOB 4LVHC 3JWDH 1XAUA 4W6YB 3T1FA 3MRKA 3QFJA 5B22A 2D7NA 3VMPA 4DZ8A 1MJ7L 1R3JA 1S7SB 2DN7A 4G9FD 1K5NA 3H9ZA 3QDGD 5J57B 1T83C 3REWA 4LHUG 5DHYB 4R4BB 1RZ8B 3IYLW 5TGBB 3QQ9D 3O2VL 1P4LB 3RWJA 1FAIH 1ZGLP 1TVDA 3MCKB 4OM0H 1O5DT 1HHGA 4NRYA 3HNSL 4U6XB 5FF6B 4EI5C 3EKCA 3KPLA 4ELME 4LCIL 4HBQA 4LKXA 2E7CA 2FLRT 4WCYH 3LKQA 2IANB 2NX5A 4R2GC 4KI5C 5FA3A 3VCLA 3BPOB 3HMXA 1CVSC 4JFOB 2NXYB 3QHTC 5ETUB 3U36B 2GJ6B 1OD7A 3PXHA 3HLAA 2ENSA 5C2UB 3B9AA 4XI5C 5C0AA 2D0GA 3UYRL 2FL5B 4EXPX 4EN3C 4Z7WA 4N0UB 4JY6A 3Q6GL 1IGFH 1MAML 1Q94B 2BCKB 1ORSA 2LVEA 5F8RC 1GC1C 2NLJB 1N0XL 3S37L 4ZYKA 2K7QA 1BM3H 4XRCB 3BWAB 2Z8VC 3ZKMD 3PABB 3NOIA 1X9QA 3VWJA 1KEGL 1FGVH 2PR4L 4OGYH 4HLZG 1WAAE 2VLRE 2YN3A 3VDBA 2IMNA 2Q1EA 4FQQA 1GRWA 4OAWA 4W4OC 4GW4B 4X5WA 4ZS6D 3KXFD 3BDYL 4QRTA 1IGMH 4YXHL 1U6AH 3L3DA 4JO4L 2W59A 3AS2A 2FIKB 1LO0L 3VG0L 2Q8BL 4L1DA 1U91A 2NY4B 1HI6B 4U0RC 3T2PA 4AEHH 3VFOA 4R8WL 1R24A 2D7TH 3SDDB 3IFLH 4LSSL 4JN2A 1RJYB 2YD9A 1DQDL 3KPSE 4DKAA 4KQ3L 4KROB 2QSCL 1YUHB 4I0PC 2P24A 3S96B 2Z4QA 3TYFA 4KUZH 3DX8A 2YD7A 4HJJH 4PGDA 3IDNB 4K7PY 5C09B 4YHML 3IKKA 2LTQB 1LE9B 2DQUL 1QNZH 4F7PA 4I77L 4R0LC 5CMAA 5C6PB 3PP3H 4D9QE 3T8XB 1MCEA 2FDBP 4Y5XC 3FQUA 5E24E 3O9WD 1O7SA 4P2RA 2X9XA 3S36L 1C7TA 1CDGA 2BFVL 4HPOH 2RGSA 1U8QA 3Q0HA 1MCIA 5I8OL 4L8SB 3UTZB 2BVOA 3QIBB 1ROWA 1DQML 5JORA 3VGAC 3GHBH 3NCYS 2NXZD 4PGCB 3ZDXF 1KB5A 2FD6L 1FV1A 1BWWA 3JV6B 3MCLH 4BH8B 1C5BH 4YXLH 1TQCB 3AREA 4EIGB 4O2CB 4UNTA 1U3HC 4Y4KA 3F7QA 4KKCC 5IKCA 3UTPE 2QLVB 5SWZD 5C08A 1A14H 2KH2B 2LAGB 1I1RA 1A9EB 4PG9A 25C8L 1U3YA 4M1GL 4GAGH 4E41A 4YDLB 3BP4B 4H5SB 4M4RA 3VW3H 2BRQA 4BH7A 3HR5B 3W11C 2DQEH 4PJIE 4ZNCD 1ED3A 4PREA 4QHNB 3HPLA 3S5LG 3U4AA 1OF2B 4NQSA 2GT9B 3QNXA 5EC2B 4S11A 4CW1B 4QF1B 4XPGL 1T21B 4MJ6B 2R0LH 1ORQB 5INCA 3C6LC 3F12B 2I9LB 3U48A 2R1XB 3C5JB 4Q6IB 4XPTL 1MJJB 3H9SB 4DEPC 1JPST 1T3FB 1KOAA 5HPMA 3TBSB 4ZO9A 5ACZA 1AE6L 4UDUB 1QPXA 1T7ZA 2CQVA 4IS6A 4LHUD 5D1QD 3HMWH 5FHAL 1BVLA 3MRQA 4D8PB 4IRZH 5DUMH 2G9HB 3EYUH 3WFBH 2PTTB 2RCSL 4I48A 3WLWD 2R0ZL 4P4RB 1QO3B 1JPFA 4JQXA 5ILTL 4OCLC 3VFNA 5D7JD 4F9PC 2X4NB 4JFFE 3TBVB 3Q5OA 1UADC 1A2YB 4PJEF 3HZMB 4GMSL 3IDXH 3HUJF 4HZLB 5K9KB 1CDHA 3I6LE 5J4MA 5F6IC 4MNQE 4S0SD 4PJ8C 3V6BR 3G04B 1FNEA 4LLUB 4NZJA 5I1EH 5D9SB 4ZFOB 4XCFL 2X10A 3HE6B 4HS3A 3T08A 1F58L 4OCRL 4JFPA 3KWWB 1YMME 1MREH 3CJJA 5SX5H 4NPYA 1NLDH 1W72B 5DVLA 4XHJC 1IGIL 4OZGF 3S35L 4D9RE 3G5XB 4HUNB 2DI9A 4Y4KD 1A02N 2J88L 2D7PA 4P46C 4D0DA 4K7FB 1JWUB 2C3HA 4OF0A 3DXAB 2NNAA 3JWOL 5DUBA 1EAJA 1OD9A 3FO9A 1CLYL 4MAYC 5DJZB 3AS1A 4DEPB 3C8DA 2ADGA 5DWUL 4R4FH 4FXGB 4G6ML 5KSBE 4G7VH 5F7UA 4JFXA 4D9LH 2YOCA 3O9WA 5F70A 3VFWB 1A1NA 4JVWA 5HGHB 3W9DA 5HHXH 3BEWA 5D1ZB 1QLEL 1UH4A 4M1DH 1SJEA 1YDPB 4FQLH 3LKNB 1RIVH 1DBKH 1I3GH 4XCYB 4QRPE 2EEAA 1GHFL 4NM8H 3LN9A 2WP3O 1TENA 1G9NL 2Q3ZA 3HNTH 5D7LD 2DS4A 4G9FB 1VEMA 5I1DB 4UDTB 1JN6B 2HN7B 1GHFH 1C7SA 4HFWA 5ESAB 2R2BB 3EGSB 4G80B 1FC1A 4UAOB 4L4TD 4X7DC 4U6VH 1YQVL 3EAKA 1RK1B 3TO2B 4F7TB 1UZ6F 3EYFB 5E8PA 5KJRL 1JIBA 4WNQA 1OARL 5CZXD 1AO7B 3ZHDA 4I3RH 5GGTA 5BVJA 2QADB 3U0WL 4X7SL 5SWZE 3KPNB 5CIPH 4PRNB 1YECH 2MHAA 4PUBL 4CUCA 1I1CA 2AJVL 5JDJA 5IIEB 4EUPG 1ZEAL 2NY2C 3DUSB 1K2DA 2BXYA 4DUWA 5LXGH 1BD2B 1AHWA 3OKDB 4FQXD 2XQYG 4XPHH 2XG5A 2EYTA 3MROA 5IBLD 1A7PL 2RAMA 5CD5C 4CADB 1ZANH 4I2XE 4L4VB 3VG9B 1YEIL 2R8SH 1FVDB 1N59B 5EO0B 3VXSD 1CLOL 4HIJA 3QI9A 1UWGL 4S1SL 1OT2A 3BPCA 2FO1A 5KOMC 2EIDA 4ZOBA 4XCEB 4XCCL 2FBOJ 4FXLA 1Q38A 5IBTH 4Y5XB 1QYGL 1P4IL 1S7QB 1QYGH 4OLWH 1T5XA 5LAXB 1A14L 3VWKC 4M43L 2WUBH 4D0BB 1RAMA 2VZOA 3U2SA 3UO1L 4AL8H 3AFLA 4LF3A 4Z7VB 5FUOH 4A6YB 4P46D 2OX5A 2E27H 1EZVX 1NGPL 5C92A 1AJ7L 3FB6B 3SJVA 4IDLA 4JKWA 3CVHL 3DV4A 4Y4KC 3VMOA 2AV7B 2DLEA 4ZO7A 4AIOA 4M6MH 4WI8A 4TRPL 1G7LB 1A6TA 4QRPD 4GQ9L 3SDAB 3P9LA 4XNXH 4XVUD 3D69A 5IMMB 2EIEA 1NGQL 4MD0B 5DVOA 4F7EB 4HH9A 3SGDH 4M6ML 4XAKE 3ZE1F 4P4KA 4MXQC 1OAQL 1VFUA 3MNZB 5F9WB 1YEDB 3WFDH 3EDJA 4HH9B 2A6IB 4F7EA 2H2PD 3HZVA 2PXYC 1UWEH 2FECI 1A6TB 1FSKC 1D6VL 2E9IA 3MV7B 3QDAA 4L4VD 2OZ4A 1JGLL 1OP3K 2WWKT 2FSEA 5DS8A 2OR7A 5T1MA 3WLWC 3U9UA 3FB6A 3SJVB 1B4JH 5C0JB 1CVRA 2A0LC 2O5ZH 4GLRI 3RWFA 4F7CA 4JVPA 5IFJA 4GKNB 4M1CC 1RUMH 3QEQE 4Y2OA 4YUEL 5LAXA 4NO0D 1HXMB 5GISH 3OR6B 4O58H 2Z91B 3EJYC 4S1DD 4JCMA 3ULVD 2C9AA 4BFEA 5C07D 4MS8D 1WC7B 2DF3A 3SGJC 4ZXBA 3WFZA 4KXZH 3CXDH 4HKXB 4ZD3H 3RI5K 2NPLX 3DSNA 1PSKL 2YKLL 2XNAA 5C9KA 4LVEA 4Z7UA 1J5OH 3RAJH 3TPUA 3F7VA 2RQ8A 1V3JA 4K3EL 4Z0BH 1NLBL 1FVDA 2M26A 3VFSA 2W0LA 5SWSD 4CADA 2VO5A 4BM7A 3UYPA 5I1GH 3QXAB 2QTEA 3H7LA 3W0WE 4NBYB 3HFML 3MROB 3O2DH 4Z76A 1DUZA 2MJWA 2BXZA 4BQBA 1UZ8B 3O2WL 5I8EA 5DD6A 3NABH 1JNJA 1XT5A 3TT3H 5HD8D 1K2DB 1HH9A 4NQDD 2ZUQB 4O9HH 3HC3H 1RZ7L 3VXNA 3DURB 2EO9A 3L7FB 