2MCPH

Refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKGNKYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARNYYGSTWYFDVWGAGTTVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Crystal Structure of the Mc/Pc603 Fab-Phosphocholine Complex at 3.1 Angstroms Resolution
rcsb
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1984-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpH02
3MLZH 3PWPD 3EOBB 1UXSB 1BEYH 1YUHA 5C86A 5MP6H 3H9SD 3L3HA 4K3HA 4NWTL 4TSAL 1HYSD 4HGKC 3SCMA 4OF6A 2MNUA 1OPGH 1KCKA 5GRXG 4KKLD 3D3VB 2OTPA 3TIEA 4NPYA 2HVJB 1N4XL 4YDKH 4Q58C 1ZLWK 3GJFB 3MLPA 1NFIA 5DHVA 4LSTH 3SQOH 4G80A 3B9DA 3O45A 4QRPA 3QJFB 4JZJC 3H8NA 3RUGE 2BY2A 4MAYC 4GRLA 5KVEL 1OTTC 5D1QA 3LD8B 4MA1B 3QIUC 2E27L 2ATPB 5FCUL 1BZ9A 4ZOBA 5GZND 1MCJA 4JDZA 1OP5K 3DBXA 1RIVL 1T1YB 2FD6H 4LCYA 3RDTA 2FBJH 5F1IB 4Z76A 4HFWA 4L5FH 5DJCB 4BKLB 1U42A 1JF5A 1JZ3A 4P2RB 1T7ZA 4WJ5B 3ZDXF 1UXWA 4JQVA 5DI8B 1AIFA 1QA9A 4I3SH 4YE4H 3VFSA 1QVOA 2WIIB 4WEBL 3B9KA 1F13A 1OD7A 3UROR 1X44A 3QUXD 4OFYD 5IW6B 4U6YB 3T4AA 3R06A 4TVPE 2QADD 3V4UL 5HDQL 5JW4M 3RIAF 4LHUG 5K59E 4WI7A 3BHBB 3TVMB 1MSPA 2SEBB 1DFBL 1MRFL 2CO7B 4UV7L 1CDJA 3BIKA 5HGGS 4XVJL 3ULUF 2Y06L 3W5MA 3UCRA 3OKKA 2BOBA 3CZFB 1C5BL 2O26U 4Y5VA 4DTGH 2ESVB 1KN2L 3T8XA 4HPOL 4Y5XA 5D1ZA 4LKCB 3TN0C 4EUPA 2X4NB 5I1CH 1LO0H 3D3VE 2QEJA 4K71C 3FOLB 4I48A 4LF3B 4QHMA 4V1DD 4FQ1H 2P5WA 4NCDA 3V6OE 3VH8G 4JY6B 3RWCB 3QFJB 4Y5YB 3W0WB 4UOW1 4J8RA 3HTLX 4XCYB 1FNGB 1RZGB 4XB7A 1M71A 4N0FB 4K94C 2CRIA 1HIML 1XCTB 3QIBC 1IL1A 4MB4A 5E2WL 4JPKH 2CK0H 1T22B 1J18A 1N7MH 3ZKNC 2EKSB 4JFPA 4GXUM 4HUWB 4PG2A 1KBGL 4N8PA 4JKPL 4NQCB 3EO0B 4P2OC 4PP2B 5BZWB 4F15C 4XHJD 5E6ID 1GIGL 4P2RE 2UVFA 5DJ0B 4FS0A 1J8HB 1NDMA 1OAQL 4LARL 1H15A 5JQHC 5E1AB 3WFCH 5J6GA 4N0UA 3H7LA 4FFVC 3CFKB 3ARBD 3PWPB 3F6LA 1JHKL 4PJ5D 4DJMA 2WQ8A 4EI6B 1SBSL 4U1NB 3H9SB 1FVCB 4F58L 5IROA 3VFPA 5IV2A 2VXVH 1ZWIA 4U05A 4JB9H 4IRSC 1RY7B 2ID5A 2FB4L 2VDKH 1BREA 1G6RB 4RAUA 4NP4H 5EU5B 3MLSL 4YAQB 5IW3A 3V7MA 5D2LA 3LEVH 2ESVE 5EBLA 3T2PA 3PGDB 4OZHF 3FONA 4CU8A 2ITCA 3X14A 4UU9A 5FO9A 3QFJE 1U95B 1S7SB 4UTBL 1Q1JH 5FM5O 2YA0A 5K9KB 3GJFK 2B8OT 3ZKMC 1JGLL 3C08H 3AY4C 1A7RL 1XCQA 1JNNL 4DEPB 4NCC1 3WS3B 1EFQA 2FJFA 2DF3A 5CJBA 4DGYH 1AY1H 3WXWH 4Y4HB 2DOCA 4NQCE 4G8IB 3RAJL 4EN3A 5IMOB 5JNYA 1KENH 4JEGB 4M5ZH 1QKZH 1S9KC 3ZHLA 2V2XB 3S4SB 1WFOA 2VQ1A 5I18L 3KNBA 1QD0A 5F44A 3SDAD 1MH5A 3QUXB 2DLFL 2RR3A 5ACZA 4XPAH 1J8HE 2GJJA 4M7KH 1G7JB 2QADB 1DVFD 5CWSB 3WKMH 5FIEA 5JUEH 4OB5L 3CC5A 4IMLB 3AMLA 3PWPE 4RCAA 1JWSA 1NSNL 2D7PA 4IOSD 2B0SH 1QBML 2J3SA 3H9SE 2DQJH 2E9WA 4X98A 1CR9H 3QJHB 3LMJL 3D9AL 3SO5A 3H0TB 5HVWA 1DLHB 4DUXA 1QSED 1IKFL 5JXAH 3HPLB 5BJTA 3O41A 1J0ZA 4C55A 4J4PC 5F1NA 1Y18B 3ZZ1A 1FL3A 1Y0LA 2FNBA 1F4WH 4HCRL 5DUBA 1MCEA 3OGCA 3RPKA 4RWYL 4CKVX 1K6QH 4FP8H 5E5UB 3HLAB 3MLUH 3W39B 4YBQC 3TBVA 7FABH 3HI5L 3IVKB 3RWDB 1FGNL 3REWA 3IXTA 1DN2A 2XPGA 4H1LG 4IRJC 3FMGL 1EHNA 1I3UA 2EH8L 3LY6A 3WDIA 4Z77A 4MNQD 5E6IB 1YC8A 2UUDK 3KYNA 1TTUA 5E56A 1A1MB 5DGRA 1WZMA 1NBVL 1GZQB 1A6ZA 5FYKE 3FQTA 3ARBB 4D8PB 4YHNA 4PJ5B 5B38B 2IFFH 4P9HC 2CSPA 3AUVA 1UH2A 3SO3C 4AENB 3UPRB 3HC3L 1J8KA 1QSFA 2AEQL 3VWJD 5A16B 2OP4H 2Q8BH 5JPMB 3P4NB 4HS8H 1E0OB 4OCYL 2IBZY 3ARGA 3TZVC 4I9WD 3FT2B 4EDWH 3IJSB 4ZNCD 4JPWL 3HG1A 3JV4B 1FCCA 3CSYA 4XH2B 1D5MB 3QYCA 1MQKL 4LP5A 5J3HC 2QQQA 1IGCL 3RNQA 3C60C 4PJIB 4UT6H 4EI5D 1SJEA 1CWVA 1E4XI 3E6FA 1EK3A 1PD6A 3D2UD 3DMMD 5IHUH 4HKZB 1CD0A 3RP1A 2HKHL 2PW2A 5CIPA 4KMTL 4WUUD 4BQCA 3IJHB 1P84K 4FMKA 1ITCA 4HC1H 2OJEB 4LSRL 3NIGE 5CP7A 4GJTB 5HJ3A 1I7UB 3VJ6A 5F9JB 4N5UA 3PF2A 3EOAB 2GK0B 2HMID 4AIZB 1J05B 5GGUB 3X3FH 4ONGL 2ORBL 1P4LB 3SDAB 3G5YA 1FFNA 1WSST 1CI5A 2NY2C 4RX4D 2PYEA 1T7YA 2WZPD 1GZPA 1RZKL 5EZOH 1DVFB 2VDQL 5DJ8B 1FRGH 1MFEL 5E0QA 4OI7A 4F7TA 2ZSVA 3L3GA 5C1MB 3UZVB 2Z0BA 4QHUB 1T20A 1DBAH 4PJ5E 4R90L 5IMKA 3QG6B 3CAFA 1W2KT 1FNFA 5EFIA 4HH8A 4MD0B 5SWZD 3VXSD 2FZ3A 3TPUB 5SX4H 3BP7B 5EPMA 2H9GB 1GGCL 1QSEB 4MA8L 4ETYA 5J06A 4K7FB 1IAIL 2G9HA 5GGSA 4UUJB 4NGHH 2VL5A 1MJJA 1LWRA 5HHOD 3U7WL 3VCLA 3GUTA 2ZCKH 3QUMB 3QDMD 4BM7A 1K4DA 3ALXA 1INQA 3ARVA 4PJIE 3MC0A 4L3ED 5IM7A 4XPHL 2YD4A 2VUOA 4U6XB 3I2CH 4WDIB 2QJDA 1N5YH 1WAAF 2YPKA 3U7YL 3BVNA 3JV6B 1BFVH 1DSFL 2ADFL 2HG5A 3QO0B 2CLRB 4XPTH 4M7LT 4HIEB 4CGTA 5K9JL 4PR5B 1EFXD 4MNQB 3W2DH 2ZUVA 1LGVA 3LIZH 4L4VD 3O9WB 5BV7L 3AS3A 1MAML 3QCVH 4J3OC 1D5IH 1HDMB 3I6KB 4JHAL 2IADB 3IGAA 4JKKA 4TTDD 1QSVA 4WW2B 3EGSB 1F00I 4YIQB 3NZ8B 4OM1H 2H32B 2FATL 2PXYA 3RIAK 1X5LA 1DQLH 3F5WB 3LN5A 3P0VH 3DARA 3VWJB 1KB5A 3BESR 1P1ZB 4Z9KB 3PABA 3P77B 4KGJA 2Z8SA 5KS9E 2G60H 4DKFH 1QSEE 3DV4A 4Q0XL 2EE6A 4NQEA 5E2TH 3OX8B 4PLJD 4Y5XC 7CGTA 1CGYA 3ZT5A 4EI5B 2I5YH 5SWSA 3ARDA 2FHFA 3WIFB 4M6MH 4MXVF 2DQCH 3D2UB 4WI8A 3DMMB 1ZANH 4NYLB 3RY6A 4HK3N 3IDJB 5AZ2H 5IW1A 4WUUB 4YDJA 5ANMB 2IBGA 5E8EA 3T3PE 2ZNWA 1MLCA 1O7VA 2WW8A 3O2VH 4POZC 3IJYB 2DQGL 2P24A 1XT5A 5CZVL 1QO3A 4MNQE 2Q86B 1GGTA 2AQ2A 2O93L 4V2BA 3C6LA 3EYFA 