2MCPH

Refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKGNKYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARNYYGSTWYFDVWGAGTTVTVSSESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Refined Crystal Structure of the Mc/Pc603 Fab-Phosphocholine Complex at 3.1 Angstroms Resolution
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1984-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpH02
3T0AA 5DFVC 1WAAF 1JTOA 1IVLA 1RI8A 2ICWI 5JW5B 3BT2L 1A6PA 4S1SH 5F44A 1RMFL 2XWBB 1ES0B 3PWJB 4QF1A 3JV6B 2FHCA 5CZXC 3IB4A 1HYSD 1HHGA 1HKLH 4Y7MA 5AUMB 4TQEH 4PJ7F 4D0DA 3KYKH 5JDSA 1U8HB 2NNAA 4U1GB 3RPIB 4WWID 3VXUA 3MRRA 1A9BA 4KJWD 4WWKA 1QLRB 3STLA 3U6RA 1OSZB 5I1EH 2VDOH 3ISWA 2BNRB 4WJ5A 4GJTB 1P4LB 3TZVA 1WFTA 2D7MA 3OKMA 3B9KA 5E5MB 5IFAH 4N5EC 4WW2C 2I25N 2XPGB 4JFED 4JPIA 3C2SA 3UTTA 1B0RB 2I9LB 3B2UD 1JCKA 3MRLA 4XXDB 5JOFA 3L7EA 5EUKB 1TPXB 3O2VL 4LLAA 1F4WL 1HIML 1XGPB 4GMSH 5AWNH 4GOSA 3PWVB 4E41A 4XP4L 1UWXK 1OPGH 4Y8DC 2B4CL 4WRLA 1LE5B 3H3KA 1NMCB 2ED9A 3GRWH 1KJVA 1NGQH 1GAFH 3P40A 5GGUB 5BS0B 5J12C 4DWHA 4HX1B 1KB5L 1DE4B 2JJTC 4PV8B 3DO7A 1AQDA 3HHRB 1FNSL 4JRYD 4WFED 3KLSA 1J10A 1JGVH 4XB8A 4NHCH 4TUKL 5JHDD 5C0BD 4LCCC 4P2OD 1OAQH 5E6IB 4LPYA 5HY9A 1RU9H 3GI8L 5HHVH 4L3ED 1R5IA 3OKDB 1J0HA 2ARJB 3OHXA 5CCKH 1Q72H 3W5NA 1RZGB 2VL5A 4JZNA 2O5ZL 4MCYA 5IWLA 4JLRB 3OKNA 4PJCF 3S37X 1OLLA 1TJIH 3ARFC 3MXVH 4QEGA 1ZHKB 3RGVC 4PJ8C 1GIGH 4YHKH 1XAUA 1DBML 2LU3A 2UYLA 4G8EA 4LU5H 1BWWA 5CHNB 3HNVL 4XPTH 1MIML 4NKOA 4ZS7L 3X12A 2LFGA 1E4KA 3QFJD 1CICC 2DBLL 2Z35B 5EBWA 4WENB 4YGVB 3T04D 1JF1A 2CLZA 4M5YH 2ENSA 2AJVH 1EVUA 3S5LG 1JNHA 4WO4B 5J9PB 4M4PA 2E9JA 1FVCA 4PJ5B 1QZ1A 3S3JA 3ZO0A 2W91A 5CEZH 3E2HC 1MJ7L 3ZYOA 1KEML 2HG5A 5L88H 4WU5B 4BK5A 4ZPVB 5DR5H 5HBBA 2IQAB 4P4KD 5I6XB 1SY6L 2XACC 3RVXD 2Y5TB 1OP5H 5H35A 3TIDA 4A6YA 5E00A 5KANG 3P0VL 3DYOA 1JPSL 4FQ2H 4ELMB 2YPKB 3Q6GH 1I9JH 3N1QC 3VDBA 3I02A 3GKWL 1J0ZA 3PDOB 4GLRI 3UDWC 1MQKH 2HAZA 4GKNB 4U1GC 2OJEA 3QDHA 5IJKA 4IEFB 2P49B 