4ZUUA 5EOQL 2A6KB 3GGWB 5IESL 4LQFH 5F1NA 1H5BA 2VE6A 1HWGB 1U3HD 2Z0BA 3KLAB 3CFKA 1XCTA 3MR9B 4LVHB 5IVXB 5KSUB 2IBZX 3T0ED 4WGVB 2NTFA 2XZCH 1BQHG 2VLME 5MI0B 5HY9A 2IQAA 3MLZL 3GMLA 3IJHA 2XOTA 2XWBB 2BNRA 5F9DC 3NCJL 4PJFF 1CFSA 3C5ZA 1F4XH 1MFCL 3HI5L 4G80A 5IB2A 3NIFE 5ESAA 1FO0L 3O9WC 5BVPH 2OTPA 1S9XB 3W2DL 2BFVH 1DVFB 1I9EA 2VIRA 5L7XH 1XF4A 3NIGF 4LSVL 2WBJC 5IB4A 5CJ8A 5JHDD 5JPNB 2KZ1B 4DGIL 2OK0L 3WIIH 3V6ZB 2HG5A 1MUJB 5D1XB 3DV6B 1I8KB 2EICA 5EG6C 2R2HB 1TVHB 3W9DB 2JCCB 3VXOA 1FFPB 2P46B 2VOTA 6FABH 4CN6A 3L95B 3QUMA 5MERA 1EUUA 4N1EA 1FC2D 4HWZB 1GSMA 2V5MA 3HS0B 4Y19B 5H37G 4BSWB 3CK0L 4ZQKA 4NJ9L 4KTDL 3NA9L 1CD9B 3NN8A 2WM0A 2AJ3A 4P2RE 3UJJH 3OPZH 4E5XB 5I1IL 4PJBA 3C09B 4XC3L 3JZ7A 2EDEA 2GK0B 4HUWB 5D2LE 4LLQA 1L0YA 3UAJC 3CAFA 5C0BB 3FAXA 1ZLWK 4KHTL 1G9EA 4I13B 1T20A 2DQJH 4YHLH 4DUVA 4APQB 2IBBA 1UVQA 4ZFFB 4UINL 1MCPH 4PJCE 5JOFB 5HBBA 4L3CA 3SJVD 3QZWB 4HCRH 5B38A 1NMCB 4HS3B 2ZCKH 5D9SA 4ZFOA 1J05A 5GSVB 3HG1B 1FNEB 3BD3A 1FVEA 4M1GH 1DR9A 4X6EB 1CCZA 2EDFA 2W9EH 2Z93B 2D0FA 3QXDA 2R1YA 3L7EA 3LHPL 4O51B 5A2LH 3QWOA 3O6LL 1V7MH 4MJIA 3ALWA 4HX1B 3ULUF 4WO4A 4JKPH 4DOHB 5C0GA 4EOWL 3RL2B 5GZNC 1ZV5A 2OP4H 4EI6B 3UTTE 4I48B 1QD0A 3EOYG 3JUZA 5DC9B 1JPSH 3MRQB 5GISL 2EDJA 2NXZC 2YD4A 1MFEH 5IVZA 1LGVA 4YXHH 1HXYA 3HHRB 5JW5A 3O81A 3ARDD 2HRLA 2MWCA 2VXSL 4LEXL 2Z8RA 3B8YA 3MRMA 1O7VA 3CMGA 1IAIM 5HYFA 4S1QH 2AJZB 1TCMA 5H37H 3O3UN 4PJ5D 2HKFL 4GRLA 4QF1A 3RUGB 5JDSA 4OJFH 3CXHJ 3K7UA 3GIZH 3P9MB 1RHHB 4Z95L 1RUQH 3IGAA 1YEFH 4NQSB 1KT2B 4KK5C 3V6OE 5LQBH 5DA4A 5IVZB 5AYQA 5T1DL 2A74A 4G3YH 3DX6B 5DZNA 1DTUA 4NO2A 2DL2A 4H5SA 1BHGA 3ESUF 3WUZA 4HUVB 5SX4H 2Q87A 1M7DA 4AQ1B 3E6HB 1R3HB 1GZQB 1LMKA 4MJIB 5FO9B 4WU5B 1IM3B 1DE4B 5D7LA 5CEXB 4G8EA 2FEDC 3S36H 1TLKA 5I8CA 4PJEA 1DLHA 2IAND 4L8CB 1TJGH 5GSVA 4JEGB 2FNBA 3MLRH 1ZLVH 4UB0H 1IMHC 1JHKL 5CJXA 1MFNA 1DLFH 4PGBB 3UMTA 3QDMD 3MZGB 4ZFFA 3QXVA 4KWUA 4YXKH 3ULVH 4FFVD 1OW0A 1W8NA 4URTB 3GUTB 4OTXL 3T8XA 3O3BA 2IPTH 4YHPB 3W0WA 1RZJL 4NN7B 2EO1A 5F7EL 4HJGB 4OLUH 4LVNC 3IDNA 3FT2B 4WVRA 1E6JH 1IKNC 2K1MA 3LVEA 4Q2ZA 4X98A 3O41B 4ONFL 2EXYC 3X14A 3MLPA 1YUHA 1F13A 4JHWL 4HLZH 4PY8J 4OKDA 3RPIB 3RWCA 3VA2C 2BVPA 3KYOA 3L6FA 1TVHA 3PNWA 3SDDA 4Z7OE 5EIIA 5BRZA 5HDOA 1HI6A 6CGTA 4CMMB 3MLWH 1MUJA 5D1XA 1Z0NA 5DQ9A 5HGDB 1Z5LA 5J11B 4QRTB 5M7QA 2Y23A 2B1AL 3O4LE 4TSAL 1WBZA 4FNLH 3SCMD 2MNUA 3IDGB 4OAWB 2JK5B 4CL7A 3LN4A 3LB6C 4PJ5E 4Y5VB 3DSFH 4OI9A 3QNZA 5IB2B 1U0QA 5D7SH 1OAUL 3O0RH 3NCEB 5I0DA 1FORL 3OJ2C 1CFSB 1ZTXH 4R90H 3U1SH 3PQYA 2BNRB 4GLRH 1ZANL 1I4FB 1WIPA 1N2RA 5C0IB 2IQAB 4KI5F 5HY9B 5ICYB 4EN3B 3OXSB 3QCTL 1Y6NR 3SN6N 3TCLA 4FA8A 1OTSC 4JY6B 1U92A 1D5XB 3ULUE 5KSUA 5IVXA 3N85H 2HFGH 3IFNL 3FZUD 3TWCH 5HXMA 4RFNB 2VE6B 3GK8H 1Q9OB 2P8MB 1CD0A 1P7QB 2AJVH 4UZGA 4FZ8L 3SE9H 1KJMB 3TJEL 4NKQB 5IT2L 4UQ2A 1TVBA 2OQJB 2X89D 4HUXA 4P48A 1NAMH 5DR5L 5JXED 5JQHC 4JRYE 3MMEB 3EOBA 1QFOA 1Y0LB 5C2BH 1UZ8A 5I8EB 1MCFA 2W38A 3I50L 1A6ZA 3D85A 5IVOA 5IB1B 2IADB 1NCDL 1F8TL 2B7DT 4U1NB 4S1SH 2DWEA 3CFEB 3TPUB 1Z0MA 4EDXA 3E2HB 3ARYA 4AH2B 4E41D 5GGQH 4Z7QF 5M95B 4OCYL 1G9MH 3TV3L 5C6TH 3CSYB 2OR9H 2HMID 3PWNB 1R3JB 1S7SA 2AVGA 1PKOA 2QSCH 4JGMA 4HWUA 1K4DB 4KZDH 1HWHB 3T1FB 4GKNA 5LCVL 3RDTC 4F7CB 1RJZA 3T4YA 1N5AA 3MNWA 5IK3B 2FLBT 1N4XL 1FFQA 3SPVA 5MEPA 1Q0YH 4Z7WE 3BVNB 3KNBA 1IGML 3N9GL 1BQUA 2FSEB 5DS8B 2CO6B 3QDMB 2H32H 4K9EL 4UTBH 4ODUA 3RVWC 4BZYA 1IEHA 4Y4FD 4WTZG 2DLTA 1S8DA 3ZE0F 4N8VG 3OHXB 4NQVB 3GSWA 1GH7A 3P4NA 4NRXB 3GKWH 5FCUH 4HKBA 2A6IA 3RGVA 4HS8L 3IS1X 4M7LT 4Y19D 2XICA 1NL0H 1XGQA 4PRIA 2O26U 3CSGA 4Y1AA 2DYPD 1OGAD 1UFUA 3D69B 1S7TB 1MAMH 5E1AB 5HYEA 2V5RA 2VRAA 2FO4A 3F6IA 4LARL 1JV5B 1WWCA 4YHIA 1YQ2A 2R9HC 2F5AH 4OZIE 1A1MA 4LFHG 3DV4B 5D1ZC 5LGHL 4PJ8D 3RWDA 3WKNA 1KPRA 1D5BB 1F2XK 3D9AH 4J12A 4GRLC 4HEPG 3U2SB 2AJYL 2G75A 5F7MC 3LCYA 1CFQB 2E6PA 4JFEE 1ZE3C 1G84A 2BSRB 1T5XB 3GRWL 4F7MB 1E0OB 5F1KC 4P3DB 4JPWL 2G2RB 3IJYB 4QOKD 3L3JB 5AD0B 5GRVK 1CG9B 1B0GB 3QPXL 4Y16A 2D9CA 3OJDA 1UT9A 3D0VA 5TE7L 1WAAA 3EYOB 1NKRA 1ZVSB 3OAYK 4U1JA 4Y7MA 4AT6A 4IOIA 4OIIH 4JJ5B 3D3VE 2AEQH 3IXTB 3SQBA 3WN5B 3FRPA 4UOW1 4P3CH 3EFFA 4PV9B 4MXVF 3QPQC 1U3HB 3NTCH 3GMOA 2O5YL 1UM4L 2E7LC 3SKOA 1MQKL 2V6HA 5HTSA 4FQ2H 4EIZC 5DD5H 3J8F7 1JZ2A 3TT1L 3OGOE 5I74B 3DUSA 4OQTL 3RDTB 2WUCL 1ZHKA 3LEYH 5A3ID 2YD3A 2NX5D 4PJFA 2O5XH 3A6BL 4PRNA 3U46B 4MX7A 1PKQB 1FQ9C 3WIIL 4GQPH 2E5EA 4X4XA 1F90H 1OAQH 1R5IA 4YGAB 4Q9CA 1XH3A 4D3CL 1MCKA 1TZIA 4P2QE 3DX9A 3T2NH 3ARGD 5ALCH 1RK1A 5DJXA 1MFAH 1N64L 4GSDL 4CN4A 5T33L 2DOCA 1MFCH 1NFKA 3QUYA 4WW1A 4CU8A 4KKCD 2NY0D 1LO2L 1A9BB 3BW9B 5L8LB 1G7HA 1LO2H 1UJ3A 2XTJD 4UDTA 4G9FA 3CK0H 5MHSD 5TDPA 3DO7A 1WCQA 5A2KH 1XGPA 4N9GA 3QFJD 3Q1SL 4HPOL 5T3ZH 3IU3B 4UNVA 4NOFA 5GZOC 