1LP9B 1WCQA 3LEYL 1QRNE 4UNTA 4F7CA 4Y7MA 2ILLA 4LQFL 4J3VA 1A7OL 5IBLC 4BH7A 4X5WA 2Y7QB 5JO5A 5BRZE 1PLGH 3HAEA 1CICB 4BQ8A 1HWHB 1UM5L 1WIOA 4PD4K 1NGWA 3K3QA 4N1CA 2VMFA 5IB3B 1ZGLM 1I9IL 4BFGA 2PYFA 3MACL 5E4EB 5SWZB 3VXSB 4OCSH 4HS6A 4PYGA 4G6KL 5GRVL 4TSAH 4GSDL 5FHAL 3MRHB 4GRWF 5DA4A 4I9WE 4D0CB 1UM4L 1PEWA 4LCCA 5F7YC 2X10A 1KG0A 1RSFA 5HHOB 4D9QE 3BRGC 3U46B 1FG2B 2GKIA 1N4XH 2J5LC 3HAEH 4HWZA 3VG9C 3QDMB 1FAIL 2IAMB 4KKCC 2HLAA 5EB9A 2YUZA 1DANT 4L3EB 2ZUTA 3DX9A 2A6DA 5J13B 4MHHI 1UA6H 4D0DB 2EIZA 5DK0B 1IAOA 3B6SB 5T3ZL 3LZFL 4N9OB 4JO1H 3T3ME 1BP3B 1GAFL 5CMAB 4ZDHB 5D93B 2E27H 3MA7B 5FCUH 1I8LC 1YY9C 1EFXB 3WL9B 1RIVH 5IVXA 1HXYB 5LGHL 4GW5A 4QXWA 2VLKD 3V6BR 5IB5B 4G8FB 1K5NA 1I8MB 5C09E 1MCRA 2MFNA 2VLRA 1AGEB 3VFUA 1IEAA 4LEOA 1EUTA 2EE3A 4WEBH 1LP9E 5CEYA 3K4DA 4MJ6B 4HV8B 1K3IA 1J11A 3I02B 3V4UH 1NEZB 3EYUL 1HCVA 2R0ZL 1ZVHA 1JPGA 3P11H 4QOKD 4R0LB 1DFBH 1MRFH 4M7ZB 2EIDA 4JM4L 4UV7H 5SWZE 1CDUA 2EDYA 3VXSE 3NFNB 4XVJH 4HJ0C 2Z31A 1E4KC 4U1JB 1FO0H 3BAEL 1JGDA 1XGTB 1KN2H 4Z0BL 4HPOH 4MQ7B 4D9RD 3QDJD 5ACLA 3VXTB 1A3RH 2VZUA 3QDME 1CN4A 3PWNB 1GC1C 5JHDE 1IJ9A 1JNHA 2GTWA 3CGTA 4I5BB 4F7PA 2IQ9L 4L3EE 4ZNEE 2EDNA 1UCBL 1HIMH 5H35A 5E2WH 3K80A 3FL7A 1D5XB 4JHWL 4QRUA 5F6IC 3MLVH 3GKWL 4YEEA 4OF3A 3QZWA 4JKPH 4RMRA 3E3QE 1S9VA 4NQUA 4PP1D 3NCCB 1CE1H 3PGFL 3EJJX 3BE1L 1LEIB 1R3KA 1D5BA 2EDFA 5D2NA 4FFZL 1GIGH 2JCCA 2F53A 3B2VL 3C8HA 1OAQH 4WHYG 1R5IA 3DVFA 4U1HA 1TETH 4F8QA 3DSFH 4I1NB 1K8IA 4M7LH 3BZ4A 1F02I 1I3GH 1SBSH 2Y72A 4F58H 1B4JL 2N56A 4MJIA 1JP5A 4XVUC 4OLYL 2BNQA 4XNMB 3G5VA 1ODAA 4Y1AD 3WN5A 4XBGB 4M48L 1W0WB 3VA6A 2AXHA 1ZTXH 3MLSH 4QXTA 5I1JH 5TE4H 4WEUD 1TVBA 4PJHB 1OOAA 1MNUL 1S8DB 2VLJA 5JR1L 5EO9B 2P47B 4O2FA 3P73A 1YPZF 3QIWD 4JM2A 3FT3B 4XCNA 1BFTA 3MRKB 2YN5A 2BSRA 1HSBA 4JGJA 1N2RB 4ZQKB 1A6VH 4P4KC 3JXAA 1MAJA 3DHMA 2EYTA 3PHQB 1JNNH 4MNHB 5D7SL 3LPGA 4GG8B 1NCCL 1BQSA 2VLKB 1XF5A 3CVHH 4XVSH 3I6GA 2VXSL 3RAJH 3UEZA 1AGBB 3HN3A 1CE6B 1S7TB 2F5BL 5AZEH 1BD2E 5HDBE 1NFKA 1N6UA 5I18H 4QWWD 5CJXC 2F54D 1ETZA 3LQMA 3VA2C 1MHHB 1WWWX 1QBLL 3IFNL 1LE9A 1ERNA 1FL5A 2XICA 4QOKB 1O5DT 3H9YA 4OB5H 3VGHA 5IG7A 1NSNH 1QBMH 1UZ6F 2RGSA 3B3IA 1ZHBB 2W0FA 3BSZL 1A2YA 3MUZ1 4Y8DC 4EEEA 3TYFB 4XC1L 1JUFB 2APXA 1IKFH 3THML 1QACA 1R24B 3U6RB 4KWUA 4QTIH 4R2GB 3MRDA 4NRXA 3Q6GL 3QNZA 4HCRH 2P5ED 5KVMC 4PJHE 5DVKA 3NIDE 4M5YL 1SEBB 1S7XB 1QR1A 2UWEE 3MO1B 4ZFZB 4ENED 4JY4A 2H3NB 4L4TD 1I1CA 5F3BA 2GQHA 2N7AA 2GUOB 4PJFB 5FCSH 3RL1B 1RFDH 5E70A 1YEKL 3QCUL 5EBGA 4P9ML 4CMHB 3DRQB 1FGNH 2Q87A 2P8MA 3IU3A 3QXDB 3TLRA 3FMGH 3J7HA 5CKGA 2W0PA 2EH8H 5BS0D 3MFFA 2VLKE 1QG3A 1J7VR 4PJAF 1BQHA 1WFUA 4UOJA 2Z8VC 1J86A 1NBVH 2JK5B 1KTDA 2NXZC 2QSQA 3IXAA 3PWUB 2NY0C 1IGML 2VLLA 5I76A 3HC3H 4QOKE 3C8DA 4PJBA 3OAYH 2AEQH 5F7HA 2B5IB 2NY6D 5IBUG 3H2WA 3F62A 4Y1AB 2A2QT 1OAKL 2GK2A 4X9HA 1N8ZB 3AS2A 4JFEA 4ZAKC 3QI9A 1JGEB 5DJXA 5GS3A 3F8UB 1U8QB 5J0BA 2XTLA 3CD4A 1IGCH 2I9LB 3LKNB 4W70A 1Q9WA 3CX5J 5DD1L 2EDTA 3DIFB 3UO1H 4OZGF 3IU4L 3MR9B 2OZ4H 2HKHH 1F58H 4KMTH 3L3IA 3CXDL 1RUPL 3NIFE 4PJFE 1U3JA 1J0YA 3ARUA 4LSRH 2ZP0T 2V5TA 5IESH 4GMSL 4FHBD 4M1DL 2AV1A 4LASL 2NXYD 4UDTB 2ARJB 3RTQD 5KG9B 3EAKA 2ORBH 3BXNB 4UNVA 1JTOA 5TH2B 2F54B 5FF6B 4PGDB 4GLRI 3D18B 1RZKH 4G5ZH 4YDVB 2VDQH 1MFEH 1TQCC 3MXVL 3VXMA 3DROB 4LLMB 3SKMA 1S9YA 2R1YA 4JFHE 2B4CL 4R90H 5C0AA 4XVTL 4HT1H 5C2BH 1A6AA 1X5FA 4HMDA 5ICZB 1RUKL 4P4RB 5IK3B 2XWJA 5L7XL 4YBLB 3FQWB 4OQTL 2VQTA 4BUHA 5C0JB 3GMLB 2NY4B 1MCWW 4P0DA 3CK0H 3U7WH 1AQDB 5H37H 5KSBA 4MQTB 4ZTPL 4M1CC 1ZLUH 4Y8AA 2OSLA 4RSVA 3HA0A 3L3KB 5B8CC 2OL3L 1G0XA 3OL2A 3U7YH 3I75B 1NJ9A 1DSFH 2JB6A 3O8XA 5I1EL 3ISWA 1GGIH 1CF8H 4PRBB 1AO7E 5K9JH 1BIIA 5BS0B 1F2QA 3BPOC 1WTLA 2NW2B 1HN1A 3MLTB 4JCMA 3MRNB 5BV7H 5KN5B 2K1MA 4FTVA 2V5YA 4KQ3L 4XNXL 2D2OA 4TPRH 5J7CC 2F54E 4ONHA 3L1OH 2OM5A 4QRQB 5LGJB 2K7PA 4Q6IA 4QXUL 3NCJL 4LBEA 3CX2A 2Q6WB 4HAFA 2FATH 4AT6A 4XHQA 4YC2C 2NY6B 2GCYB 2IPUG 4R7DB 3BDYL 1FYHB 4RISL 1P4IL 5DD3L 2C1OB 5BW7A 5ISZD 5T5NG 2FL5A 3UAJC 12E8H 4N8CL 1YECL 3MGTB 3D39E 3F6IA 4PLKC 5J57B 1N6VA 1U8LB 3ARSA 2XQYK 2QHRL 3KJ4B 4E5XA 5KSVA 4DZ8A 3IDGA 2NLJB 3O4OB 3RA7H 4JZNA 1RJYA 3GMRA 4OD2A 5JDSB 5FFLA 4ZUSA 8CGTA 1VKXA 1ZHNA 3MRLA 4M62L 3U1SH 5FYKU 2OQJA 3HUJA 3TJHC 2VIRA 1DQJB 2CD0A 4H88H 5C07D 4BYHA 2DLIA 5JOFA 5GGRA 5GGTL 2NXYB 1ZA3A 2DQGH 4NZRH 3RTQB 4DUWA 5BS0E 5CZVH 2DQFB 4FQCH 2YEZA 1ZLVH 2DI7A 2QSTA 5GXBB 4U33A 5KAQG 2CDGA 4L3CB 3WV0A 5HGHB 1I3RB 3BGMA 3JVGA 5DQ9A 4LQFH 1A7OH 4X4XB 4H8WL 4U6TA 3FB8A 3ROOA 4L8CB 3CFCL 4HAGA 2ICWA 4NZTH 3UMTA 4Y4FA 1I9IH 3DX7A 3VRLE 1I1YB 1MWAH 1IGTA 4D94A 3HE6C 4G6KH 5FO7A 3CVIL 4GSDH 3VWKC 5T3XL 1UM4H 3NCYP 5D8JL 2APFA 1A7BA 3S5LG 4QTHB 3KYOA 1H8OA 1KULA 5B39A 5C8JA 3LVEA 1RZ7H 5DUPL 2IMNA 3CFBB 2VLMD 3V5DB 5DFWH 4HIHA 3STZA 1AQKH 1MY7A 4LCUB 5IMLB 4Z7VB 3PWVA 3ULUL 5T3ZH 3HS0A 3QG7L 5DF0A 2WINA 4MX7A 3LZFH 1ADQL 1PG7L 5DLML 4I2XA 3V79C 4NKIL 1TDQA 2CXKA 4P46A 5GSRA 3VXOA 3KLHC 5LGHH 3WEXB 2AK1H 4TQEL 3LQAC 1WCBA 2NZ9C 