1UM5L 3SDCB 5D5ME 5LKNA 3GSVA 2E7CA 3LB6C 1CBVH 2YBRA 1NMBL 3WHE0 2IQ9H 5T3XD 1FNFA 1S7UB 3QG7H 5FK9B 4O9HL 5T1DH 3PP4H 4PRNB 5FKAA 1TPXC 4NFCA 1JK8A 1NLBH 2F19L 3BKCL 4PJEB 5AZ2L 1CK0L 5C6PB 2BDNL 1N6QL 1EO7A 5CMAA 4AIXA 1H3GA 4YDKH 1OQOA 2UZIH 1BD2E 1F45A 4GAGL 3FQRB 3H2WA 5DHVH 5D72H 1I8MB 3U82B 2VDNL 2FSEB 5FDWA 4NT6B 2YPLE 1XF4B 5IF0B 1NMCC 3WD5L 2H3NA 4N1HB 4GW4B 3G6JA 2A83A 3C8DA 5CJXA 5I1LA 5CJ8A 3HZKA 5T3ZE 3I6GB 3HMWH 2W9DL 3ULVH 2V6HA 5E6IC 4JRWA 4M9OA 2R0ZL 3ILPA 1D6VH 1F6AB 1X7QB 4NDMB 5AYQA 1U8LB 1JZ8A 1QSFA 4AH2B 5C08A 1NFKA 2UZYB 4XPFH 4EVNB 1YJDL 4NQTA 3I50L 5HPMB 5DI8B 4Z8FH 2VDML 3QWRA 2EZ0D 2VZTA 1FRGH 5E9DD 2MQCA 1I8IA 5DK2B 1PVHA 5BOPA 1T03H 2EYSA 1U95B 3REWA 5B3JE 2QSCL 2UWEF 4EI6A 1IJ9A 3GBNL 3G04B 5K33A 4K71B 5JHLL 1WISA 2C3XA 1O0VA 4HFUL 3DRQB 4WO4C 5FCUL 2YD3A 4L1DA 5MENB 2N1KA 2B5IB 3IS1X 3ULUE 1T1XA 5CSBA 4EOWH 2OXHA 3KPNA 3O41A 1U8QA 2APBA 3L6FA 4RGNB 4P3DA 4YHML 3VFWB 4Q97A 1N8ZB 2F5BL 4DUWA 3DURB 3UTQA 1PY9A 4ZTOH 3RTQA 1RJYA 2EDWA 3RQ3A 3PGFL 5KS9F 2AJXH 2J8UA 5DEGA 2VQ1A 4O2CA 1P4BH 3C9NA 3K4ZA 1HI6B 5I9QB 5I6XC 1MHEA 5FHAH 4LMQI 5KVGL 4KK9C 1AO7D 5TPWH 5IB5B 3MLSL 4JFHD 5C0CB 4ZNEE 4QOKB 2A9NH 3MRDA 1IKFH 1INQB 5M7QA 3TO4B 1YEDB 4Z7WB 2BSSB 4XMKH 4OZ4B 3IXAA 3M17A 1QHOA 3MLYH 3RWCB 1ORSA 2P5EA 3WMSA 2HKFH 3T0EE 4M5ZH 5GRYA 3TT3L 2YEZB 4JDTH 2JB6A 3DXAE 5HGGS 3QPQD 3SO5A 1DQQB 2GSIA 2CDEA 3SDCC 5L2KA 4LKCA 4PJHF 2Z92B 2IPKA 4U33A 2L4OA 4OLYL 4JM4L 1ROWA 1KN4L 2EDTA 4PJFB 4X6FA 2DMBA 3D2UD 1J5OL 2P8PA 3GMPB 4LCYB 4RISL 3D85D 3J8F7 4JO3H 4H1LB 1RQ5A 4RGOH 1KLUB 2D3VA 2P5WD 5IESL 1CT8A 1U8OB 1P5UA 1WBYA 4YXHH 5ALBH 2JE8A 1PSKL 4YO0B 2D7TH 1X4ZA 2CMRH 1A4KA 4R8WH 5F9JA 3RKPA 4RZCB 2H45A 3WNLA 1G7PA 2AK4A 2IH3B 1C12B 1ZAGA 2X9WA 4YNYB 1BOGB 1FP5A 3A6BL 3TPUB 4UDUB 1YECH 1U3HB 2E6PA 3VWKD 1MRDL 3QEQB 1FL5A 4EQ3A 1BGXL 3R1GL 3O3BB 1J8HA 4JFXB 1AGFA 2P43B 4YPJA 3VW3H 4ODSL 1CTNA 3KPRA 4LFHG 2R23A 3ZE1F 4KDWA 2H9GB 2DQGH 1HOCB 1JZ3A 4G9DA 5L7XL 1QP1A 3D0LA 1ZWIB 3EDEA 3FN3A 4NO5A 