4DN4L 3WE6B 1SYVA 3OAZH 4UBDC 5DEFB 1J18A 4IDJH 2IEPA 1H3VA 5LVEA 3LAFA 1YDPA 5C7XH 1MVUA 3RA7H 4CKVX 4XBEH 3BEWB 5D1ZA 1BIIB 5CUSL 2HAZA 1S7RB 2W9EL 3R8BB 4OUOA 5CUSH 4NQEB 5LWYL 5SX5K 1U8HB 2PW1B 3SKUD 2DRUA 4KZEL 1OAYH 4YC2C 1QRNA 5BV7B 7CGTA 1PDKA 4LLYA 5AZEH 5E7FA 3RY6A 4M7ZB 3IAGC 3ULVF 2NNAB 3RKPA 5IUSA 1A0QH 2OM5A 2YKLH 2VLRA 1G6VK 3FCTA 4JKMA 1FNSL 2N1KA 3GSOA 5CZVH 3MLSL 1KIQA 3EYUL 2PW2B 4JZOB 5DMJB 2YXFA 2N56A 3QIBC 4NPYB 3SDCD 2NR6C 1LD9A 2J88H 3KWWA 4Z7NE 5BW7A 4JFPB 1JF1A 3LSOB 5D71H 4I18B 1H3GA 1YJDC 3HE6A 4WWID 3LIZH 3RTQD 5F71A 4Z0XB 1G7PB 4Y88A 3BIBX 1X5LA 2L0DA 1TQCC 1YEHH 3R0NA 4G8FA 3MODH 1P4IH 2X6MA 4HAFA 5CCKH 1GGTA 5DD1L 1A6AA 5C0FA 3L5IA 3ZKMC 4LEOA 3IRZA 1A2YA 3U7WH 2X4NA 4PJBF 2MMXA 2ORBH 3BRDA 1M1SA 3LMJH 5DJ0B 5KSAA 4ERSL 1FJ1B 1JPFB 2DAVA 5IJKA 1QO3A 4JN1H 4GRWF 2UWEB 4KVCL 3SDXA 3WS6A 3U7WL 3QIUB 3GM0A 4X6FA 5F7DA 4D8PA 1MCJA 5GGTL 1DL7L 4NT6B 1OAZL 1YC8A 4HAGA 4MJ4A 4A2MA 4JRXA 3EO1A 2C1OA 4KU1A 4PJDB 5FKPB 4LSPL 1LNUA 2PF6A 5E2VH 4Q6IA 4FFZL 1FNHA 1CGTA 3BQUA 3UTSD 2VLKE 4GKOA 4YDKH 4LU5L 4YO0A 4CVXA 4LU5H 2AEQL 2VN4A 4I0PB 2ZUQC 4RISH 5CSGA 3IB4A 2R29H 1CU4L 1KGCE 2H8PA 3AC0A 3QFJE 1T21A 4ONFH 1TPXC 1VFMA 2EIBA 5GQBA 3CVIL 4HK3J 4PJAA 2GUOB 1N6VA 3ME0A 5A43C 3UDWA 5F9WC 4ODTH 4QKXB 1HHIB 1QRKA 3TZVD 1QHOA 3G9AB 5EU6E 5EBGA 1U8LB 2V2TA 4BH7B 5EFIA 1H0DB 2PXYA 4EQ2A 1NGWB 2VDLL 5CP7A 3N1FC 3MLUL 5JOEA 3BXNA 2O5XL 3A6BH 3HZYA 4K07A 1MPAL 1KPUA 1EFXB 4ETYA 2Y9RT 3G5YB 1JZ6A 4F2MB 5A3IC 1U8MB 1U8KB 5L0QB 3CZFB 2DMKA 4XXCC 3L5XH 5ITFB 5IKCB 5KSBB 2H8PB 1OM3H 3ZE0E 5EZOL 2EZ0D 4Y1AE 1SJVA 5BV7H 1J8HE 1D5ZA 4P23C 5IMOA 4PGCA 5CD3B 1D5MA 3CZFA 1NDGB 3MOAH 4X80L 5E2WL 1CFVH 2LQRA 4G8GA 2C1OB 1J9CT 2HFEB 1KPUB 4PJDA 3CLEH 1KJ3L 3HZYB 3MUY1 4OCXL 1NGPH 3HN3A 3MRDB 2AEPH 2PXYB 1DBAL 4X6FB 3T0EB 3RHWK 3QIUA 1T04A 3MX0A 4PRPA 3ZE2E 3NFPA 3OR7B 4EKXA 3TJEH 3QUZA 2F53A 3V0VA 3HA0A 4NM4H 2OCFD 3G5VA 4UTBL 1FJ1A 4K23L 3EOAA 4PJAB 2L4OA 3B9EA 4LGSB 2B1HL 4EI5B 5D7IF 3VFMB 1TCRA 3I02A 3S88L 4LEOB 2R0KH 1I7UA 5HHPB 4WHTB 2Z4QB 2J8UE 5I71C 5IFHL 3N1PC 4YO0B 4CVXB 1Q72L 1GGBL 4M62H 3GI8L 2R9HD 1R24B 2B4CC 4BZ2L 4I18A 1JF1B 3LSOA 4QXGH 3D3VA 3EO1B 5FKPA 4JRXB 1LD9B 1T7XA 1NGQH 1ITCA 1JHLH 1Q72H 4OCYH 5DLML 3HI6L 4MNQB 2BRRH 1EFQA 3ARSA 3RWIB 4OKVA 4LCWE 3H9HA 3I50H 2YK1L 3SEPA 2MQ0A 2F19H 2X4RA 4QXUH 1OHQA 3TNNA 3SQOL 1RU9H 1QSFE 1II4E 1F02I 4JFEA 4WTZA 5FYKL 1CIUA 3VWKD 2CDFA 3WFBL 3BWAA 4JRXE 4XRCA 3EJZC 1BBDH 5AZ2H 3O6LH 1U8HA 2GFBB 3SE9L 4AMKH 4YBQD 1S7RA 4O2FB 3B2UC 1F3JA 2BC4A 4N0UA 3CU1A 4XPFH 4TPRL 5DQJB 3I84A 1YYMH 4XP9H 3ZDYE 5C0AB 2I27N 3WE6A 4UQ3B 4JZJC 4JZOA 4M6NL 4PRPE 1HIML 4ZODA 3E6FA 1KCKA 2YD2A 4N9GB 5HHVH 5EOCH 4FQXC 4MZ2A 4BFBD 3Q48A 1JNHB 1JBJA 2AABL 5I73C 4FMKA 1MI5A 3B5TA 4DVRH 5GRWA 2IQ9L 1QRNB 4QO1A 4WWKA 4H0HB 2Y36H 2RBLA 4OZGE 4HW6A 4TSCH 4HIEA 2GITA 5GRUH 4Q0XL 3RWJB 1BFOA 1TZIB 5TGBA 5DC0A 1FGNH 4EJ1C 3UBXA 3NCMA 1XH3B 4X6CE 1U42A 5CZXC 5K9QG 3VD7A 1EJOL 4YWGH 3LEVH 1VEPA 5C0DA 4F9PA 4MCZB 2VXTL 2AKRA 1Y6MR 4N9OB 3BAEL 1FCCA 5ID0A 2JCCF 5TDPB 1XZ0A 3FQXB 1U95B 4JHAL 1NCTA 3HC0B 1N5YH 3FB5A 3PWVA 1MEXH 3GMOB 3S4SG 4GAFB 3O8XA 5D7SL 4PV9A 3UPAA 3EOTH 1I1FA 3GNML 4LCUB 4U1KA 1OGTA 1FRGL 1N26A 3FOLB 5F9JB 4IOIB 1CDIA 3WKML 3S5LA 3PHQB 1NL0L 3OJDB 4YXKL 3ULVL 4FQIL 3S6CA 4RMSA 4HC1H 4ZUWA 1PKQA 2DQCL 5AD0A 3CDYA 3G08B 3OKMA 1BMGA 3MV8A 4I5BA 1EA9C 4WY7H 1DBAH 4JFFB 3SO3C 1ZHKB 3MV9A 5EUOE 5TDNB 1NMBL 3LEXB 3GIVA 4U1GB 3QWRA 1BP3B 2WZPD 5JPMA 1KPRB 2NY4D 3RWDB 2OZ4L 3E2HC 2R4SL 3TBYB 1NMBH 3EFFB 5DJCB 4Q9RL 2ZOLA 1UWXH 3WXVL 2BVQA 5MENB 1ZVSA 3EYOA 3STZA 4OD2B 1P5VA 4FFYL 4MB5A 5H94B 1DUYB 4OZ4A 3TH4T 3OKOA 5GS3A 4M9PA 4JZJB 3UCRA 4LPWA 4M5ZL 4HKBB 4S1QL 3OHXA 1QOKA 1S8DB 1RFDH 2WAHA 3GMRA 1U2CA 3UTPD 3LEYL 2ORBL 1I9JL 4NO3B 2FHFA 4D9RD 5FGBC 1Q0XH 5F1IA 1N5AB 1JV5A 3PL6B 4UUJA 5E95B 3VJ6B 5MEOA 2VQ1B 4HJ0D 1UACL 1CFTA 2XKNA 1C08A 5E4IA 2VITA 2JJUA 2EKJA 2OXGA 3WIFB 1F58H 1XGQB 4OCRH 2XN9D 3WFDL 5I74C 2EC9U 2NY1D 3OMZA 4NNYA 4PJ8B 3BOVA 3P4NB 3PGDA 1RUQL 4GG6E 1UB6A 3CFEA 2DWEB 4DN3L 4DVBA 4Q9BA 5I18H 2FH6A 5FXCH 3MGOA 4IIQB 5FK9A 3D85B 1YMMB 4HWBH 2AABH 3KNBB 5TQ0L 2H2SC 2F5BH 2HT4D 4NIKB 1U3ZA 4JDVA 1RJZB 3MLUH 3MREA 3T4YB 3MMEA 1E4XI 1JTOA 1QLRA 3UYRH 1DQTA 4IIQC 1TVBB 2OQJA 3GBMH 4HUXB 3FN0H 1EXUA 3BI9X 3ARRA 4M93B 1BEYH 1A21A 1S7WB 2HJKA 2P5EA 3WIHA 2HJLB 1IC4L 4OQTA 2F54B 2GAZB 2MSPA 1UYWL 1NEZB 4Z7VF 4GT7A 1T0PB 4NQCD 4PJ9A 3RIFK 1FFOA 4U49A 4P0DA 4I0CC 3MYJB 1JMXA 3RP1A 4KAQH 3C08H 3VGFA 2A6JA 4P2YA 3OB0H 4HV8A 1LO5A 4QHUB 4H26B 1B6DA 5J0BA 4ZNEE 4B53A 1QSEB 1A22B 5I1AA 1ZT7A 1HYRC 2P5WD 1IVLA 2CMRH 2X7LB 1WZLA 4OLXL 4XP6L 3UTQB 3LN4B 2EDLA 4RFEB 1T1WB 5CHNB 3NFNB 4DKFL 5CWSA 5HDBF 5ACLA 5I9QC 3E0GA 4XVSH 3DROA 1INEL 3C60D 5CEYB 2I07B 3ARFC 