1D6VL 1A1NB 4RGND 3TM6A 2HTLD 4Y19A 3U30B 4WTZA 1QFWI 1Q38A 2C4FT 3QH3B 5KANG 5CFHA 2ICES 4KKAC 1HEZA 2NPLX 1LK2B 4XWOC 4JO3L 1CK0L 2A74B 3EYUH 5D7LE 1MCWM 5F7NC 1EGJL 1P4BL 1R5WB 4IIQB 2R0ZH 1RJLB 4FQIL 5ISZB 2D9QB 3QO1B 5T33L 2CIIB 1OB1B 4MDIB 4NN6C 3BWAB 1QLRA 3QUZA 1GGBH 1YMHA 2ZNXA 3MV8D 3GGWA 1PYWA 3BAEH 4NM4L 4GAYB 1YQVL 3WLWC 4LVOB 2P8PB 3ARXA 3LKPA 3AS0A 3MNZA 5L2JA 2ARWA 4D3CL 2FX8L 3I85A 4X6FA 1H3PH 2HT3C 3SPVA 2P49B 5FYLE 2W92A 4R6UA 3RFZC 3F12B 2DKUA 4JQIH 3OJDB 1T04B 3BGFB 4MCYA 5DSCA 3S88L 3MRMB 5C07B 3SE9L 4JHWH 1B4RA 3BN9C 5IJKC 4IOIA 2LVCA 3GKWH 3MV11 4L8DB 5HGDA 3X11A 3NBNA 2EDEA 3LKRA 1AXTH 1KCUL 4Y4KD 4KUZH 1U3HD 1T4KB 3PGFH 5D5MA 2YPLA 3BE1H 5DQJB 3MRGB 4EIZC 3B2VH 5F7LB 1G7IB 3SDCD 1RMFL 5TE7L 4MB3A 1OP5H 1FFPB 1S5HB 1CG9A 1UKSA 1VEMA 1T0NA 3AXLB 1MI5D 3HZVB 1WWBX 2QSVA 1FYTD 3ZL4H 4L4JA 5FYLH 3V4VL 3KPOA 1B4JH 4N9GB 1BVZA 3MV9A 1HQ4A 4HWBL 5BZDB 5ISZE 3QWOA 5GZOD 3CSPA 1MF2L 3F7VA 3LRSA 4M48H 1KJ3L 1JN6B 2H45A 5CJOL 3LEXA 5F89B 4WRLA 3UTZA 3QQ3A 5JR1H 3GMOA 2ARJQ 4LLUA 4NQXB 4XPFL 4BELD 1V3KA 5KSAC 4B50A 1EXUB 3NABL 3DX8B 4MAYD 4MSWA 4NQDD 1NANH 1OTTD 1OW0C 3C5SA 4O51A 4UV4L 1N6QL 4WUKL 2AW2A 2P7TB 3MRIA 2YKLL 3TIDB 4W4NA 5HDOA 3RUGA 4PJDA 4HKBB 1NGZA 3HE7A 4PGBA 1FH5L 5D7SH 3SDXA 2VN4A 1VFOA 3S37H 2ZJSL 4FXKB 2R29L 5DJDA 4N90E 4DVRL 3GRWL 4ELMB 3T0AA 4RDQF 2VXSH 4N0CD 1AXSA 3FAXA 2F5BH 2XXCB 1M7IA 4B53A 5F9WC 2GJ6A 1TPXC 1YEDA 1YJDL 5C0FA 4JO2H 3WHE0 4HWEL 1NC4D 4WEMB 4HGMA 2C7UA 4KROB 1QBLH 4MAUL 1AHWB 4MCZA 5AWNL 5TJWK 1G9EA 5JIPA 1G6VK 3WIIL 1FZKB 3RIFF 3FHQA 4NHUA 4S1QH 3ZE1F 4Z7WF 5DJAB 4WV1B 3PE9A 2J7LA 4PRAA 3BSZH 4ZTOL 3I6LD 3MV8B 3QDGD 1CLZL 4FQXC 3EOBA 5F9DC 1UXSA 3TN0D 3THMH 4XWGL 5FUCC 4XI5C 3Q6GH 1JTPA 3U0PA 1P6FA 2BSSB 3L5XL 2HAZA 1HZHL 4NO3B 4M5YH 1X4ZA 2VLME 43CAB 3D3VA 2Q7NA 3LH2H 4EDXB 2HVJA 3CXHK 2GAZB 3X17A 1P7QD 3GJFA 1RJZB 3QIBD 1G9ML 1N59B 5AUMB 4KH2A 1LO3L 3ZKND 1NLDL 1YEKH 4NQVB 4P9MH 5JIKA 3V5KB 4OD3L 3S35L 3HI6L 3QJFA 4PGEB 1YEIL 4XNZC 2DI9A 5EORL 3RZCC 4Y4KB 1U3HB 5GJTL 1YEHL 4P2OD 1YEGH 2X4UB 3U9UA 1EMTL 5J12C 4ELME 2ATPA 1N3NA 32C2B 3VFMB 2NY7L 4HKJA 2X89D 4J1UB 3SDCB 1F6LL 1OY3B 4HJJL 5F1IA 4U1LB 4NC1E 5DJCA 4BKLA 1IGMH 4P2RA 5IVNA 5IUSA 1MI5B 3O6ML 3HR6A 5JHLH 5DI8A 5AAWA 1FYTB 4KI5C 2WIIA 1MUJA 4N0YL 1ES0B 5IW6A 4U6YA 5ADOL 1U6AH 4IRSD 1I75A 1B6DA 4I4WA 3ZE2E 3UPCA 1AJ7L 1C12A 2CDEB 3MV8E 3BHBA 3TVMA 2HT4D 2XWTB 2CLVB 1KELH 1PJ9A 5TQ2L 5DJ2B 3CZFA 4JZJB 4MAYB 1ACYL 4Z95L 4NQDB 3LV3B 1S3KL 4LF3A 3IU4H 4XNYL 3ZKMD 1X5IA 4JY6A 3RWCA 4Y5YA 3HNTH 5MERB 3E1F1 4ZSOE 3W0WA 5J1SC 3FN0H 1Z9OA 1J1OH 3CXDH 4XCYA 3BPLC 3K1KC 1RZGA 2QR0A 4E41D 4GUPB 4N0FA 4GMSH 1XCTA 3WFEH 5MENA 2IC2A 5D1XC 4R4ND 3DO7B 2PO6C 1JFQL 2J88H 5INDB 5LWYH 4M1DH 2EKSA 4HUWA 4OBRA 1FNEB 1CTOA 5E24E 1DQQA 1UWGL 3MXVH 4PP2A 5BZWA 3HRZA 4NWUL 1QFWM 1FVEB 4HXAL 2B4CH 5DJ0A 2VXUH 1J8HA 4XVTH 4XXCA 5HHQB 5E1AA 2UUDH 4TNWF 5HVFB 5I8OH 5L7XH 3ULVC 3CFKA 2E7CA 4NO0D 2OL3A 3PWPA 3TN0B 4OQTH 3ZDYF 3V9FA 4EI6A 3LDBC 4U1NA 4K71B 5I1AB 1FVCA 2Y36L 4J4PD 3BI9X 3FO2B 4ODHL 2WBJD 3JTSB 2RBLA 1FDLL 2VDLL 4KGLA 5LXGH 2DQHH 5C0EB 4APQC 5EU5A 5IEKA 3QIBB 5TDPA 3FO9B 1RHHB 4R8WL 4NQDE 3PGDA 4YBQD 3UDWA 3JBG7 2OL3H 3HNSL 5GS1C 1KPRB 5IMMB 5I1EH 1U95A 25C8L 4IRJD 4JDTL 1S7SA 3CFIC 1A4JB 5K9KA 4P2OB 1FV1B 1XR8B 1NFDE 1ZK9A 4JLRB 4FFYH 4LVHC 4F15B 1DANU 2W59A 3VXQB 4LAQL 4LRNL 4KQ3H 4XNXH 3MREB 5JMRA 3UTSD 3WS3A 5ICXB 5FYJD 4HLZH 4G8IA 4QXUH 5IMOA 3VGAC 3NCJH 2IQAB 4MJ4A 3T0EE 3BD4A 2V2XA 4OD1L 3SJVD 2P46B 5ID1B 3QUXA 4OFYA 1U8HB 3HZMA 2ENYA 3BDYH 1G7JA 3PGCB 4IRSB 3TZVD 4ORGB 2IH1B 5DD3H 5CWSA 1DL7L 4F33B 4LPXA 1RJCA 2XZAL 2E3VA 2YK1L 3QQ9C 4IMLA 5J3HD 1MEXL 3L7EA 3QJHA 3C60D 4BUGA 3RI5F 3H0TA 2QHRH 1DLHA 1PAMA 2ZKHL 3Q0HA 3RKDC 3HPLA 2Z93A 4V1DA 4QRRD 1Y18A 1JPSL 3RVVC 3ZDXE 1H8SA 1IC1A 3OKDB 2FSEB 4ZO9A 3T09A 3BYYA 3WJLC 3QCTL 4E41B 3QPXL 5C0GB 3N1GC 4Q2ZA 3K1DA 1ZVYA 5HXMA 3HLAA 1ZMYA 4HIJB 3W39A 4Q6YA 1KN4L 5GGTH 1L0XA 5I66A 3IVKA 4YGAB 2NY2D 5D9SB 1HCFX 1NAKH 3NH7L 5FGBA 3PIQB 4X5LA 1UG9A 3FZUC 3BZEB 5E6IA 3OXRB 3CFCH 1BWWA 5DD5L 2E5EA 1CXKA 5ITFA 1GZQA 5E95B 4OZIB 3ARBA 2B1AL 4NO0B 3CVIH 4D8PA 4JG0L 3HAEG 4K7PX 4U31A 2Z35A 5T3XH 4AEIH 4AENA 5I9QC 2DM7A 2IF7A 1JGUL 2WBJB 4KC3B 3REVB 5A16A 5JPMA 3F65A 3P4NA 5E94B 4L1HA 4M6OL 3SDYL 1UENA 2NCMA 3FT2A 4NNPL 4X0KB 5DUPH 3IJSA 3JV4A 5IHZB 4XH2A 1CXHA 1CXFA 1D5MA 4D2NA 4CUCA 3ULUH 3QG7H 3F7YB 2DJSA 1OARL 5LCVL 4IRJB 4G9FD 2XA3A 3T0WA 1ADQH 1LHZA 3T77A 1PG7H 3EYVB 5EZLB 2AJYL 4E41E 5GRUL 1EGJA 1H5BA 4HKZA 4ELKA 4TQEH 4KVNL 1KTKE 1D6VH 1FLRL 2OJEA 4OZ4A 5F9JA 1I85C 3O3EB 3IDUA 3SGEI 3UTSB 2XOTA 3EOAA 4O9HL 2GK0A 4AIZA 1YDPB 3SO3B 1VFUA 1NCBL 1J05A 3SJVB 2JJSA 1G9NC 1P4LA 3SDAA 4JO3H 5IFAH 1CK0H 4UT9L 3VD9A 2X44D 1L9MA 5DRZB 1DVFA 4O2EA 5DJ8A 1CFTB 3RIFK 1DUYA 5T33H 3GM0A 3S36L 4C56D 4P2CG 1R3IL 4KKBC 3IS1X 3QG6A 1AE6H 1F6FB 4B0MM 3IDXL 1Q72H 1JPFB 2CLZB 2AV7B 4IMKC 1YQVH 4NM4H 4TNVF 1OHQA 4AH2B 3BP7A 1IC7L 2H9GA 4OZHA 1JPTL 2J4WL 1GSMA 1QSEA 4H0HB 2FX8H 4UMGA 4K7FA 