3FOMB 1MLBA 1Z5LB 3LZFH 2AJXH 1RI8A 1R3IH 5BO1H 4JY5H 4OQ1A 3T04D 3VXSE 2UYLA 3Q6FB 2OR9L 4HS6A 5KN5B 2BNQD 4M7LH 4DQOL 2XY2A 1EEYB 4EN3A 4L29A 5ICYA 3MBXL 1CS6A 3Q3GA 3X14B 4M6AA 3O41A 3TN0D 1EX0A 5GPRA 1NH6A 4LVOC 2EDXA 3EDDA 4AZ8A 5F6HI 2X41A 2Q7NA 2XIDA 2ZPKL 1XIWB 4JO2H 4WFGE 4ZAKC 1YYLH 3U83A 4YHPA 3W0WB 2Y6SC 5GGTH 1TJIH 3LS5L 4ZMAT 4I3SH 3B6SA 1U8NB 4PJHE 1TETL 4OCXH 2ESVB 1HYSD 4JFYA 1L9NA 3TGXA 1OAXH 3DBXA 3HNVL 4O5LH 1MIML 3CFDB 1ZLSH 3GNMH 5EIIB 3ZZ1A 1FZMB 2EKSA 3WNLA 2SEBA 3HUJB 1ZA3B 1CXEA 4F8TA 2H41A 1MCSA 4L8CA 2DI8A 1L7TL 4KDVA 3TLRA 3V6FB 4G8EB 1OWWA 4JFDA 1YEKH 2FWOB 2Q86B 3M17B 2NYYC 4HXAH 5L6YL 3G5ZA 2AK4B 3PWPA 4MSWA 1BVZA 2HVJA 4PD4J 1Z9LA 2ED8A 5E4EC 5C09E 5JLZB 2X4SB 4QHMB 1K8IA 4QGTA 4L5FH 4KDTA 2DJ4A 5SV4A 1G7MA 4HGMA 1VFOA 4ETQA 3QAZC 4HUVA 3I2CL 2C3VA 3I2CH 4NO2B 2OL3H 1A4JB 4M48H 4NCDA 1F11B 5TQ2L 3O3AA 2W0FA 5KVGH 4FMFA 4OGAD 3G6AA 2FEEL 3QDJE 4RGNB 2LAAA 4OZFA 4WFFE 3MJ9L 3NFSL 4MDIA 4F3FB 3MA9H 1RZFL 3KPTA 1UWEL 2UZXB 3RUGA 3KR3H 4X6CB 5L8JB 4YE4H 3MSPA 4PYHA 5E00A 4MXVE 1NCWL 4NZDA 4N0CC 5DD3H 4WU5A 1ZK9A 5IGXH 1A6VH 1F90L 5DVKA 4YNYA 1MIEL 3TVMA 1R3HA 1CL7I 4E0RA 3ET9F 1HXYB 4X8JB 2J3SA 5D7IA 3GSXB 5EUOA 3I6KB 1F6LL 2BHZA 5DRWA 1MF2H 1F4XL 2EE3A 2NY5C 3T65A 4HPYH 4HFUH 3K8KA 1PY4A 4YBLC 5J56B 5EOCJ 4WDIB 2I9TB 4EI6A 3C6SA 3GSXA 1AXTL 3RL2A 5C0GB 3JSSA 3MUJA 1MI5E 2YWYA 1MRFL 4OCWL 3QNYB 1ZLUK 5FCUL 4Q58C 1JF6A 1AGEB 3O6FD 1MH5B 3KYMB 2BK8A 3HAEA 2AJZA 3OG6B 1OQOA 2R1YB 1QQDA 2HT3D 4CJ1A 4TULL 4YPGB 4X6EA 4F3FA 2EC9T 1ZS8A 2F19L 3GSQB 5CKGA 2XACC 4OZFB 3IETA 5C2BL 5D2LF 1WT5C 3MV8E 5DMIL 5JOFA 5HI5D 3G6AB 1PLGH 3U9PL 2EYRB 4FZ8H 4APQA 3TC9A 3O3AB 1JYWA 4AIXA 5C0BA 2H2PC 4H1LG 4HUWA 3F58L 3QB7C 4MXQD 2NXZB 3GSUB 5ID1A 5M94B 2WSKA 4AG4L 3CSPA 5T1KD 4JM4L 1I8MA 4XVUC 2QR0A 4WO4B 4HWZA 1G9ML 4UU9A 3TV3H 1P7QD 3P77A 1NMAL 4XMKL 2FZ3B 3O2DA 3KS0J 5MERB 4XGZB 4NKOA 4PY8I 3WHXB 4O51A 3PIQA 2Q86A 4JFDB 1KN4L 3ROLA 2ZP0T 3S8WA 3LEVL 1FHGA 5GRVL 1W0WA 1I8IA 3VXOB 1XGRB 5B38B 2R2HA 4ESKA 4IRSB 3PG2A 4N68A 4LASH 4QTHB 4POZC 1KIPA 3DBXB 2I60H 4PP1D 1T20B 3WSQH 3ZT5A 5DGQA 2I5YL 3GSNH 3JVGC 3FO2A 4LOUC 3H42H 2I5YH 4X9BA 4QTIH 3B6SB 4MCYB 4PY7A 3FL7A 5J9PB 5IB4B 1H9VA 3WDHA 1DVFA 2QSQA 4NWUH 4WEBH 4ZQKB 2FX7L 2MKWA 1S9XA 1LEIA 3RBGA 1S7XB 1U8IB 3JWDL 3V4VH 4PJCA 3G6DH 4RA3A 4XZUB 3QUMB 4XWOD 1U41A 3SKMA 4FQJH 1INQA 4KKNA 4GJTB 3IJHB 3OXRB 5F7EH 4CMHB 1AR2A 2HFTA 4S2SB 4YHZH 5E99L 1P7HL 2NTFB 3DI3B 4MXWL 5KN5A 4FTVB 3G6DL 2WBWB 4LSSH 3CFJB 1NDMA 5ADOH 3K0WA 3CFKB 5KVFL 3DV6A 2HG5B 3GGWA 4DAGH 5T3XD 4OGXH 1BQSA 1UKTA 5CEYA 3OKNA 3SE8H 4F9LC 4CU7A 4P9HH 3IDJA 2ZSWB 4FRWA 4OCMC 3I6GA 1XF4B 4Y2DD 3UBXG 4H20H 4OZFG 3D5OF 4LSRH 4F33B 2NW3A 4PRBB 4XC3H 1RQ5A 2XKSA 4NUJA 4YHNA 4ZO8A 5KS9E 2O5YH 1IKFL 2FJHB 3EO0A 5I1AB 1TNMA 1J1OH 3C5ZB 4KKBD 5HVGB 3K2UH 4Q9QL 1OCWH 1BZ7A 3C2AL 4LP5A 1DBJH 4QHUA 5E2VL 2ENYA 3VFSB 1NFIA 3CPLA 3KPOB 1NCCH 4R0LA 2BZDA 4M5ZH 1OW0C 2DQHH 4Z7UB 4HWEL 1CZ8L 3VD4A 2CLVA 2GAZA 2ERJC 2QSVA 4IHOB 4HUKB 3KLAA 3EYQC 4OB5H 1B4RA 1S7WA 1R3LA 2A6KA 1B6UA 1AGFB 1HHHB 3BPLB 3OJVC 4ZUUB 2HTLC 1ZKAA 3BH9A 2DQEL 5MP6L 3L7FA 4Y4HC 3RU8L 4Q9RH 1A3LH 4K8RH 1QLRB 3MJ8B 1FYTE 1LO3L 1UM5L 3RWFB 1TPXB 5DD6B 4OF7A 1S9VB 4LVOB 1TTFA 2MCG1 1AR1D 1XGYL 1DN0B 3BIAX 3UDWC 3TFKD 1NPUA 3WUWB 5D1XC 4WO4C 1P84J 5CILL 4KRPD 5E56A 5K9JL 3FFCB 1WLHA 2QQKL 2D7TL 1ONQB 1X5KA 1HN1A 4ZXBB 1WC7A 2IQ9H 2L7UA 3OQ3B 4FOMA 3SDAC 1EBAA 3LKOB 4WU7B 3VXMB 4MD0A 3NVQA 3OR6A 3ZYIA 3P9LB 4PJIB 4R7NA 5EU6A 4XBPB 5IFJB 2CLRA 4GAJL 4S0TD 4KZEH 3BRGC 5ICZA 3NPSB 5F1IB 2C4FU 1IARB 1UM6L 4A6YA 5DFWH 3KPRD 4XPFL 4EUPB 5ILTH 8CGTA 4XBPA 5L9DH 3FRUA 3D25B 4R6UA 4PRHA 2F8OA 3GMMB 3TNMA 4TOYH 4U0QB 3A6OA 1J5OL 2XZQL 5F7WC 4JZJA 3MRIB 5D6DC 4NC1C 1SMAA 3STBA 5C0BE 5IMMA 4ZUTA 1FN4B 2GSIA 3JTTB 5B4MC 4HIJB 3F7PC 1CDJA 3OV6A 1EHXA 4J2XA 1P7KA 4UV4L 3TBYA 2R23B 2F54D 2LU4A 3C6LD 3K3QA 4RGND 5JPMB 3LQZB 1S9VA 4YFEA 2Z35A 2PYEE 4KUCF 2UWEE 3GIVB 4BK5A 5FYJL 4PS4H 2PCPA 1OVZA 1FNLA 5CP3H 2JTDA 3RBSA 1WZKA 1S7QA 2ZJSH 1TITA 5CINH 3ORJA 3OAUL 3LOWA 5E6IC 2AJXL 3W11D 4GRMB 4XCEA 1DEDA 1IE5A 3IDUA 5FYLL 2N4IA 2CLVB 3BPCB 3RNQB 4YHKH 4UT7H 4KUZL 3BKJH 1ZLSL 2ZJSL 3MA7B 2VR4A 5CEZE 1UCBH 4R3SA 2QQQA 3C60B 4AQOA 1N5YL 1I1FB 1CR9L 3KYAA 4U2ZA 1BZ7B 1INDH 1HILA 5J12C 2FJHA 1H8OA 5FO7A 5DK3A 1IEBA 2Q8BH 4NUJB 1XF3B 3FQXA 4HZAA 1BD2A 3OKYA 2QHLA 1AQDB 3MOAL 4V2CB 4YHYC 3QO0A 3BDYH 3REVA 1CF8H 1OAZH 2DM3A 3DYPA 1N0LA 2DQCH 3TPKA 4DTGH 3T3PF 1BQLH 3ARGC 3LKNA 4FZEL 2R0WL 5BVJB 3QR2A 1Q1JL 4JFQB 5ENWA 4J3VA 3LS4L 1K6QL 5HGHA 4M02A 3B9VA 3H8NA 4QHKI 3P2TA 5DJ8B 3VFGH 1LDPH 4QRRD 4MAYB 4ODHL 4WNQB 5E8PB 1BLNA 3EYFA 3WKMH 2JCCE 3OXRA 1AKJA 2GITB 3BP6A 4ELKA 5JHDE 1J8HB 2ZG1A 4FXGA 5IFAL 3SKMB 3CH8A 5DXWA 1FYTD 1U8IA 4LHQB 3EDKA 2DBLH 