4PLOB 3UYPA 3QRGL 1EJOL 3F58L 3GSVB 1XF1A 3PWLB 4X6DB 4QRRB 2PKDA 1BF8A 5D2LF 2P44B 3QUMA 4LGSB 4ZS6D 3V6OC 1PQZB 1EVTC 2R4RL 3EYOB 1ORSB 1OD9A 3ZE0F 4U6HB 3VFRA 1NDGB 4POZD 1B2WL 4U6XA 4WDIA 4XCFL 4G9DB 2VISB 3MXWL 1KCUH 3Q5OA 2NY2B 3LD8C 3QO0A 1C16B 4HIEA 3MBED 2Y25A 5HHMD 3SBWC 2J1KA 2V5SA 4MNQA 3UTSE 5IBLD 4KXZH 5FYJE 3EBAA 4RRPA 4F37F 2VSDA 5KJRL 1ZLSL 1HDMA 4P3CL 2MPAL 3PUCA 3SJVE 3BW9B 5LJYH 1I8IB 5LBSL 2CKNA 4J2XA 2Y6SC 4OCWL 3V4VH 3NGBC 4WW2A 1AI1L 3VFNB 4YIQA 3NZ8A 1WZKA 4XP1L 4HWBH 2H32A 3QEUB 3CLEL 1MF2H 3OPZL 3VWJA 2H8PA 2DI8A 1KJ3H 3V0WH 4UDUB 1KUMA 4HD9A 5CJOH 3W5NA 3TVMC 2EDWA 4XX1G 3BZFA 1P1ZA 5T1MB 4NC0B 3AVEA 1IGYB 2I60L 1HINL 3LN4B 1DEDA 4MA3B 4OT1L 5D7IF 3TFKC 2XA8H 3L9RA 1NGPL 3J8F7 1UEMA 3NABH 4UIMB 1VEPA 3OX8A 3HMWL 4FZEH 4J7RA 4QRRE 4X6DE 5GS0H 4EI5A 4IRZL 4UV4H 1N6QH 3U0WH 4G9FB 1Z9LA 4OLEA 2NR6D 4N5EC 4WFED 4WUKH 3UBXG 4DVBB 1AKJD 3WIFA 1FZOB 1YY9D 4LHUD 3D2UA 3DMMA 4U1MA 4NYLA 4NKOB 2IPKB 3IDJA 1DBML 2ZJSH 3I9GL 4WUUA 2R29H 3Q1SL 1EJ6A 4DVRH 3GRWH 6FABL 5ANMA 1YZZA 4GQ9L 1CT8B 1LK3L 3NCBB 3IRZA 2UYLA 5EUOB 4S10A 2LAAA 5E5MB 1SJHB 4ZXBC 1BPVA 3U48A 4HZLB 1YJDH 3GK8L 4PTUB 2X4SB 4HWEH 4LGPB 2Q86A 3V52H 5ENWA 4RX4A 1D7FA 1E27A 2BC4B 2ITDB 1LP9A 1DBKL 4AYFA 4X4YA 1NCTA 4C56B 2Y7QA 1QNZL 4QLRA 1UCTA 4TNWK 5IB3A 1HWGB 1HSAA 5SWZA 4PJ9C 3VXSA 1NCUA 3JUZA 1U92B 2CIKB 4XWGH 3NPZB 2VAJA 3CNKA 5SV3A 3MRHA 4D0CA 1I4FB 2R23A 4XCCL 3L5XH 1KF9B 1HZHH 5HHOA 3U46A 3W11D 1FG2A 3U83A 1B3JA 3QDMA 2VDMH 4ZD3L 3LPFA 1G9MH 1WT5A 4IS6B 2BRQA 1OCWH 4L3EA 4RMTA 5A2JH 1LO3H 1NLDH 4G9FE 3WNOA 3HFML 1RU9H 2VZ3A 1E4XL 4M03A 4NJ9L 4OD3H 4D0DA 5DK0A 4LCWD 1NMAH 1YEIH 3B6SA 1EEYB 3U0TB 5GJTH 4ZDHA 5CMAA 1RVFL 1EMTH 5KZCD 1UB6B 3V4PL 3MBEB 5IF0B 3MA7A 1OF2B 4TVSa 2R2BB 1XIWC 4ZYKB 3SGJA 1EFXA 3VXRE 3WL9A 3UC0L 2NY7H 1HXYA 1F3JA 4L4VA 4TUJB 4HJJH 2XKUA 5EUOE 1Q8MA 2VAAB 4YPGB 4JAMB 5IB5A 9CGTA 4G8FA 2VE6B 4Y4HC 1I8MA 3O6MH 1AGEA 4OZFA 4XVUD 4JFQB 1T5WB 1E28B 2MCPH 3NN8B 3QQNA 4GS7C 4MJ6A 4N0YH 1IAII 1XGYL 4HV8A 1JBJA 5ADOH 2QADC 3I02A 1M7XA 4FQLH 1NEZA 2J5LB 4DW2L 3VG9B 1AJ7H 1YN7A 5GGQL 2A6KB 4OF7A 4R0LA 1A9BB 2F19L 4LHJB 3NFNA 3RI5K 2DQTL 4OZFH 4U1JA 1XGTA 4Z95H 3KPRD 2CDFB 4P23C 4KUCF 1S3KH 5IFHL 3VXTA 1F4XH 4PJCF 4P3DB 4IDLA 4XNYH 1AKJB 2NTFA 3PWNA 2J2ZA 1U0QA 4LHUB 4S2SB 4MD4B 3AAZB 2HFFA 3VGBA 1KEGH 1TZHB 4OF8A 2VKXA 5E99L 3GNMH 4PIRF 5ESAB 2AS5M 4KPHH 1BOGB 1DQTA 3MCLL 1W0VB 2FGWL 1D5XA 4LPCA 3QFDB 5D6DA 1F8TL 4YDIL 2D7NA 2BDNL 2IANB 4FQ2H 3VH8B 1T3FB 4UZGA 1JWUB 1UWGH 2Y07H 4XHJC 1LEIA 2W0LA 1INDH 2UVEA 4NWUH 3MYZA 3NA9L 4HXAH 1KXVC 5F7MC 1EZVX 4X6CB 4BJLA 2VR4A 2YXFA 2AEIT 3ARBC 3DUHA 5DDHA 5H37G 1DUZB 1EPFA 3P0YL 5INCB 2XRAH 2Y36H 1EO8L 4ODHH 4JHBA 4Z7UF 3FN9A 2XZCL 1NUFA 4CVWA 3QRFM 3DWTA 1FDLH 2VDLH 4GG6B 1W0WA 1BQLL 1IQDA 1S8DA 5IB4B 3BJLA 5EO9A 4WFEE 3HNSH 4LCWB 1VDGA 2QSCL 25C8H 4I18A 1UJTA 3FT3A 5I1HL 3MRKA 3SKUD 4KTEL 5KZCB 4J12A 1FNAA 3O3DB 4ZQKA 2Q8AL 4A6YB 3SGKC 4W4OC 5DJZA 2IFGA 3AS1A 3PHQA 4LAQH 1EVUA 2P4AB 3KDMB 3QHZL 4GG8A 2E6QA 4E42B 2VLKA 2NY0D 4X4ME 2CKBB 4NUJA 4Z7OF 1NUGA 2IANE 1CE6A 1S7TA 4X8JA 3L6FB 4YXLL 3KHQA 4OD1H 4LDEB 3TPKA 3UYRL 3VD7A 2I9TB 4G8EA 5IB2A 3UJTH 4XTRC 1F90H 4X6CE 1MHHA 1DL7H 3GBML 4QOKA 4ZAKD 3KAAA 2YK1H 1UVQB 2C4FU 4RMQA 2ICWI 3TEUA 3BO8B 2ZG2A 1ZHBA 4TNVK 4DGVH 2X1WL 4WHTB 3G08A 3TYFA 3W9EA 2ZKHH 3VGFA 3QDJA 3PXJA 1R24A 4JPIB 1WIPA 3U6RA 5KVGL 5IGXH 1M05B 3MRBB 4RBPH 3QXWA 4GG6E 4GRWH 5A40E 2EZ0D 5L88L 2AQ3A 3QCTH 3MO1A 3QPXH 4ONFL 3TP4A 4W6WB 4ZFZA 2H3NA 5MHSE 3PV6B 5LGKA 2V9QA 5TDNA 4HUMB 2DBLH 5F70A 4U1GB 5TPWL 3OF6D 2GUOA 1X7QB 4WI4A 1CDBA 2W65A 3QXDA 5IVXF 3NH7H 2DWDA 4CNIB 1BFOB 1AGDB 4OUOA 1BJ1H 4F9LA 3MJ8B 2L7JA 1K8DA 3W82A 4KAQH 3O9WC 4F37K 2AXJA 5C9KA 5DD5H 3ZDZF 1NLBL 3KG5A 1CXIA 3PWUA 3M8OL 3P0GB 2R15A 1LEGA 2HA1A 4GKSB 2R0LL 5F21B 4JG0H 2YA1A 2HJLA 5CJQL 1WBZB 1IKNC 3IFOA 1A0QH 4H1LB 1JI1A 4X9FA 1JGUH 1WEJL 1Z9SA 3VXUD 1SY6L 1VSCA 3ECBB 1YMME 2GY7B 2WV3A 3CH8A 2MMXA 3HNVL 3B5GA 4Y1AA 3MX0A 3SDYH 3TO4A 1Z5LB 1N8ZA 3VFGL 4HUXB 2FIKB 4M1CD 5DQDH 1X5AA 1P9MA 1U8QA 3EO1B 3A6CL 1EAPB 2I9LA 3LKNA 1WQVT 1DZBA 4TYUA 1OARH 3QIWA 5LCVH 2J6EL 3M45A 1NGXB 2P8LB 3DIFA 5CSGA 2WANA 4BQBA 4UB0L 1L7IH 5GRUH 1C8PA 3MR9A 5DRNB 2MQCA 4KVNH 2K7QA 1FLRH 1FSKB 4JGUA 3WXVL 2NY0B 3DX6B 4JFDE 1WV7T 5ESQB 4HS3A 1NCBH 4UDTA 3FO0L 5KG9A 1DEEA 4HZAA 3BXNA 1RAMA 5TH2A 1HHHB 1TCMA 2F54A 5FF6A 2JCCF 4UT9H 4PGDA 5CLWA 3SEPA 3N9GH 2C4XA 1Q9KA 4TSCL 5HTSA 1FZMB 4YDVA 3BPCB 3CUPB 3KR3L 3GSOB 4ZAKB 4LLMA 4YR6B 3FO1B 3UAJD 1CICC 2B39A 5TE6H 5L0QC 1KACB 3IDXH 5ICZA 1FORL 4P4RA 5E4EC 5IK3A 1IAIM 1TJGL 1IC7H 1X5JA 1JPTH 2J4WH 3BEWB 2OJZH 3GMLA 3FQNB 1AQDA 2P5EA 3V8OA 1D9KB 4DKEL 2IAMC 3G5XA 2R4RH 4BFIB 3TJHD 4JM2F 3MLWL 5E9DD 4L4TA 1P7KB 5J13C 5I8KH 1ZGLA 1B2WH 4CADB 3L3KA 4MJ2A 3MTRA 4HLJA 2CXGA 4PBWD 3MXWH 4O2CB 4HK0B 1UZ6E 4BH8A 1KXQE 5BS0A 4X9BA 1IC4L 1TQCB 2V9RA 3E3QC 5AG9A 3HI1B 2NW2A 3MLXH 2R1WB 4X99B 2HN7B 3MLTA 2R39A 3MRNA 5KN5A 1KCVL 5EU7C 3ABZA 1ZLSH 4P3CH 2MPAH 3V95A 4UTAL 2LTQB 3HE6D 4OLZL 4TTDC 1S7WB 4QRQA 5LGJA 3VWKD 2AJVL 4PJEB 4WVRA 5GS2D 4XP1H 1QEWB 2Q6WA 1BVLB 3CLEH 4NN5B 4LPVA 3OPZH 3SDDC 2GCYA 4R7DA 2RFXB 4K3JL 5KVFL 5C0IB 1U9KA 4PRHD 2I60H 3RPIB 1CCZA 1UB5B 5FA4A 2J8UF 3MGTA 5FK9B 5B8CB 4YX2L 3C2AL 1JZ6A 3HMWH 4OCRH 2YD3A 4IRZH 5KOVC 3L5HA 4NZJA 1ZHKB 4WCYL 3GSRB 2NLJA 5E1HB 3MSPA 1HKLH 3BJ91 3KLHD 3GI9H 5IBTL 2R69L 5DHYA 4NC2B 1DBMH 3I9GH 3UTTD 4POYA 6FABH 2OXHA 2LU3A 1N0LA 3AU1B 4MLSA 4KK6C 5D7KD 3C9NB 4GQ9H 3U9PH 1LK3H 1DQJA 3MRRB 1NCAL 2OTWA 3PWJB 2KKQA 5EBWB 4KKAD 5DHXB 2EDRA 3DO3A 3OAUH 3RTQA 2DQFA 1L9NA 4YC2B 1RI8A 1KLUA 4ZFOB 5HGHA 1I3RA 5T1DL 1QFHA 1DBKH 3L3JB 4M02A 4CVXB 2AAVA 1QNZH 4KDWA 1JL8A 4L8CA 3S34L 5BQ7B 2A9NH 2D31A 5IKCB 4PJEE 4KTDL 1I1YA 3WLWD 4FQPA 3FHAA 4PJBF 5M7QA 2W38A 2R9HC 4B41A 2EDHA 4I13B 5DMGC 2ED7A 5DMYA 2WP3O 4XCCH 5ALBL 1RK1B 5D96B 4QTHA 3K2UL 4LPYA 4FOMA 3RX7A 4ZD3H 2DDQL 3B5TA 4CBPA 2BVQA 4OJFL 2BNRA 5KW9H 5E9DB 2Q7YB 1CL7I 3BN9D 1Z2KA 4LCUA 1E4XH 4U7KA 4NJ9H 5DUML 4Z7VA 4P59L 4LP4A 1A64A 1WTGT 1HILB 3JTTB 4FFWC 2RIKA 1ZVSB 1HHGB 1RVFH 2HRLA 3V4PH 1HK6A 4WY7L 1TNMA 1G7QB 4JREC 3OB8A 1SYSA 3LRHA 3WEXA 3FB7B 2E7LC 5CKAA 1J12A 1MHPL 5I17B 1A1NA 3STLB 3HE6B 3LSOB 3MV01 4P49A 1T7VA 3QH3A 3QHFH 3VWKB 2YD7A 1Q9OB 4KTYA 1LK2A 1U3ZA 1XGYH 4LEXH 4AJ0A 2A74A 1R5WA 3OZ9L 4DW2H 4IIQA 5GGQH 1WWAX 1U2CA 1RJLA 4XZUB 5ISZA 4L9DA 2F19H 2CIIA 4PRHB 1OB1A 2W60B 2H2PC 5EU4A 3PQYD 4M3JA 2AJUL 2GJZB 3BWAA 2DQTH 5KSAD 3TH4T 1NCWL 4H5SB 1MCFA 4GAYA 4P9HL 2P8PA 3LPWA 1YNKL 5C0ND 5IFHH 3ARPA 5ECJE 5A2LH 4R2GC 1PW3A 2PN5A 3HZKB 4MA7L 4PJ8C 2RHEA 4ZUTA 3VFOA 5FYJU 2WUBL 3KVQA 5E9DE 1VENA 1OGAD 5DRWB 3UTTB 4PLNC 5E99H 3F12A 3P4MA 3OJDA 1T04A 3MPCA 3MCLH 3PP4H 4HFUL 1G84A 2FGWH 1T89A 2Y4SA 3CFDA 3P30L 4K2UH 5F9AC 1HHIB 1G7MB 5C07A 4JN2A 4YDIH 2XFXB 3BZDA 4L8DA 3RWHB 2BVYA 4PP1C 1AGCB 3VD3A 5FKAB 4L1DA 5DQJA 3GSXB 5HHXL 3MRGA 4PJGB 4HIXL 3NA9H 2XIDA 4LNRB 1G7IA 4NN6B 2EDKA 3MMEB 1NCDL 1MCCA 1FFPA 1S5HA 3TT1L 2UZIH 4ODWA 2X4TB 4GKZA 1KC5L 2J8UB 4FQXD 5FM4A 5KVDH 1BMGA 3AXLA 4ODVL 3E8UL 3HZVA 4NRZA 4OLUL 2AJ3B 1TLKA 4N9GA 1EO8H 3Q3GB 1CFQB 4XI5D 1DQML 4DCQA 5DD6B 5BZDA 2DICA 2DJUA 4PRHE 5DC0A 5EZIL 1S9XB 3RGHA 1JN6A 2ERJC 1GGYA 4CAGA 5I71B 2D4FA 1AR1C 1BQLH 5F89A 2HVKB 1U8OB 1NCNA 4ZUVB 3L7FB 4NQXA 1EXUA 2QSCH 2X4QB 3DX8A 2EIEA 1J87A 3RZCD 1XGRB 3IFLL 2CRZA 2G5BB 2FECL 4KTEH 2P7TA 3UTTE 1J0IA 3TIDA 3N06B 2Q8AH 3SE3C 3HUJF 4HKBA 4HLZG 4LIQL 1LQSR 4X7TB 2BY1A 4R7NB 3H3KA 4FXKA 1WIUA 1HYRC 4MWFB 1I7TB 3LCYA 4BZ2H 1E6OL 1ZXQA 1U93B 4KI5D 4YXLH 1QTYT 4XAKD 4QWWC 5T1KA 4PJGE 4OIIL 4H20L 4J3UA 2VZOA 1AHWA 1I1RA 1X5HA 3GBMH 4JO4L 2IBZX 1FZKA 2FX7L 1H0DA 3A6OA 3DUSB 2V2TB 3PQYB 5DJAA 3VI4F 4WV1A 3OKLA 5KSAB 4YHIA 3GBNH 4YBLC 3O6KL 2Q76B 1Q94A 3IDMB 2NY4C 3EZJB 5CILL 4JRYD 2WNGA 2A83B 2BSTB 3T08A 4ZMAT 1T6WA 2BSSA 3G5ZB 4NO3A 4PJ7B 4QRTB 5L88H 43CAA 1WBYB 1OGAB 3R1GL 4OFKA 3SE4A 1SJXA 4N1HB 2GFBB 2GAZA 4K3DL 4X7DC 5EO1B 5F7UA 5D1XD 3T2NL 2PO6D 2H6PB 5TPWH 5AUMA 4PRPD 4OCNC 4NQVA 5LKNA 5F9WB 3M07A 1TPXB 2VWEE 1YEJH 1T0MB 4Y4KA 1U8JB 1U3HA 1ITBB 2GTZB 2X4UA 5T5NF 3DTXB 1BBDL 32C2A 4ZOAA 3GSWA 5F1KC 3P9WB 4J1UA 1QFWL 2VUYA 4OIAA 3SDCA 4U1LA 4YHKL 1OP3K 4NN7C 3M8OH 2HFEB 1KYOJ 3ULVD 4PRID 4BA8A 4NFCA 2R0LH 4FQXB 1W72B 5CJQH 1MI5A 3E0GA 1FYTA 2J6EA 3V5HB 2EO1A 4HX1A 5JMOC 1WEJH 4U3CA 1SY6H 1U8KB 3CLFH 1MJ8L 1ES0A 1T1ZB 5FM8A 4AIOA 2VSCA 1JYVA 3K2MC 3VFGH 3T0XA 5F97E 4APQD 3MUJA 2DYPD 4IBLT 4JFZH 2CLVA 4U4BA 3WNMA 3A6CH 1A5FL 2PF6A 1U8MA 5DJ2A 3CH1B 4JZJA 2J6EH 2PTUA 1AC0A 4MAYA 3KJ4C 4XNZB 3RZCB 4PJ7E 1ZAGA 3LV3A 3NZHL 1OGAE 3O4OC 3QIUA 4CL7A 5IBUB 2FO4B 5FGCB 5J12B 3EOYG 1A7QL 3TH3T 2R56L 4L9LC 3ZTJH 1C5CH 4OLVL 4K3EH 1NBZB 3WXVH 1ZOXA 4P2QA 4LLDA 1XF4B 3DO7A 2FCBA 1FPTL 1MRCH 5INDA 4G7VL 5D5MF 5I19L 3FO0H 1MCSA 1PVHA 1MFAL 1P53A 3OWEA 3N1MC 1IGFL 4OGXH 1NC4A 2IALB 1A8JH 1FNEA 1PG7X 2AKRA 2ZZUT 3OMZA 4TSCH 4WI2A 2Y23A 3KR3H 5FOBB 1CFVH 1T21A 5E2VL 1NAMB 3QQ9D 1FVEA 4Q9RL 3TJEL 5C0BA 1RZIB 2VERN 1FORH 3OHXB 4NZUL 3QDGA 4HF5H 1BHGA 5IFJB 3TN0A 5GGVY 2FWOB 3O2DL 1VPOL 2W9DL 3RKDD 4X7EC 2IG2L 5I1AA 4JRYB 1HOCB 1MLBB 3FO2A 2PUQT 1MPAL 2BVPB 3JTSA 3FFDB 4BFBD 2GHWB 5I15H 2IMMA 5HY9B 5ADPH 3BPLB 1F6AA 3ILQC 2O5YL 4K23L 1P7QA 4UIKH 4UT7H 5C0EA 3MLWH 2YSSA 1L0QA 3QIBA 4XNQA 1HHJB 2PO6B 5D1XB 3FO9A 2E8YA 1SYVA 1CFSB 3G6JB 1CDIA 1A3LL 2Z91B 4LQ1A 1KPRA 5EIVA 5IMMA 5FGCE 3RUGF 5F6HI 2XQBL 5FDWB 4KJYA 1GC1L 1A4JA 35C8H 4P2OA 3P9MB 1FV1A 1XR8A 4JLRA 3IDNB 2CRMA 3FZUD 3T1FB 2GT9A 4UQ3B 1KCVH 4U3XA 2FLRT 4KI5E 4ODUB 4URTB 5GSVB 3MREA 4XAKE 4YWGL 4PRIB 5ICXA 4OLZH 4Z7WA 2ATKB 4LSVH 3RL2B 2IQAA 3LDBB 1J0KA 4QHKI 5ESVB 5E2UH 5ID1A 1NL0L 4CMMB 4QNPE 4R97B 3I50L 1L6ZA 2ADGB 2QBWA 4IIQC 4LSSH 4K3JH 3PGCA 4IRSA 4ORGA 2IH1A 3DI3B 3WE6B 3PJSA 5KVFH 4WI3A 1BLNA 4X9IA 2LVEA 1QFUL 2BRRH 2DYPB 1ZA6B 2V7NB 1I9JH 2Z4QB 4PJXB 2HWZL 2CKBL 4YX2H 3C2AH 1EV2E 5JW4R 1NBQA 3RDTD 1MELA 2I24N 3MOAL 2E6JA 1S7RB 1CD1B 3FAWA 4XGZA 3CSBA 2BHZA 3EDDA 3VD4A 2R69H 4G42B 4AL8L 3OKDA 2FSEA 5GJSL 1MCOH 5DC9B 3WFHB 1S9WB 2OCFD 3B9VA 4E41A 