3OKLA 2R2BA 3EGSA 5I1KH 3JV4A 3IU4H 5KW9H 1JNHA 1LEIB 1AGCA 3FO0L 1HIMH 1JWUA 3PV6B 4D0DB 2VDPH 2WW8A 1QA9A 4NQCB 1WT5A 2ZKHH 4WCYL 5IOPA 1TTUA 1I85C 4PY7B 4XX1E 1AE6H 1UEYA 1C5BL 3G5XA 3T77B 3F65A 4UQ3A 4KPHL 4HUMB 2WBJA 3TZVB 1LE5A 3AVEA 1OPGH 3FT4B 4EBQL 1KIPB 3OGCA 2X2YA 5DQJA 2CDGA 4G7VL 3DVNB 4DK6A 4XNQB 4NC1E 5FEBA 5I6XC 3G04A 1W0WB 3FN0L 4OM0L 1VGEL 5K9KA 2UUDK 4M8VA 5K59E 4QRUB 3HCVA 3HZMA 1EFXD 2CDFB 2UZIL 1ZAGA 3QI9C 1CDCA 3TBVA 4LVNB 1EAPA 3D87B 3V4PL 3TNNB 5KVDH 1WICA 1JGEB 1N4XH 4PRAB 3HI6H 3TN0A 5T3ZE 4L8DB 4M00A 4OKVB 4OLZL 3VGAB 4FQ2L 1DSFH 2BNQA 3PWLA 3PWJB 2X1OA 1KPVA 1IAKA 4L8SC 2E6QA 3D3VB 2DKSA 4RNRB 5LGKA 3H9SA 3M8OL 3QISA 4YLQT 3IETB 1EHLL 5E1HB 4WV1A 1ZLVK 2R1XA 5LBSL 4QOKE 4MQ7B 3NH7L 4PBVC 1ORQA 3HNSH 5INCB 4ZG1A 4GO6B 2LTQC 4HZLA 4XPTH 4ODSH 1AI1H 4WHTA 1ZA6B 4GKZA 4NP4L 4X7SH 4KRPC 4G6MH 2O5ZL 5HDLA 2ESVD 4CW1A 5DHVA 3QEQA 4P2CG 4J23A 4PP1C 3EOAB 2IH1A 1U8JB 3SE8L 3TJHC 4QY8A 1OF2A 4P4KC 4KRNA 3DLQR 4U4BA 3C6SB 2K3TA 3ZMRA 1SEBA 1GGUA 4PRPB 4YDLC 4H20L 2P45B 4YHOH 5HI4C 3V79C 3MQIA 4LSVH 4HCRA 4LCCC 4XXDB 3H9SD 5ESVB 1MRFH 1VPOH 4OCWH 3I6KA 4G8GB 4MDJB 1EPFA 3QFDA 5HPMB 1T3FA 2YBRA 2R8SL 2CGRL 1EHAA 4RFOH 1WWAX 5CD3A 5IMOB 5I73B 2WIMA 2I9LA 3GMNB 3F12A 4Y4KB 5E8NA 2XXCB 1GC1H 1VPOL 2H1PL 4X0KB 5E5RB 1NBZA 3MOQA 3C6LA 2M2DA 4W81A 3BJ91 5ITFA 4AY0A 1YYML 5TE4L 4TUOB 1U8MA 1U8KA 5MI0C 4PLOB 1CXFA 3OSKA 2HT2D 1EFXA 2BVOB 3QIBA 1ED3B 4P57A 4UI2A 4PBXA 3MUGA 5D2LA 3BKYL 3HR5A 5DC4B 4IRJD 5LG1A 1N6UA 2DKUA 2HT3C 3R0MA 2ZG2A 2C3VB 1U8LA 2V2TB 1MWAH 1B90A 4NC2B 4Y16C 2AJSL 3T09A 3MJ7A 2PKDA 5CMAB 2W9LA 2VN7A 1OARH 5JLZA 4X6DA 4TSBL 3M17A 2CIKA 4O2CA 3AREB 4K7PL 3S96A 1ZHLA 5BMFH 3X13A 4HMEA 3KG5A 2R0LL 3TBWA 3VI3E 1S5HB 5JORB 5CBEA 3VFOB 3DO3A 1LNUB 1IRAY 2DQHL 2HVKB 3BMWA 4P9ML 5I2IA 2FIKA 2ED9A 5LXGL 1MEXL 3U79A 4X4YB 1X5XA 1W72H 4QXTA 3V2AR 2BVTA 1U8NA 4N0CD 1Q9WB 5F7DB 5EA0L 3U0PA 1J1OL 1A3QA 1BBJA 3SDXB 1RZKH 1UA6L 3W81A 3CX2A 2Y25A 2ID5A 3D2UD 5DD0H 4YZFF 4AL8L 4P23B 4J1UA 4J6RL 3TYFB 3UEZA 2XRAL 4RMRA 1ZT4B 5KBNC 3LDBB 2FH8A 3QHZL 1VERA 4ENED 4QHLB 2EDTA 3MLYH 3NA4A 4ONGL 5GGSA 1U91B 1TNNA 3U4BL 4U1MB 4WI6A 5T1KB 1QFUL 5L2KA 5DT1L 2C26A 3BDXA 4R2GB 5EZJA 5TF1H 3U36A 1JNLH 3DROB 4PGEA 1JZ4A 4X9HA 4XAWH 5FA3B 3V5KA 1E27B 3NFNA 1DSFL 3QP3A 4NQXB 3VGDA 5I1KL 1FZJA 2ZZUT 3FCTB 3HRPA 5J06A 4MA3B 4ELMF 4RMWA 5EULV 5HYSG 5K9OA 1PLGL 5T1LD 1NSNL 5KTEH 1ZT7B 5L0QC 4MWFA 4NKMB 5F1OB 4JY4B 1WZ1L 4BELD 1NC4D 4C56E 2NLJA 4G6KH 4U7MA 3LPGA 3MYJA 4R4FL 1QBML 4JRYD 2OYPA 5CILH 3VXUA 1D9KC 1FFOB 4OV5A 4C4KO 1QSVA 2F54A 2OLDA 5KVEH 5GJSH 3WO4B 2CPCA 2P5EB 5DEFA 1IAIH 3BUYA 3HLAB 1NCUA 4HDIB 3SO3B 5I15L 4JFOA 1RUKL 2EXWC 3MJ9A 1LO3H 3CLEL 2AXJA 1IBGH 3SOBH 1UENA 3C8KB 4HK0A 1UKSA 4WHYG 5IQ7L 4LSPH 3ARZA 4WI3A 3GBNH 3EZJB 3H9SE 1A9BA 3QUKB 4LMQE 5CAYB 5FF6A 5E94A 4U6XA 3WFEL 3SDXE 4RFOL 1YMMA 4WW1B 4MAUL 1NCAH 4LGPB 4Y8AA 5FDWA 5EU7C 3SE3A 1LQSR 3CVHB 5FM5M 4YGVA 5IROC 2EDKA 1EJ6A 1OAXL 4PG2C 5DHYA 1B2WL 3REWB 1CL7L 5DRXA 2ZUWA 4RAUA 3LS4H 3QUML 4H1LB 4HS8H 4G5ZL 3RX7A 1VHPA 3ARDC 2QL1A 3C5SB 2D0HA 2XKNB 1I7TB 1F4WL 2AW2A 4U1HA 1KNOA 1NJ9B 4NNXA 3MTRA 5FV2A 1JI2A 4DKEL 3MRRB 5I75B 2VXTH 1IM9D 4XVJH 1JL8A 3D39D 3SBWC 2VABB 3VFTB 2XV6B 5JO5A 3DNKA 3WN5A 3O11B 2E9JA 3VFUA 2DQGH 4AT6B 4HKJB 5BJTB 3QHFL 4OSUH 1AC6A 5D5MA 5HYSB 3CIQA 2A73A 1G7QB 3QJFB 5BZWB 2H2SD 1MCDA 2JJSA 2NXYD 4OD2A 3STZB 1W72L 1IGJA 5T5FL 5MENA 5T5FH 3VRJA 4JVUA 2J4WH 3VFUB 2ILLA 2PTUA 1DLFL 3L5WB 4EDWH 1UXWA 1AIFA 2VXVH 3FFCD 4BQ9A 1IL1B 3CVIH 2HH0L 4PPTA 2EH8L 1NC4A 4LLWB 1MHHA 3MLVH 1BF8A 4J3OC 4YHIB 1H3PH 3VU2A 2FO4B 3VDCA 3MV8B 4I5BB 3R8QA 1KCVH 2AV1A 5K9JH 2HFGL 1T0NA 2WINB 2NZIA 5HI3C 3KXFB 4RAUB 5T33H 1I3UA 4JREC 1NGXA 5SX4I 1EGJL 4JJHA 4LRNL 2Y5EA 4Y0GA 1IGYB 3NZHH 4NQVA 2R4RL 2P8LA 3MV11 5L2KD 4U1KB 3MRFB 3TA3B 4OZHF 5B39G 4Z95H 5IHUH 1I3VA 2F58L 5FDWB 1P6FA 3RIAF 3ZT6A 4AEFA 1D6VH 3GSVB 5B3NA 5E94B 1NCWH 2X44D 2XWTB 2UZIH 2FX8H 3ARXA 1U95A 4KZDL 1MHEA 5ALBL 4I8DA 5ID0B 3VW3L 5C7XL 1A1OB 4LBEB 2E9BA 2UY6A 2YD6A 3KAAA 4RMTA 3RHWF 3GM8A 7FABH 4O58L 1JPSL 3BUYB 3DVFA 5E9DE 3SO5A 1CBVL 4KY1L 3U7AA 4CVUA 5F8QC 2B1HH 2W0KA 2VZ3A 1AXTH 4RBPK 2C4XA 4MJ5A 3U6RA 3RWHA 3T0WA 3TM6A 4MQTB 4KVNH 4WFHE 1XGYH 4RA0C 5J3HC 1T80A 2F5BL 4PJGB 4PTUA 3O2VH 1TJHL 1MAKA 4RGOH 5GGUA 4GXVH 2NCMA 4NNPL 1Y0LA 2C1PA 5JNYA 4NGHL 1E27A 3V5KB 4TNWK 3E6FB 1U3JA 2BVUA 5EZJB 5D7KE 1P7QA 2NY6C 4JM2B 4M4PA 5LGHH 1VCAA 4ZD3L 4GXUN 5EN2B 5KZCB 4U1MA 5T1KA 3MJ9H 1YY9C 3O45B 1GOHA 4Y19E 3S34H 1T0MA 1U92B 4DCQB 2BC4B 1T03H 2X05A 3OXSA 5C0RL 4O2FA 5C0IA 4HD9A 3CZJA 2V9TA 5HSFA 2DL9A 4QCIA 3D2UB 4APQD 2Q7YA 4YHOL 4V1DB 1T5WA 2LE9A 3QNZB 3VXSB 2XI9A 1E4WL 1KELL 1Z9SA 5BXFA 4CU6A 3VXRE 3ZKSD 1OSZA 5F9OL 3ZSSA 2H26B 2W91A 4MMXC 3U0PB 2RFXB 1KCRL 2FRGP 4LNRB 1KIUA 4Z8FL 3O2WH 4LPXA 2HFFB 1GPOH 3N9GH 5HGDA 3RTQA 1SEQL 3GHEL 4O4YL 4DGIH 3BZDA 1JZ5A 3MJGX 5I2IB 2D2OA 3NZ8B 1J0HA 4LHJB 5BRZB 1JZ7A 3QO1A 1NLBH 3X12B 3ROOB 4DOHE 1AXSB 3RZCC 3RPIA 5DO2D 3RWCB 4WW2C 1GC1L 4ORGB 4U3HA 3VFVA 2P5WA 1I7UB 5HHPA 1XCQA 3ARTA 2VDQL 4R26H 1OWRM 3GJFK 2BSSB 4ODVH 4WHYH 3W9EB 4EI5A 5ISZD 1UM4H 5DK2B 1JNLL 3MLZH 5L2JA 4X6DE 1QLFA 4GFTB 2F53B 3UTSE 3V0VB 4EEEA 1X7QB 3H3PH 1VDGA 2NY4C 5E6IA 1T04B 3U0WH 4ZDHA 2R56L 4Q9QH 5BQ7B 1QP1A 4GS7C 3BPNB 1D3CA 5D2LB 1T89C 3H3BC 3LKSB 1YJDL 1FDLH 3MRHA 2HFEA 4PGBA 5EUKB 2Y7QB 1RZIB 2XA3A 3MV7D 1H8SA 2R56H 4OF5A 4MLSA 1D5ZB 4IRJB 2G60H 4S10A 5HVFB 5JW3H 5I8CB 1NBZB 2IH3A 1ZMYA 1MJUL 4X0KA 1MRDL 2BVEA 2UVEA 3GMNA 5FO9A 3S9DB 5JUEH 4PJ7F 4M3JA 2YS4A 4UINH 2GCYA 4QT5B 4FQCH 4FQ1H 3VWJC 3D18A 1VKXA 4F2MA 3VFRA 4XP4H 1YPZE 3QFDB 4OCNC 3OF6A 4OLUL 1N3NA 1ADQH 4LLMA 1NBVL 2C3XA 3BXNB 2EECA 1CICC 2IANE 2ATPB 3CU7A 1AH1A 5HHNB 3ES6B 3DX6A 3DJ9A 2EDBA 1FG9C 1BFVL 4JDTL 2NY2D 3RL1B 1HHIA 5I17B 1MQ8A 3MLXH 3IGAB 3A6CL 2CXKA 5KVDL 3FAWA 1M6OA 2VZ1A 5DJYA 3RA7L 3P9MA 2QQKH 4BFGA 3LH2H 3WD5L 4GRLB 2CRZA 3FB8B 3H2WA 5FAAA 1TZGH 4X6DF 4I0PA 5HVHB 4MQ7A 2V7HB 3D39B 1RZKL 2ADIB 3IS0X 4WV1B 1KFAL 4JM2D 5D71L 2YA0A 3GJEA 4PJHF 1AKJD 1GJIA 3TIDB 2VH5H 4HEME 1KEML 3F5WA 4KH2A 1J86A 4KKAD 3AXLA 4HG4J 4RAVA 3WFHB 4ALAH 3MLSH 2E3VA 2WQ8A 3RU8H 5HGBB 1WBXA 3MXWH 4L8DA 3S4SA 1EO8H 4KKLC 5EOTB 3BN3B 3UTSB 5ERWA 3QDJA 4WW2A 1F3DJ 1KCUL 2EDNA 4G6JL 1JGEA 3FO0H 1KCUH 3QIUC 3DGGA 1FIGH 1I3RA 1EAPB 3QUZC 4HX1A 1ZTXL 3U4BH 5GGQL 4O5LL 3S36X 4QRUA 5DK0A 4FS0A 3OAUH 3TA3C 4ZUSB 2Z93A 5LKNA 2BNUA 1J05B 4ODHH 3CX5K 2WUBL 3E3QC 5F7LB 1HEZA 4L4TB 1AFVH 2OSLA 2QQNH 4GG8A 3TZVC 4L3CB 3L3GA 1UVQB 1XGTA 3DECA 1JPTH 4A6YL 5HDQL 3T77A 1V8HA 4FABH 2D7QA 3F62A 2ZOKA 3PWUA 5D96B 1NEZG 2CD0A 3GRWA 3MRBB 4NQCA 1QA9B 3MO1B 2A77H 4PJCF 3UPRA 1IGCH 3GKZA 4Y1AD 4TUJA 5TFSL 4YX2H 4KJPC 4Y19A 4LCYB 1SY6H 3IAPA 4OFYD 1Y18B 3RGVD 2ITCB 2PW1A 5E9DD 1YMHB 4FQXB 1J8HA 2ZNWA 4HIHA 5FGCE 4MAYA 3F7YB 3SKNB 2JCCA 2W92A 2XKUA 2F15A 1MVUB 1QLEH 3BUTA 4PP2A 4ZS7H 3BAEH 1DQLL 3NIDF 3ZSTA 3TIEA 4G43A 2FEEI 2HTKD 2IAMC 1NFDF 2VDLH 1PZ5A 2VWEC 4JLRB 3W82A 1BAFL 1XGPB 3NAAH 5TDOB 2VIRB 4D94A 4JFHD 1A64A 2XN9B 3VA6A 4JANB 3FQNB 3BW9A 1MFEL 1J7VR 1HILB 3VI3F 4UNUA 1YQVH 2NR6D 3KPRA 4X4ME 4BKLB 3O4LD 4OZIF 1BECA 1XEDA 3GKWL 4IMKA 1KYOJ 4KY1H 3IFPA 4R3SB 3X11B 5ANMB 4BFIA 1T2QH 1CGXA 5GRZA 3D85D 4DK3A 4HGWB 2VLKA 5EOQH 5IHLB 4LQ1A 3J7HA 1JWMB 3MR9A 1R3IL 1A3RH 2VLJE 1YY9D 1H5BB 5EZIH 5F1NB 4FP8L 1CD1A 2AI0H 5E70A 2DQIL 5IFHH 2XYCA 2NY6D 1UCBL 3DURA 1ZT1A 5GGVY 3VD3A 4YZFE 2MKLC 4J4PA 5AZEL 1HCVA 1U58A 1E28A 5ELIA 1FL3B 2NY5L 1J88A 1QNZL 5FECB 2ZUSA 3V8CA 5ITBH 5BVPL 3KYKL 1QEWB 1PQZB 32C2B 1P4BH 2Q76B 5C8JB 3ARBB 4OF6A 5KG9A 4YE4L 1LK3L 1KYOK 3AAZB 2K7PA 4LHUB 4CDHA 5A1AA 2VWEE 3IXTA 3QA3A 1HH6A 1W2KT 3DYOA 4KTDH 2FHCA 2YHGA 3BH8B 4XNMB 1FN4A 2GSIB 3D6GA 3SQOH 3D0VB 3WNNA 1EHLH 2OBGA 1I7ZB 3ILQD 2XTJC 3X3FH 2PO6B 5JQ6L 5C0EA 4AEIL 3X3FL 5I30L 5JQ6H 3GDBA 4EBQH 2G2RA 4C56D 5FYKU 2BSRA 5CJQH 2CRMA 3MV8D 3E8UL 1UQSA 1M71A 4JPVL 5CLWA 4P99A 1BVKA 3OTTA 4ISVB 1TDQA 3WHE1 1D5BA 5IMLA 3BGMA 3IU4L 4RSVA 1A1MB 1G0YR 1XR8B 2CLZB 2BSED 1RURL 4NYLA 1RURH 1QVOB 3CNKA 4GXVL 4PJIA 5EU6B 3OKKA 4OZHA 2DJUA 5FUCE 1S7TA 1SYSA 1WJ3A 2VXSH 2Z8WC 4LEXH 5E1AA 3ZDZF 2IAMA 4NUGL 1HSAA 5GGSY 3VXMA 4WU7A 4KTYA 2XZZA 4Y2DA 3FHQA 2EE2A 2XTJB 1LK2A 3AS0A 1NANH 1ONQA 4HT1H 3SDYH 3RTQC 3S7GA 4RISL 2AXHA 4GW1A 3GSWB 3N1MC 2VKWA 4Y5YA 1T1ZA 2J2ZA 3U9PH 1C5DA 3IRPX 3Q1SH 3LDBC 4GG6B 5CJBA 3Q5TA 3WUWA 4KROC 2VDKH 4TSAH 3QDMA 1DQJA 4XCNA 1AP2A 4MA7L 2OMNA 4OCSH 5E6YA 1DP0A 2IG2L 5AAMA 3O3DB 4Z18A 3WLBA 4QGYA 1FL5B 2AGJH 3P4LA 4XB8A 1BQHB 2DM7A 2W1NA 5FCSH 1VEOA 5C3LD 3GJFB 2LFGA 5SWQB 3BH9B 3L1OH 2F9BT 1K4DA 3PJSA 1AGFA 1KLGB 3L3OB 1KN4H 3MV01 5DDHB 5F89B 4ZS7L 5JZ7D 2E9WA 1L4IA 1ZVYA 3CSYA 1RMFH 5IEHB 1URLA 2ARJA 4JKKA 5BZDB 4QWWC 4Q74A 1WTLA 4R0LB 4U1NA 5IEKA 5IB1A 4XMLL 5T3XE 2Z31D 3EHBC 3HG1E 1I8LC 2JKXA 1EGJA 2QEJA 3MGTB 2EYTB 4HULB 3V4VL 3O6FB 2NW3B 4RQQB 4WEBL 3EOBB 4LDEB 1YY8A 1WFTA 1JHKH 5EO1B 3I6GB 1MHPL 3MLVL 5IIEA 3V4UL 1OB1B 3IDJB 1KJMA 1OTUD 1T66C 4I3RL 1NGZB 4JRXD 1MJ8H 1Q9OA 2P8MA 3ARDA 3H0TA 4L3EE 2X1WL 3B9KD 3IT8D 5BS0B 1VGKB 4G7YH 2VLJD 4JPKH 5J7CC 1FZKA 3UTTA 3TCLB 1A47A 2Q6WA 2ARJQ 3LY6A 3QEUA 1DEEA 3RDTD 3TO2A 1QUNA 2PUQT 4EQ3A 3L3KA 4Y4HD 4OUUB 1DQLH 3PQYB 3DPBA 4YEEA 4F15B 5IQ9B 4U1LB 1C8PA 2APXA 5F3HA 1FO0H 2ADFL 1KSRA 3R4DA 2BERA 4QRSB 2GYSA 4P2OB 5I1DA 1JP5A 3NCFB 1ACYH 5F9AC 3IDGA 4XP1L 5GRJH 1FORH 1OP5H 1EIBA 1X6LA 3CH1A 1CGVA 5EU5A 3ZLQC 1MFDL 4KQ4L 5GGRA 3DRTA 4KKBC 2RJMA 3CC5A 4O00A 2F53D 4AMKL 1TQBB 4RWYH 3PNWB 4WFGD 2A0LD 1G6RA 4JQIL 3VFWA 3O9WB 1P2CB 2VXVL 4GAYB 4NBXB 5TF0A 3SE3C 3LRSB 5ADPH 