5C0GA 5E7FA 4HIJA 1IGIL 1ZE3C 4PTTB 1JRHI 1BBJB 1CZ8L 3K8MA 3WDHA 5D9SA 1CLYH 5HYJA 4OFDA 3PIQA 5T1DH 3SKOA 2N1KA 3VGEA 3BDXA 2WSKA 3BZEA 3ULVE 4PRIE 2AABL 3RBSA 3S34H 4IJ3C 4P57B 3CJJA 4ZO8A 1CLOL 3QXAB 3O4LD 4KTDH 4OZIA 1IQWL 5HPMB 4NO0A 5L2KE 2D7TL 4J4PA 3QA3B 5ALBH 2WBJA 3REVA 5I75C 5HHVL 5J9PB 4PJXE 3V0VA 4JVWA 5DTFB 4X0KA 2VNCA 4OJFH 5MI0C 4W81A 1BFSA 2W1NA 1RZJC 5CZXC 4CU6A 1U8IB 3ZKQD 5DUMH 4Z78B 4HIIB 4P59H 3BGAA 3F7YA 5I73C 5DZOA 1ZV5A 4IRJA 3QHTC 3S5LB 3I3DA 3OJVC 2DQIL 2NY5H 3BKYH 3EYVA 4WY7H 3OAZK 5EZLA 5HI4C 3D1MC 5TF0A 1OSPL 1KV3A 3SCMB 1MHPH 5D6CA 5H8DA 3O3EA 3UTSA 4NRYB 4NZDA 4OKVA 2Y6SD 1MCKA 4HUUA 2WUCL 4NC1C 4GLRH 3S35X 3BP5B 1JYWA 4FN0A 5I9QB 1NFIB 3SJVA 4A2LA 5EOCL 4HBCH 4G80B 4G8GE 4KROC 1TVDA 3OZ9H 5DRZA 4HG4K 3TZVA 4OZFG 2VH5L 2OLDA 3GHEL 1FFRA 3DETC 5F7KC 2AJUH 3EOTH 1WBXB 4DUVA 5A3IC 1BZ9B 5LAXB 4JDZB 1JPFA 1FE8L 2QLVB 3TCLB 2AV7A 2ESVD 3RDTB 3C60A 4P9HH 4AH2A 4HFWB 3BEVB 3QULB 4L8BB 4N5ED 2BOCB 4MA7H 4J3WA 1CGTA 3GSVA 4X7SL 4X6DA 4QRRA 1MIML 1NBYA 3D69B 1QA9B 1TNNA 1QVOB 3WUWG 1PQZA 3VFVB 3BOVA 5C08A 3R06B 2APBA 4R4BB 2XTJD 4HPYH 3P30H 4U6HA 2Z92B 3OQ3B 1NDGA 2EIBA 4ZXBD 5CP3A 4G9DA 5EULV 4LGRB 2VISA 3A6BL 5C0DB 3OKKB 15C8L 4Y5VB 1U58A 1RK0A 4HIXH 4GMTH 4XMPL 1KPUA 1G1YA 4QHMB 3RNKB 5FV2A 3MOBH 3BISA 1NCDH 4KV5E 5IHBA 1J10A 3O4LB 3TT1H 3BW9A 1I8IA 4PJ9D 3E8UH 1M71B 4KDTC 1T1XB 3VFNA 3TO2B 4EJ1C 2BMKB 5GZOC 1SBBA 5EZIH 1YN6B 4UDUA 4Z18A 1SVCP 2AEWA 4I0PC 2MQ3A 3MUHL 5T1MA 4NQTA 5EU6D 2FIRT 3LN4A 3NCFB 4MA3A 2DMCA 4HK3J 3VW3L 3D87B 4OLXL 4Q9QL 4M6AA 5IR1B 4UIMA 3EJYC 2G2RA 1AGFB 5GRZA 5LG1A 4F57L 1VACB 1DLFL 5JLZA 3ARRA 4DVBA 2JB5L 5C70A 4JJ5B 4U0RC 1XIWD 1FZOA 3WSQL 1T2XA 2IPKA 1M1SA 5DHVH 1WLHA 3C87A 2XKNB 4K8RL 3O3BB 3IETA 3D25B 2EDQA 1WWCA 4Y4HD 1CT8A 4N0CC 2QQKL 3NGBB 5FYKD 3DYOA 1SJHA 4N0RA 2OK0L 4HZLA 4OIIH 4PTUA 2X4SA 4YXHL 4OTXH 2ICWJ 1EH9A 3T0EC 3FONB 1T66D 2JJVA 1I9RH 2BC4A 2BHYA 2ITDA 3O4LE 4C56A 3OJ2C 2YD2A 4GW1B 4LCIL 4NNYB 3AM8C 2KQNA 1II4E 3MRCA 3O6KH 1XCQB 2JJTC 1KJ2L 4P23D 2AJZA 2P45B 5CILH 2ZWLT 4C4KO 1I4FA 4P48A 5FOJA 4EN3B 4I3GA 2APWA 1YY8A 3MRJB 2G75B 3JWDC 3N50A 4K3DH 4U1SB 4RA0C 2CH8A 4PJIF 3AB0B 5HGBB 4IS6A 2XTJB 5C6TL 1ZKAA 4EUPH 2N7BA 3V6FB 4N0UE 4ZXBB 3MCKB 3KYKL 3DURB 2EDDA 1EEYA 3S3SA 1JZ8A 3U0TA 1CTNA 1VGEL 2EYSA 2W07A 5LQBH 3KPLB 3MBEA 5IF0A 1OF2A 1TZGL 4P5KB 2NY1C 5F88B 4ZYKA 1EEZB 1BBDH 4L8SC 3ULUC 1QFWH 4TUJA 5BVPL 4YHKH 2VAAA 5CEZL 4YPGA 4MNGB 5F1NB 4JAMA 4HXBL 3WBDA 2VRAA 2VE6A 4PJ9B 1EO5A 2R4SL 2QKIA 4YK4B 5J1AA 3ZE0E 4JFQA 1T5WA 1E28A 1RURL 1WZLA 3U4BH 2BXYA 2HT4C 4EKXA 1A3QA 1A9BA 5EU6B 4RFOH 3PHOB 1H3XA 4GAJL 1A5FH 1HE7A 5CD5C 4NO2A 5HPOA 5IEHB 1C08B 2H26B 3UYOD 1H3GA 1MCIA 2CDFA 1MCPL 1WZ1L 3NZHH 3BMVA 3BKCL 2H2SD 4X9GA 4P3DA 5AYQA 1AKJA 1A7QH 1XIWB 4YHNB 1I8LA 2R56H 4S2SA 4MD4A 3AAZA 4OAWB 4UBDD 2XTJE 3GM8A 4JRXA 1I1AC 2JELL 4OLVH 1TZHA 1N64L 4RFNC 3QUYC 3T3PF 4R4NC 5DFVC 1XH3B 1LO5B 3U4EB 4G7VH 5FAAA 3QFDA 4C59B 1MFAH 4MQXC 3CSYB 4GS7B 3PP3H 3O2DA 1MCLA 2J8HA 2QQLL 1F45A 4ZFFB 4Y2DC 4XTRD 3VH8A 1T3FA 1JWUA 2EECA 3WNPA 1A7NH 1KIQB 4MNGE 3GSNL 3BT2L 4Q7DA 3LQAL 5E2VH 1R3HB 4YHZL 4Q9RH 3AFLA 3TJEH 5HYSA 5C3LD 3MYJB 1IM9D 3CIQA 3BD3A 4WW2F 3RY5A 1E4KA 4WFHD 4PG9B 1FC2D 4P23B 5D7IA 5INCA 1VPOH 3VJ6B 2IG2H 4K07A 1T83C 3X12A 1SMOA 2ENSA 2WBJC 1MPAH 1OL0A 2EEDA 3FCTB 4ALAL 5EU6E 2V5RA 4XPGL 3BKML 4J6RL 5FDYA 3ZKSD 1J9CT 3T2QA 1B0GB 2O5YH 4K23H 3HHRB 4GG6A 3S36X 1WFTA 3D85D 1FIEA 3C6LD 5TGBB 2P42B 5IB4A 1A3LH 5EA0L 4F7TB 3X3GH 4UILL 4OGYL 3L3GB 1SJVA 4LCWA 4BZ1H 2QHLA 3KPNA 1KLGB 1UT9A 1GC1H 5E08H 3FQXA 1QSFE 3O3DA 2WIMA 4PS4H 4A6YA 3O9WD 3LS4L 2AEPH 4PRNB 3TA3C 5GS0C 3KDMA 4LSDA 2G9HB 4DN3L 1QRND 2KPNA 3FRUB 3HG1E 5E00B 4YWGH 4E42A 4UAOB 2O5XL 5BRZD 3VCLB 5AYUL 3GUTB 4BFEA 2CKBA 1A1OB 3N85L 4R9HA 3L6FA 3TCXA 2FEDC 3TBYA 4XPBL 2ZOLB 3MGOA 4ZODA 5J56B 3P2TA 1LP9F 5FEBA 1NL0H 3SGDI 1A4KB 1WGOA 3I50H 1B90A 2I9TA 2F8OA 4Y16C 3BP4A 5F7EL 1HXMA 5TF1H 1M6OB 2DTSA 4U2ZA 4ONOA 2CR6A 1QFUH 4D9QD 5IVOA 4JCLA 4FQJL 1UVQA 2WP3T 3BO8A 1AD0A 2HWZH 1J0JA 4LRIC 4Z7NE 4GXVL 3KPRA 2DLGA 4JPIA 1M05A 3MRBA 3BH8B 5DWUL 1HKFA 1NKOA 4P4KA 1TENA 2PYEE 5GJSH 1MCNA 4HWNA 3T04D 3RVTC 3CFEB 5CINL 1H3TA 1A21A 1EA9C 3LN5B 3PV6A 1UJ3C 4ZS7L 2ZUWA 3KXFD 2WM0A 5LVEA 5BO1L 4K9EH 1IGIH 1TJIL 2BJML 2R0KL 1UH4A 1X7QA 1CZ8H 5C09D 5GGVL 5CJXA 3LKSB 1PX3A 3HC4H 1BFOA 1AGDA 1EEQA 4RQQA 5CIPH 2H1PL 4O02L 1KCLA 4H26B 3VGDA 5ICYB 2D7QA 1X5YA 1CICD 2AABH 4QHLB 1GRWA 1IM9B 3Q6FB 1CLOH 5KSUA 4O5LL 4GKSA 5KS9B 3ARQA 5HVGB 1WBZA 3C8KB 4H1LA 4UI2A 1HH6A 4ZPTA 1DDHB 3T0VA 3ECBA 5HHVH 2EC9T 4PJCA 2IAMD 2P24B 5JHDD 1Z5LA 5DD0L 4QYOB 4HUXA 4NNXB 3D85B 2FIKA 4XBEL 5JZ7D 2M26A 3WD5H 3C6LB 3O0RL 4LLVB 3FB6B 4KY1H 4F7CB 3EO1A 1SM3L 2F53D 1EAPA 4BH7B 3HAEB 3O11B 5TDOB 2FX9L 1NGXA 2P8LA 1FGVL 1R0AL 2YD8A 2EDXA 3ES6A 2HT2C 4RZCA 5I74C 5EDXA 2V9TA 1JI2A 1QRNB 2VXTH 1EAJA 3UTPE 1NH6A 1IBGH 4UOW0 5BRZB 5IIEA 1JYXA 3DX6A 3QDHA 2ICCA 2WUCH 1EBAA 4JPVL 5ESQA 4YXKL 1NGQH 2XKSA 5HDBF 2HLAB 1A6WL 1FL6B 4YPJA 1HHHA 