1X5FA 1I9JH 3PIQB 4HIIB 5KJRH 3EO9L 5TE4H 1YNKL 3FO9B 1EBPA 4G8GD 4PLNC 4KRLB 1YZZA 3E1F1 2GJZA 3NACH 3W39A 2QR0B 1CI5A 4HWBL 1PD6A 4HJGA 5ICXA 5F7NC 4DAGL 4BZ2H 3PV7A 5E9DB 2P7TA 4HF5H 5D1ZD 3GUTA 3MFGB 4HG4K 3IDIA 5ECJE 3QG6A 3TYGH 4FFWC 5TF1L 3ILPA 3R1GL 1WWBX 5FYJD 2EYRA 3MXWL 4C58B 1T1XB 1YN7B 4H0GA 3FRPG 4XP4L 4DWHA 1ZS8B 5I16B 4LLUA 3ULVE 1X5ZA 1FNGB 5J6GA 5DJ2B 4YPGA 5DEGB 1KENL 15C8H 4E9LA 3WXWH 4GKSB 4AIZA 2XZAL 3NCCB 1CT8B 3S35X 1IM3A 4U6HB 5EZLA 3PWPD 1GZQA 1EGJH 4M6OL 3E6HA 4OLWL 1KXTB 1KFAH 5DUML 3RX8A 1QBMH 2NTSP 3RVWD 4X7CC 1T22A 1FGVL 2A9NL 2PR4H 2W65B 1RVFH 4OGYL 4CNIB 4MQSB 1BVLB 1CQYA 5E6ZA 4MA8H 1A3LL 1PX4A 1GVIA 1NANI 4IS6B 2PYED 2H3NA 2OP4L 3MPCA 5DRWB 3A6CH 3QCTH 1BEYL 4MA1C 2EDQA 5EUOB 4QEGA 5HHVL 5IB3B 3VXRD 3IFNH 3C5JA 2V2XA 1X5AA 4DGVL 4NQDB 5FM4A 4ZTOL 3UC0L 2CKBH 3BD5A 2RHEA 4GMTL 4GMSH 4TRPH 3TO4D 3WV0A 3LZFL 5TQ0H 4NQDA 3MRMB 2Q8AH 4XNXL 5D93C 2HYMA 1M7IA 4ONGH 2ZUVA 3S97C 3GIZL 2F58H 4WUUE 3HTLX 5A2JH 4OLXH 4XP6H 1F11A 2QSTA 1BBDL 1AQKL 4J7RA 1PBYA 4R4ND 5BRZE 1GAFH 1KXQE 1LVEA 1TJIL 4HMCA 2EDYA 2WP3T 4H88L 4WENB 1NUFA 3KXFE 4QOKA 2A83B 2FIRT 1HCFX 3A67H 4PG9B 3GRWH 1YJDH 4QHMA 5HHME 1PW3A 4YDVA 1MLCA 5C08B 1G6RH 2AK4D 3S37H 2AK4A 3PWPB 2GTZB 1F45A 3RKDD 1A7OL 2VERN 3V6FA 1TQBC 1RV6X 4JAMB 5EZOH 1WCBB 3V5HB 5I8OH 5I16A 5HPOA 3UXFA 1QFWL 2EKSB 2NY2B 2DIBA 1YN7A 3QZWA 4KVCH 5F7YC 1KN2H 2GJ6D 2IBGA 3CFDA 5B8CC 3V5DB 1QRND 4L8SA 1FPTL 3ILPB 5FGRA 4P2RB 1D6EA 4GRWB 5FA4B 3WDJA 4LLQB 5D6CB 2EIZB 1U93B 4PJBB 3INUH 1U8PB 4O02L 3RFZC 3NN8B 1LE9A 3MACH 3LKPA 3HS0A 3UPCA 2BP3A 3V4UH 2GJZB 3K8MA 3CD4A 2NY3C 1CU4H 3ZYJA 3STLB 3L95A 1KULA 5E5UB 1YPZF 4XVTH 3SKJH 4L29B 3CXHK 1FFPA 1RJYA 2AQ3A 1FZOB 2AXFA 2PYEA 4PJBE 3KPMB 3ULUH 2VR9A 3GSNA 4Y4FB 4NN6B 1NC2D 2VL5B 4G6FD 3ZE2F 4MLIA 2G5BA 1IC7H 2W60B 5GGRB 1FBIH 3PDOB 5TE6L 3V6ZA 3HRZB 2X4QB 3FOMA 2I07A 3HG1D 4OF3A 4UT7L 3EFDH 5JPNA 1HQRA 3QQ4A 3ARQA 3MXVH 4R26L 4OM1L 1ODAA 2YC1B 2OS7A 4YIQB 3L5JA 3UTQA 2BY1A 4P2OA 1OL0A 5JZ7C 3VWJB 2KQNA 3D1MC 3OAYH 2OI9B 3FTGB 1QSEE 1WSST 1WITA 5EWIH 3BZ4B 1CWVA 4NSKA 4H26A 1IT9L 4ZAKA 2XWBA 3CSBA 5HHMB 1PEZA 4P59H 5L7XL 1DEEB 1VGEH 4K3DL 3UJTL 3NMEA 1ORSB 1CF8L 3RZWA 2Z31B 1MVFA 1NEZA 1VGKA 5JIHA 1XCTB 2FL5A 2P44B 2VLLA 3B3IA 3E8UH 5DFTA 2J8HA 2CK2A 3PP3K 1NGZA 3P9WB 2IPUK 4KRMB 4OT1H 1EXUB 4X9FA 1RZGA 2ZCLH 4XMLH 4MGXA 4QRQB 1Q9KB 2DWDA 3TWCL 1S5IL 5KZCD 4LAQH 2PO6C 1JFQL 1U2HA 3ELAT 4RQQA 1XIWC 5I8KL 1PG7W 2K9UA 1FNSH 1FFNA 1CXLA 3KPPB 5DTFB 4BSJA 5GHWH 1DUZB 2EH8H 1GZPA 5HYQB 3KHOA 4HIXL 1NLDL 4DW2H 3DXAE 3DMMC 3QXAA 2ZWLT 3MGOB 3T4AB 1FL6A 1A6VL 3SE4A 1YNTA 4UIKH 5FGSA 1FVCB 2DTSA 1UB6B 2KL6A 4MNGE 4N5EC 4PYGA 1RFDL 3I6LD 3PGDB 4LSTH 3WNKA 2AGJL 2ARJB 3P0YL 5IHUL 4G7YL 4PJ8A 3ZKND 1JZ8A 4PJGF 1MCPL 1A7RH 2EH7L 3WIFA 4DZ8B 1CXIA 4EUPH 4G8GE 2RCSH 1K3ZA 3PQYE 4GW5B 5SWQA 1KELH 2J8UB 2YPLA 4PJIF 1ND0B 1P84K 1FCGA 1YEGH 5BRZD 1OGAA 2YEZA 3VG9C 1SJHB 4Y4HA 5FM8A 3SDDD 2O61A 3ILQC 5I15H 4RAHA 3DUUA 1Z9OA 3U9UB 2DQFA 2IJ0C 4JKPL 3MLTB 4XP1H 1LEGA 5I1HH 5D2NA 1RUPH 2F74A 4AENB 2AK4E 3PGCB 3IAQA 1FDLL 4HWBA 4XH2A 4I2XA 3HZVB 4JFHE 5D1QB 4C55A 5I6XB 3AMLA 4KK6D 5KS9F 4P4KB 4FQIH 4OZ4B 3KPRE 4RGOL 1SYSB 1RULL 1CL7H 5MENE 4NO0B 4NN6C 3ZDXE 2DQUH 1G7LA 3QCUH 5H8DA 4MD5A 3MRJA 2B4CL 3WMSA 3BFOA 1ZWIB 1UEMA 5C07E 4MA7H 4M7KH 2UV3A 1D9KA 4GAGL 4XPHL 4ISVA 4W4OA 3GO1L 2HRPL 4FXKB 5J13B 2PO6D 4MHHI 5DMGC 4N90E 1JGVL 5TDNA 1KF9B 2WLZA 1MI5D 3MV9B 2CIIB 2NY0B 4TSBH 4JFFA 3I3EA 12E8L 1OLLA 5E2UL 4M1CD 4KK8D 4M7LL 4DQOH 3BPNC 1UYWH 4YJZL 2PO6A 2F8XC 4NHUA 2Z92A 1AFVL 1EEZA 2QQNL 1D9KD 2A6DA 3PHQA 3NIGE 4LKCA 3FOLA 5F9JA 1YC7A 5AAWA 2EDHA 3BT2H 2IFFH 4LCUA 1GL4B 4LHUA 5I1GL 2HWZL 3QIWB 4PRIE 5C8JA 3DETC 2H6PA 3NABL 3WNPA 4XPBL 4PJ5A 5BV7L 4K3HA 2YPVL 3TBTB 3HI5H 3S98A 3BGAA 3DI2B 4B7LA 5MP6H 5F6IB 1CQKA 1FL3A 2FYYA 3P73B 5IF0B 4CBPA 4KQ3H 4YH6A 2FJGA 2YN5A 2MHAB 1CZ8H 5C0ND 1UACH 1MPAH 4X7FC 2VXQH 4XTRD 2KUTA 5D8JH 2UUDH 4WUKL 4BZ1H 3T1WA 3CFCH 1AGBA 4J4PC 3FT3B 3LD8B 3RX5A 1MCWW 3SCMA 4BFIB 1V7NL 1LEKA 1BFOB 3A0OA 4F7TA 2AS5M 4HIEB 4PRDB 4WO4D 5D1XD 1X5IA 1FAIL 3FQWA 4TYUA 1QBLL 4HFWB 4JANA 5I76A 5IWLC 3BIKA 2CRIA 3K74B 1OPGL 1IAOA 1R3KB 3BP7A 1WBYB 1HOCB 1PAMA 4UMGA 4G43B 5F44A 1NUGA 2YPLE 3IF1B 4M8QB 2RB8A 3HNVH 1G7IA 3VXQB 5DI8B 2HTLD 1KUMA 3QUZD 4KHTH 1FRGH 1ZXQA 3MZTA 4WUUB 4CRPA 4FQ1L 1SJEB 4XCFH 5SWSB 4LAJH 3TH2T 4P2RD 3UZEA 1F3JB 4LPYA 4JDZB 1MCCA 1HQ4B 1JGUL 4V2BA 1PYWB 5GGVL 1J8KA 3V4PH 4OLYH 4ZFGL 4Z7OF 2GY7B 5FUCC 5DJZA 3RY5A 1PGRB 2OI9C 4LCIH 1Y18A 1YPZB 4TULH 3TEUA 1T6VN 3DXAA 1PY9A 4QTIL 1GOFA 1MRCL 2GIYA 5F3BA 4PB9L 1S78C 3RVTD 3NFSH 1E4XL 5ANME 3LH2L 8FABB 2I24N 4P3WA 1P4BL 1B88A 3UX9B 5CEZH 1MHPH 2YSSB 4M93C 4G6FB 1B2WH 2XZAH 1MWAB 2HT2C 4JFFD 4CJ0A 3L3GB 5A2IH 2E8ZA 3DVGA 2IALA 2R69H 5JHDA 5C0CB 4HH8A 3BD4A 4ELMB 2Q8AL 4GG8B 2OSLB 5E4EB 3BO8A 1X5GA 5JW4M 3L3IB 1O0VA 4MXWH 3O6KL 4HBCL 2VDRH 5FYJU 1HSBB 2V5YA 1F97A 1A3RL 3G6JE 1K8DA 3IFOB 1TCRB 3I02B 2HLAB 1A7BA 2KQMA 4JRWA 2JJVA 5FYLH 3PP4H 4Z7WF 1NC2A 1KTLA 1V5JA 3G5VB 4KDTC 3GMQB 3KPSD 4NKIL 3QUZB 3UTSA 4U1IB 2PTTA 1CICB 4TQEL 3FFCE 5AUMB 5EBLA 5HI4D 5DSCB 5KSAC 3T0EA 5HGBA 3SCMC 5D5ME 4LSDA 3AXLB 1IKFH 2VSDA 5DFVC 3H7BA 1XF2B 1W8OA 3EJJX 1F6AA 3TBSA 4MAYD 5ACZB 3LKRB 3FQRA 1LK3H 4POZD 4LCWB 4N0YH 1OOAA 5T3XH 1PVHA 4UV4H 2V7HA 1U8OA 3VGHA 5MEQA 5KSAD 2RIKA 3O2DL 3DRQA 1KG0B 4N0UE 2EXYD 1OP3H 2CKBA 3EOTL 4Z77A 4JB9H 1I7RA 4TUKH 4D2NA 5L2KE 2FR4A 35C8L 2DJSA 1IGIH 2IPTL 3S35H 3BEVB 1SBSH 5L88L 3RL1A 5A16B 2NY1B 3U4EA 5CP7B 5DO2C 5F93C 1L9MA 5EFIB 3BP4A 3FONA 4K3GA 4MZ3A 4YPJA 1AJ7H 3OWEA 3JXAA 3QJHA 4JGUA 4PUBH 2EEBA 5C07A 2X1QA 3KLHD 1OSPH 4RIRA 4F15C 4LCCA 2JIXB 3D18B 4UTAH 3VI4E 2GCYB 4QT5A 1EVTC 5D72H 3KJ6L 5H2BA 3RJDA 3VFPB 5JTWA 3DRQB 3RZCB 3GSNL 1K4CA 1KJ2A 4BH8A 4KMTH 4NC0B 4NCC2 4M48L 1CFBA 1E6OH 2ATKB 1FV1B 5TE6H 1HNFA 4LRNH 1EEUA 2DMCA 4YQXH 4KK8C 4C57C 2DBJA 1NAMB 3QH3B 5KVMC 5IMKB 3FQRB 4WFFD 4APQC 4LGRB 1NBYB 3MRNA 2YZ8A 4NT6A 1KENH 1BJ8A 3GMPA 1JPGA 1F4AA 1I1AD 5BQ7A 3FQUB 2OL3A 4W68A 3PGFL 5EBLB 5DSCA 5E99H 4YHZL 7FABL 1MHCA 3GMQA 2CRYA 1S9KC 1NBVH 4DUXA 1ACYL 5DJ0A 2X42A 4JZNA 4OFKA 2EE9A 2ITDA 3SHSA 1L7TH 4XPGH 3BQUC 3DX8B 4PGDB 3KJ4C 1UXSA 1A6AB 5D7KD 5C0FB 2P5WB 1IQWL 3CVHH 4K23H 5LWYH 3GSRB 2EYSB 1QSZA 1G7PA 4WI7A 4Z0XA 3BO8B 3QQ3A 4H8WC 3S88H 4NHCL 1RIUL 3ARWA 1K6QH 4WGWB 4FP8H 5JHDB 4KVNL 3ARGA 5EIQA 3WHE0 1T66D 2OL3L 4CDGC 1T7YA 1JNNL 4EVNA 4ZOAA 1JYVA 1WIUA 3PDDA 4X5WB 5CGYC 1OSZB 1S3KH 3LPFA 2DB8A 3I3DA 2A9ML 5F3BB 3BGFB 5C9JB 5DLMH 1KC5L 3GB7B 1YA5A 3X3GH 5K93A 1T5WB 5GZND 3VXSA 5C0NC 2Z31C 3EHBD 4XHJD 1KJVA 3PABA 2OJZH 2FGWH 1HZHL 1P1ZA 3NGBC 2X9YA 4M5YH 1KJ2H 3NCBB 2P49B 3HZKB 1PYWA 4N0RA 4ZSOA 3M1BB 1BIIA 5DQDH 2BOBA 2H32A 5IWLA 2BCKA 1WEJH 1KTKE 1IZKA 2DLFH 3T3PE 1T0MB 3B9DA 4XNUL 4IMLB 3T0XA 3QZWG 1A7QH 5CJOH 5E6ID 5LCVH 5CJOL 3VXQA 4ZFZB 4RX4D 5EU7E 2GJ6A 3IF1A 3VCLB 4AJ0A 5ISZA 1HOCA 3AM8A 3H42L 5DGRA 2YUVA 2GI7A 2NX5B 1R3KA 4E41E 3DO7B 1T2XA 4MNHA 1JF5A 4LKXB 4HIXH 5GS0L 1JWSB 3BIKB 4OFIA 1IZJA 3TT1H 1G7HB 3KPLB 3GBNL 1QRNE 1M4KA 5TPWL 2FX7H 4C56B 3CX5J 4OZGA 1HHGB 1CTNA 2AQ1A 4PRDA 5J6HB 3GO1H 3CCHA 3TN0C 3U6RB 1ZHNA 1FP5A 2R29L 4JFZH 4ZOCA 1P4LA 4WWKC 3ECBB 1RZ8A 3SKJL 5DHVH 4AYFA 3HC3L 1R5IB 4ODVL 1TXKA 1A7RL 1AGBB 2EH7H 4UOJA 5GS1A 4WI9A 1K5NB 2EDRA 4F58H 4MX7B 4I77H 5CJXC 3IXAA 4OBSA 3PUCA 4K3JH 4MJIE 4NO5A 3BZEB 3PDGA 2DYPA 4FQLL 2DM2A 4YHKL 4AM0B 2FYYB 2XPGA 3P73A 4JG0H 3RDTA 5DYOA 5L9DL 1S7UA 5D5MF 5F7KC 3BT2L 3MUHL 2Z9TA 5T3ZD 1F00I 5IG7A 5IR1B 3R06B 1V3LA 3VXTB 1WAAF 3OB0K 5F96L 1J1PL 1HK6A 4N0FA 4JJ5A 4RZCA 4H8WH 4U1JB 1IGYA 3P3YA 4R2GD 3KPSA 4E42B 1P6AB 1ZLWH 4U6VL 2GJJA 1CG9A 2WINA 4KJQC 1T0NB 1OCWL 3C2SA 1UGNA 2NY0C 1GGIL 3L3JA 5INDA 3IJYA 5GGVH 4DGYL 3WJJC 3QRGH 5KOVC 3TF7C 5C3TA 4M61A 4YBHA 3SDCB 3JVGA 2V7NB 4QLRA 1MNUH 2G75B 3LQAC 3O6ML 2NZ9C 1AR1C 2XT1B 5TH2B 3EYSL 5AWNL 4JR9H 3TT3L 2IC2A 5CLTA 4XPBH 3DVIA 4WI2A 5TH2A 1ZWIA 2BHUA 4N5ED 5BOPA 3RVXD 1IQWH 4P5MB 2YWZA 3BJLA 3B2VL 3MRJB 3VH8G 4K8RL 1AGDB 2ZCKL 3EYSH 2V9QA 5GRYA 1REIA 1QR1A 1RZFH 5FM5O 4RGNE 2H9GB 3THML 1BWMA 2VKXA 3QCVH 1KCVL 2YUZA 4DGVH 3DXAD 3KDMB 1G7QA 1XIWD 3WS3B 2VC2L 4P5KA 4E42A 5D1QA 5B39A 1DFBH 4HKJA 5CJQL 4XH2B 3EUUA 3N06B 3NPZB 4P2OC 1R5VB 4N8CL 5E2WH 3NTCL 1MCWM 2NX5E 5FUOL 3EO9H 3UTOA 4D9QD 1YEEL 4ODUB 1IAII 5E8OB 3WEXB 4DFHA 1GIGL 2FX9L 3BVNA 1PKQE 5FDYA 3QEGH 3PQYD 3MNWB 1OGAB 2YEZB 4RWYL 3T0DA 4AEEA 3L3HA 2ICES 4PB0L 1YEEH 2HTKC 2IAMD 4HXBH 4PLKD 1KB9K 3FN3A 4HKZA 4NO5B 3BZEA 3KYNB 3C5SA 4XHQA 3GK8L 4JHWH 4KTEH 1Q0YL 3PWNA 2CKNA 3IDYB 1EDQA 1QFHA 1WVZA 4H1LA 2UVFA 4XAWL 4IOFC 1X4ZA 3CDGA 1KACB 4LIQL 4EDXB 2CSPA 5EZIL 5I1LB 1FBIL 1PSKH 1QKZH 4TTDC 1LILA 1LP9F 2IADA 3AROA 4TUKL 1RY7B 1KLUA 1AD9A 4C56A 1A6ZB 3TCXA 1CDYA 1NAKH 1NCBH 4OZIB 4KI5D 4PJXF 2HKFH 4DZBB 2C7UA 4QRRE 1ES0B 1JWSA 3SGKC 2VH5L 4I0KA 4HUUA 4PV8B 3B9KA 3ZL4H 1CYGA 2A9MH 5JMOC 4PB9H 1CFNA 4X6BB 4QRQA 4LOUD 4UQ2B 1DJSA 3RNKA 3C2AH 2XZQH 1DANU 1FYTB 2YD8A 4HDIA 3WYRA 4P59L 3OZ9H 4C54A 2CUIA 3W0WD 1H5BC 2V17L 4ACPA 2VLLB 2AK1H 2YXMA 5SV3A 4NP4H 2E7MA 5D70H 1D5XA 4NQDE 1X44A 2J12B 3EW3B 4ZSOE 5GXBB 3QDHA 3WXWL 3Q6GH 1C16B 4GMTH 3M1BA 2W07A 4X80H 3IVKA 1DQQB 2E7BA 1P1ZB 3BZ4A 1Q9LB 2VISB 2VQTA 1PFCA 2ZUYA 1RJLB 4JPIB 3LV3A 2M1KA 4PR5A 2WLYA 3GB7A 4MA3A 1A4KA 1IBGL 4Z7VE 2JK5A 3PGFH 3SOBL 1FZJB 3D39E 2FJFA 2YUWA 1Y6KR 4XVSL 3RKDC 1WBZB 3QQ4B 1E4KC 1CE6A 1VFAB 5F72S 3O4LA 5HI5C 3JBG7 1U6AL 5D7JA 2JB6B 4ZXBC 3SGJA 2W60A 4YX2L 5DMKA 5TFSH 1MWAL 4PJAF 5IW6A 3ARFA 2HJFA 2I25N 3KPMA 3HE6C 4KJYA 5DJ6B 2OMBA 5IW1A 1FZOA 4XXCA 3MAC