3DX9B 2MHAA 3SDDD 5SWSE 1U91B 3WIHL 1FZMA 4N8VG 4Z7UA 3BPCA 3CUPA 1I9EA 1OQXA 3GSOA 4ZAKA 4WFHE 1NMCC 3GHEH 3FO1A 1YNLH 3EJZC 1HNGA 4U6VL 2IPTL 4M4PA 4TOYH 1BX2A 4HEPG 4JFOB 3GDBA 5FKPB 3L3DB 3FQNA 1MIMH 1KB5H 2NQCA 2D03H 1IEAB 1FO0B 4PJHF 4LEOB 4QCIB 5DT1L 1I7ZB 3C5ZC 1P84J 2A6IB 4WHCA 5CEYB 4LOUD 4ZS6C 1RUML 1IZKA 4KK6D 2JE8A 3IB4A 1XF2A 1P7KA 2BHUA 3KPQA 3KXFB 4KK8C 1JPGB 3OF6A 4K7PH 3M17B 5JTWA 4JKLA 5C09B 3A6BH 4O2CA 3P40A 1A6UL 1BD2D 3TYGL 1WICA 2A1WH 3MBEC 1LNUB 4HUKB 5B3JE 5HYIA 4E0RB 4XMPH 3HI1A 2R1WA 3U4AA 2HN7A 5EIIA 3GI8L 1C5DB 1JWMB 4G7YH 3VFWA 5L0QB 1MJUL 3PDDA 4DK3A 2R9HD 1S7WA 4NWTH 4HWUA 5DMGD 1QEWA 5E4IA 1BVLA 3VXUA 4CU7A 4QRUB 4BQ6A 2PNDA 2RFXA 1JIBA 2RCSL 5JHDB 4XP9L 5C0IA 5DEZA 1GPOL 3IT8D 1UB5A 4OGZA 1R3KB 4Q9QH 3LOWA 5FK9A 5B8CA 2C9AA 4ODBD 2F53B 1OTUC 4QY8B 4FFWD 5KVEH 4F57H 1P2CA 4AIXA 4MDJA 2NR6C 3RVWC 5IB1A 4GFTB 3I3BA 1ZHKA 3QP3A 5EWIL 1T7XA 1KT2B 3GSRA 2JB5H 1K8IB 4CRPA 4OUUB 4DWHA 3KXFE 3NIFF 2E7HA 4PJFF 4K8RH 3AU1A 5C0CA 2VDRL 3C9NA 3G5VB 3MBXL 2QQKH 1U8NB 2KL6A 5AG8A 1NMBL 3MRRA 5EBWA 4QXTB 1KJ2A 1LILA 3QI9D 2OK0H 2FH8A 1BIHA 1JF6A 1JHLL 3UBXB 4YXHH 1RHFA 5HDQH 3SDDB 3CVHB 3G6AB 4EVNB 4ZFOA 4PGCA 4MVBC 3LQZB 4ISVB 5H94B 2VYRE 2H2PD 4LCIH 3ZKXC 4WWKC 4WI6A 2Y06H 3WO4C 1HH9B 5IKCA 3VGGA 1QFPA 1C5BH 2RB8A 1KJ2H 5IWLC 3EDKA 4YHPA 4WFFD 1XR9B 4R2GD 4R3SB 1VERA 1XF5B 2BSED 4MHHG 4PJ8D 1A6TB 2EXYC 1S5IL 3QT2A 3FRPG 1AR2A 1RK1A 3W11C 1DBBL 2X9YA 5D2NE 2JCCE 2F53E 4R26L 3E2HC 4M6NL 4X8XA 3DXAD 5E9DA 1UZ8B 3OKMA 2Q7YA 3WNKA 1OTSD 4U3HA 3VXMD 2PR4L 1KBGH 3KYKH 5ELIA 1HILA 5MEOA 4XX1E 3RJQB 1BD2B 1VGEH 1ZVSA 1HHGA 5EU7E 5ITBL 1NC2D 1G7QA 1TZGH 3O81A 1BEYL 4LARH 4PD4J 5BVPH 3FB7A 3SGEH 5CEZH 1BGXL 5I17A 1XAUA 2XZZA 5C2UB 4HXBH 3G04B 2NZIA 5J1TC 4JFHD 2VLJE 1JHKH 3HE6A 3LSOA 2I26N 4X80L 4NBYB 4YDKL 3VWKA 1VFAB 1Q9OA 3ILPA 1RURH 1PZ5B 3GMQB 2BZDA 3SQOL 3A0OA 1MVFA 1Q9LB 2FB4H 2OXGA 1AR1D 2P8MB 3IU3B 4XZUA 3EDJA 3C5JB 4PRHA 4X5XA 2UWEB 4GAJH 2GJZA 1X3DA 3RGVD 1DE4B 2APTA 5ID0A 3VI3E 3EUUA 2FD6L 4UTBH 3ZTJG 3MUGA 1WZ1H 1UWXK 1JF1B 2XN9D 4WU7A 3ELAT 3DYPA 1JGLH 3HZKA 2HTKC 4JREB 5F7DB 1A7RH 2YUVA 1YNTA 1AO7D 3GSNA 2JELH 4I3SL 4M1GL 3UTTA 2DMKA 1BJMA 3NVQA 4U1GC 3TWCL 3ZSSA 5I8EA 1HHIA 1G7MA 1K3ZA 3IDYC 4JFEB 3QI9B 1X5GA 3TNNB 2DLFH 2XFXA 3OTTA 3RWHA 5CD3A 1L0YA 4H25A 4WFGE 3H9HA 3GSNH 3GSXA 3LQAH 4PJGA 1FN4B 4LNRA 3S8WA 5GIRB 2E9JA 4FQ1L 3LMJH 4HSQA 3D9AH 3MMEA 4LKXB 5E8DL 1CGVA 2X4TA 5EN2B 1OP3H 2J8UA 3D39D 2FHBA 1G9NL 2VZ1A 2NY4D 4LLYB 4LPUA 2OX5A 3NPSC 3Q3GA 1CFQA 1T0PB 4K55A 4PJ8B 1MRDL 5DD6A 5M94B 4ALAH 4JPKL 3PXHA 1GJIA 3N1PC 1N7ML 3BKMH 2XACC 5I0ZA 1S9XA 4RWYH 4TVPL 2AI0L 3CCHB 4U1IB 2YA2A 4XB8A 2UV3A 3K8KA 3RVUD 5MEPB 3U82B 2HVKA 1U8OA 3DXAB 1WJ3A 2F58L 5EC2B 4ZUVA 5EA0H 3L7FA 3VXMB 4O4YL 4OGYH 5IJKA 3HI5H 4OSUL 2I07B 2X4QA 2DQDL 1XGRA 1A6AB 3BD5A 3WFCL 1EHAA 1MCQA 4PJBE 2YPVL 1NC2B 5EH1A 5E6YA 4RDQG 5T3ZD 1NKRA 1UQSB 4QHKJ 4DN3H 1FSKC 1FC1A 4R7NA 2DIAA 4JFEE 4MWFA 2OR9L 2O5XH 4NBZB 5A2KH 5CSZB 1EO7A 1I7TA 4JB9L 1HI6A 1TFHA 1XZ0A 1U93A 5KSBB 2VDKL 4YZFF 4XPBH 4UNUA 1WUNT 4W68A 5BV7B 5CGMA 5ABDE 3T0BA 3JWOL 3LEVL 2X4OB 2OSLB 4WIQA 5CZKA 4A2MA 3IF1A 4OCYH 2ZUXA 1Y6KR 2ERJB 5F7EH 4JPWH 4I77L 1CYGA 3QEGL 1MCBA 4MS8C 2O5ZL 4FQJH 1MQKH 4NSKB 2V2TA 3PQYA 4WFFE 3RGVB 4S11A 1DQDL 5CEXB 5KSAA 2F74B 4TUOA 2Q76A 3CMGA 2DTML 1H8NA 3IDMA 4KHXL 1OW0A 2XN9B 5EUKB 2GSGB 5E8OB 5DWUH 1XGQB 2A83A 4LHQB 3WMSA 3G5ZA 1AO7B 1D9KC 2EZ0C 3DXAE 4LBEB 1QKZL 4PJ7A 4QRTA 1WBYA 3RZWA 5CINH 3VXME 1N5AB 1TQBC 2GFBA 4AT6B 4Z7VF 1CL7L 4B7LA 5EO1A 5C0AE 2H6PA 3BKJL 2BJMH 2R0KH 3WKML 1UC6A 4CVZA 4ONGH 5MEQB 1EZVY 1Q0XL 4P99A 4BSJA 1PKOA 2X2YA 4LMQI 2B0SL 1T0MA 2EDLA 1KCRL 3QPQC 3LN9A 3IKKA 2Z8WC 2H1PH 2GTZA 4YUEL 4O02H 1FJ1B 3DTXA 5D7LD 3IDGB 5CUSL 4OD2B 5KSBE 5CJ8A 2AJXL 4MQSB 2HFEA 2LTQC 1ZHNB 3MRLB 5DC4B 2E7MA 1GGCH 4FQXA 4MA8H 1W72A 3D39B 4Z8FL 1IAIH 2OQJB 3V7AE 4XRCA 3V5HA 1K6QL 2X41A 4NN5C 3ARFD 1U8KA 2HFGL 3K46A 1MWAB 1T1ZA 3H3BC 1ZA3B 3ILQD 1WISA 1CDGA 5FYLD 2YBRB 1FFOB 2CDGB 4XBEH 4XPHH 3O0RH 3BGMB 3QXUA 2XN9E 2V5MA 1XMWA 1I1FB 1F2XK 2ADFH 4LU5L 3CH1A 4JFFD 2FX9H 1QR4A 4U7SA 3RZCA 1KGCD 4LLWB 1FGVH 1R0AH 4TRPL 5HYEA 3NMEA 2FO4A 3WIHA 4S1SL 4FG6C 5C92A 1G6RL 5F9OL 1MAMH 4HHAB 4NKMB 3MV9D 4F80A 1OSZA 4JHAH 4NN7B 4AMKL 1NPUA 2M1KA 1XF4A 5K9QI 1ZLUK 4DKDC 1MVUB 5DZLA 4EDWL 1INEL 1VB9A 1G7LA 2IALA 3R4DA 1VFMA 3H3PL 4P5TC 2AXFB 3PWVB 1MFCL 5FOBA 1LE5B 4UT6L 4WGWB 1A47A 4U6VH 4Q0XH 2XYCA 1RZIA 4I2XB 1B88A 4P46B 5JIIA 5IHUL 3HKFA 5KTEL 2FLBT 3OHXA 5FYKL 1GGUA 5IFJA 3DV6B 3CFJB 3G9VA 4HC1L 5JW3L 4JRYA 1HOCA 1MLBA 2FECI 2BVPA 1CDYA 5D96C 3FFDA 5DT1H 3KLDA 4L9LB 3KS0H 1HEZB 4D9LL 1RUMH 3X3FL 3PDGA 3C09C 4RNRA 5D1XA 5CBAA 1HHJA 2PO6A 3R8BB 4KJQC 5EZOL 3KPMB 4N90D 4PRPA 3G6JA 4CJ1A 2Z91A 1MHEB 4JDVA 3OG4B 1OAXL 4KKNA 3VI4E 5FDWA 3TYGH 1DBAL 1QLRB 3O6FC 5T3ZE 3LEYH 2R1XB 3P9MA 4NDMB 3IDNA 4LAJH 3T1FA 2GY5A 3TNMB 3WS6C 3DLQR 4ELMF 4EOWL 1UM5H 5D7LB 2EDOA 3GI8H 3OAZH 2GITA 3OV6A 1JHTB 4QGTA 2V2WB 1MJUH 5GSVA 4LDOB 4LSPL 3MACH 2VZTA 4PFEA 3SY0B 2FJGB 4PRIA 1JZ7A 2ATKA 2YWYA 5FHAH 3RL2A 3NOIA 5DK2A 3WUZA 5ESVA 2BVEA 4MCYB 2VDNL 3ARFB 2EYRA 4CMMA 1U36A 4DFHA 3FQUB 5JXEC 1N5YL 1FAIH 1M4KA 4I2XE 3WE6A 2DLEA 4XP9H 1GPOH 3WCYA 4APQA 1KIRA 5CZXD 2DYPA 4C4KT 3D0VA 1ZA6A 3B43A 2V7NA 4PJXA 5BCAA 3TF7C 4Y19E 4YDLC 2D7MA 1D5ZA 4QEGA 5GS1A 1BJ1J 2C3GA 3LIZL 4JFFB 3GMNB 1X6LA 1GAFH 1U3YA 1QSZA 5EWIH 1D5IL 1S7RA 1BZQK 5HI4D 3VDBA 1HQRB 4DZBB 1IEBB 2PTTA 3KPOB 2L0DA 3A67L 3WFHA 4HGWB 3MV9B 1QPPA 1PGRB 3BQUC 4CN4A 3LRSB 2DKSA 2FR4A 3LEXB 3NCEB 1F42A 4PTTA 2Q1EA 1BBJA 1JHLH 2DL9A 3UTZB 3MODL 3QQ3B 3GSUA 3GMOB 4KROD 3C6SB 4MSWB 4JM4H 1DJSA 5IQ9B 3C5SB 4MYWB 4PY7B 1ZSDB 3DETD 3MRIB 4NIKB 3H7BA 3T4YB 4LSQL 4M6ML 5A3ID 2X70B 4Z0BH 1ZANL 3SDXB 1JV5A 5HPMA 1ACZA 4M43L 3LKQB 2FYYB 5MEND 4F2MB 4GBXC 4EQ3A 1S5IH 3QA3A 2IQ9H 3WJJC 4JG1L 1M7IB 3CPLB 2YPLE 4MJ5A 2GIYA 3DI2B 5J9PA 4EUPG 1UCBH 2V17L 1DBBH 4H0IA 3WJLA 5I71C 5DTFA 4R26H 3GHBL 4JFFE 1ZLWH 4C57C 4HDIB 4MCZB 2PR4H 1KGCE 4Z78A 2X4RB 2BVOB 4DK6A 2M2DA 3HCVA 3VE0B 5FA3B 5DR5L 4PRAB 3S5LA 2HJKA 3MV9E 2VWEC 1NFDF 4FFZH 4NQSB 3QUML 4OCSL 2OBGA 1Q0YL 5DEGA 4IJ3B 1H9VA 1BGXH 4JQXC 4PY8I 3U0PB 2J12B 5JW5A 4NRYA 4X80H 1PDKA 2F15A 3BP5A 1E6JL 4OLYH 4L29B 1SQ2N 4NT6B 3PDOB 3AREC 1LEKB 2VDOL 3TT3L 5I75B 1P69B 1UA6L 5EC1B 4FXGB 2Z8RA 4EBQL 5ERWB 4I0PD 4PJDE 1MNUH 5MI0B 4JO1L 3SDXE 1IC5L 3U9UB 4NFBA 1WBXA 4QXGL 1N3NB 5LAXA 2IH3A 3EJYD 3TCLA 4HKJB 1WFNA 1ZT4A 3QISA 5I73B 5C0NC 2GEEA 3BEVA 3N1FC 3QULA 4L8BA 2BOCA 2GJ6E 1XGUB 3RWGB 4LPWA 3D69A 5I1DA 4M1GH 4S1DD 2KQMA 2R2CA 1NCCH 3VFVA 1MUJB 4P2YA 4M3KB 1I85A 5CAYB 4KZDL 5F1OB 1GCFA 4R4BA 4I4WB 3TWCH 2Z92A 3P11L 3VXNA 1C12B 2IGFL 5TFSL 4WNQB 1A9EB 2AGJL 5DXWA 5C0DA 3T0ED 3IFNH 2QV2A 3W81A 5C71A 4Z5RB 1FO0L 1EHXA 1H3UA 3RNKA 4QO1A 4MD5B 1A3RL 4YO0A 5E8DH 3O4LA 4KFZC 4IMKA 4XC1H 1OAZL 3QUKB 2QR0B 1G9NH 5HYSG 2BXZA 1ZT7B 1T1XA 3TO2A 3DYMA 5MENB 1MRDH 1DTUA 1IE5A 2BMKA 1YN6A 3VDAA 3ZT7A 4HMEA 4TVPH 3MLVL 3V6OA 2AI0H 4Z7QE 5DVMA 5EG6C 3U36B 5T3XD 1QQDB 2D3VA 4ZSOB 3ROLB 1DQQB 1CE1L 1K2DB 2F58H 1JZ2A 2WBWB 3QCUH 3MNWB 4O4YH 1E4JA 2HJFB 3HRZB 4OSUH 2IWGA 5J6HB 5IR1A 1AGFA 2DQDH 4YHOL 5HI3C 2YS4A 1VACA 2BCKB 3L5IA 2EC9U 2Z9TA 2YPVH 3P9LB 1TETL 3DSFL 2OL3B 4JJ5A 3SBWA 3O3UN 4M7LL 2NY1D 3ULUD 1AC6A 1T1YA 4PGZA 3GJFH 1I3GL 1H3VA 1MHCB 2LQRA 2OR9H 2P43B 2XKNA 3O3BA 3D25A 3X13B 4WJ5A 1JRHL 3GJEB 5IEKB 1ZTXL 5I1JL 5TDPB 3JWOH 5TE4L 2R2HB 2PW1B 5EBMB 5IHLB 3S3PA 3NFPB 4Y89A 1OAKH 1CS6A 4I77H 3QEGH 4I0PB 2SEBA 2O5ZH 3W0WE 1A02N 4OZIF 2N4IA 3FOMB 4GW1A 4NNYA 4KRMB 1DQDH 5CD5D 1A6VL 2FJHB 5MENE 5DD1H 2DTMH 2ESVA 2V7HB 4LKCA 4KHXH 2X4NA 4PV8B 4ETQB 4Q97A 3FOLA 4G6FD 3CVHL 4XVSL 3QFJA 4U0RB 1RUPH 2P1YA 3PNWB 1FNGA 5AZEL 3MLYL 1I1AD 2J8OA 1NFDB 3MRJA 2B20A 1ZGLP 2G75A 1CL7H 4U1SA 3QUYD 2OMNA 4FXLA 5DFVD 3HZMB 3NAAL 5HGBA 4M93B 3BKJH 1T22A 4JANB 4KRLB 4LASH 5ACMA 3PL6C 3NACL 4POUB 4IHOB 3V6FA 4ZXBA 4DGIL 3MCKA 4MQXD 3DURA 5M95B 1Q0XH 4NQCA 4Y2DD 4WO4C 1KCRH 3EO0A 3T0EB 1ZEAL 2WLYA 3L7EB 5B4MD 1LO4L 1TIUA 3KPLA 4YUEH 4HUVB 4KK5C 4YGVB 4S0SD 4XXDB 4P5KA 5F88A 1EEZA 3NCYS 5FV1L 5CUSH 2Z93B 4V1DB 5DURD 1K85A 1RUKH 4MNGA 4QTIL 2AJXH 3VXPB 3WLBB 2NY5C 1K9TA 5ETUB 4PJ9A 4Z8FH 1JZ4A 3H9SA 4Q2ZB 1Y6MR 1I8KB 4R97C 2HFGH 5JA8B 1R5VB 3ZYOA 4JFXB 1RFDL 3CXHJ 3QEQD 4I8DA 2NY3C 4YHML 5I66B 3S3JA 4ZTPH 1G6RA 4YAQA 1SEQL 5EU6A 5AD0B 3KPSD 3LB6C 2B1HL 4YFEA 1FP5A 3PHOA 2FO1A 4CDGC 1KIPB 4G3YL 3BPNC 1CIDA 4LU5H 3FQRB 5IEHA 1C08A 2H26A 4X6DF 5L6YL 5ITFB 1V7NL 4TRPH 4OV5B 2YD1A 4S1SH 2YZ1A 1XIWA 2NY1B 5I8CB 1G6RH 4L8SB 5F9OH 3TA3D 4OAWA 5GS0D 2Z35B 1QYGL 2C5DC 4HKXB 4AMKH 2E9BA 1XH3A 4Y4HA 1LO5A 2DM4A 1CQKA 3U4EA 5T1LD 4MZ2A 3S4SA 2FEDD 2P48B 1JK8B 1X4YA 3GIZL 1INEH 4HC1A 4AG4L 4ZFFA 4RISH 1LD9B 3H3PH 4Y16D 1P4IH 4V1DE 2NYYC 1KIQA 1MFCH 1R3HA 4N8CH 3T77B 1YECH 4WW1B 3MYJA 2VO5A 1F4YL 3UO1L 1I3VA 3ARYA 2OZ4L 1H5BB 4ELKB 5KTEH 1F58L 5FYKH 4PG9A 4P23A 1EDQA 2EH7L 4OZ4B 5IESL 5JW3H 5JA9A 4G6FB 3GFUA 4IOFD 5T3XE 5DGQA 3FCTA 4M62H 2DM3A 2MQ0A 4D9LH 4F9PC 2CRYA 3RVTD 3FTGB 1I1AB 1B0GA 5I1LB 4RFNB 3QUYB 1BF2A 2ZUQC 2EE9A 2CR3A 3D0LB 2QQNL 4G5ZL 5HGAB 5TGBA 4O2EB 3SOBL 2C1PB 1DUYB 1CGXA 3K7UA 1OAXH 3ETBF 3RWDA 1A6PA 1SMAA 3KWWB 3ULUE 1X4XA 4Y2DB 4HT1L 1KLGA 5C2BL 2UY7A 1IAKB 4H8WH 2F5AL 4WENB 1KOAA 1EX0A 3QQ4B 4EOWH 4OZHB 3EHBC 4PRNA 1A1MA 3SCMC 4NFDA 5EUOF 4CW1B 4PRDB 5DO2C 5DURB 4LL9A 3FRUA 4LSPH 2FEEL 2UZXB 2ZUUA 3CK0L 3JV0A 4M00A 5E00A 2ED9A 1M7DB 5C6PB 1A1OA 4PJ5A 1ZS8B 3HB3C 5B38A 3UPRA 5D8JH 2ZOLA 2VDNH 1A4KA 1CFBA 3VFRB 3BFOA 3WKNA 3QEQB 3HZYB 4GRLC 1M6OA 1RZFL 5D1QC 4EXKA 1GGIL 1CF8L 1MIEL 4IDJL 3KPSB 5E5RB 4R96B 4BSVB 3BUTA 2X4PB 4KJWC 2VDPL 3GMMB 4NO5B 3RDTC 4AK1A 4PJIA 1MY5A 5I1IL 8FABB 2HLFC 3OKEB 4BSWB 3ARTA 5DLMH 1WK0A 4NKIH 1FHGA 4TPRL 3BH8A 4M8QB 4XNUL 3L1OL 4JQVC 1RD6A 5EZJB 3SGKA 4W4OA 3TA3B 2HT2D 3B9KC 3A67H 3QWRD 3IJHA 3UXFA 2ZG3A 1RUAL 3CFEA 1I7UA 3VXRD 2DWEB 3ZT6A 2H8PB 1U8PB 1OVZA 3BZFB 5T1LB 1LDSA 2XZQL 5GGUA 3TBSB 2C3VB 4GT7A 3MODH 4B5EA 12E8L 3LKSA 2D7OA 4OZHE 2DAVA 1EGJH 1P4BH 4Y16B 3L9RB 4Y5VC