1AXTL 3REVA 4OAWA 3O0RL 5FYJE 3TV3L 3MUY1 4YHPB 3RIAK 1S9WB 4ZD3L 3SE9H 4MNHB 3EOTH 4K71C 1I85A 2XTJB 5TFSL 4QRPB 1WITA 2M1KA 5DC0A 4MCZB 1CLZH 2B5IC 2VLRD 2VQUA 4LHUA 1KLFA 4HMCA 4X6CE 1IMHC 5KZCB 4RGNC 3UC0H 3AY4A 2RQ8A 5H94B 1JI2A 2Y07H 4LMQE 2DQTL 3WFCL 3OR7A 3P0GB 5EZLB 4ZUWB 1OAXH 3PWUB 1CL7H 4RNRA 4QXUH 2ARWA 4Z7UB 4IRJA 4MNGE 2DQJH 4WTZA 3PWPA 2YRZA 3V79C 3BIAX 4HWEL 5I9QC 3DV4B 4HXBH 2ED7A 1IGFL 4QT5B 4JZJB 3RVTD 2QL1A 4LIQL 4Y4HD 3HI1B 2D03H 4Z7QE 3SDYH 5A3ID 3TO4C 4AM0A 2VLLB 1K3IA 2YD7A 3TVMD 1FG2A 2GJ6E 4R3SB 4YX2L 3HAEG 2WM0A 3BKJL 3DIFA 1ZXQA 4DN4H 1H3VA 1KJMA 4HK0B 2P8LA 1BMGA 1U92A 4A6YL 3BP5A 2FATH 4OCLC 1P6AB 3OKEB 2NY3D 2VXVH 2BNQB 5HI3C 2B1AL 2XZQL 4TSBH 3F5WA 1MCDA 1JRHH 1A7RH 1R3JA 1JHKH 3CFIC 4X6EA 4PRPA 1X5FA 1XGTA 5JUEH 4JVWA 1G0YR 3SKOB 3WSQL 3JWDC 2R29L 1MEXL 3GJFA 3FT2A 3BEVA 3AAZB 4LCWA 1RMFH 1ZVSB 5AEAA 3QXDA 5FO7B 4XI5D 3SCMA 5I2IA 3RWDB 1LO3L 3QDGB 4JFQA 1EGJH 5FO9B 4WY7H 4IOFC 4LPVA 3MNZB 4J8RB 4XPHL 5DD6B 1U3HC 4LAJH 3CZFA 3X11A 5SWSA 3TYFB 1YEEL 5DJCB 2AV1A 2FECI 2JB5L 1I3UA 3WJJA 2NW2B 2KZ1B 5I1GH 5FGCB 3HN3A 4FP8L 2PR4H 3IETA 1BZ9B 3FO1B 5IMMB 3WFHB 2GY7B 1I7RB 4KJPC 4KK8C 1CVRA 3QEHA 1MFCL 5DJ2A 3FB7A 4N9OB 4J3VA 3BE1L 4J2XA 3O2VH 2EH8H 1XZ0B 4I3RH 4LEXH 2GTWB 2H32B 5EWIH 5CUSH 1T66C 3MA9L 1SBSH 2D7NA 4ZUUB 1AHWA 1P7KB 4XP4H 1N2RB 3MJ9A 3U46B 3B6SA 3H9SA 2B4CH 2DYPB 4PG2A 1LNUB 5E56A 2JCCE 1WUNT 4GG6E 1MCHA 2XTJC 1BP3B 1A14L 3V7AG 4HKZB 2LAGB 2BY1A 1KB5H 2CLRA 3NH7H 4U3CA 3HI5L 4XB7A 1IQDA 4GG8B 2ZNXA 4XVJL 5GRJL 5EOQL 4DW2L 1FNSH 2AQ1A 4GAYB 4UT9H 5F96L 2FWOA 1P69B 4K94C 4TUKH 1QSEE 3VFNB 5FB8B 1D9KA 1X5HA 4PB0L 1KIQA 3MRHB 5HI5D 3SHSA 2O5ZH 1J0YA 2A9ML 4JZJC 4LCUB 4I5BA 1CFSB 1YN6B 1DBMH 2XZCL 4EDWH 3HNVH 3O4LD 5F70A 5AAWA 3UZVB 4JGUA 1XGYL 2HJLA 3QUXA 3WFZA 5C0RH 1PKQE 3TCXA 4JO1H 1HQRB 4PRDB 3J7HA 1F3JB 4O2EA 4JFFE 4KVCL 2VLJB 5E2TL 1TQBB 4GRWB 1NCWH 4YHYB 2PYEA 3TH4T 4X99A 5SWZA 1FNGB 5D71H 1EFXB 4X9BA 1MJ7H 5C09E 4I3SL 1KEMH 4DAGH 2E7HA 3SDXE 3U4AA 5I1HL 3FMGL 1VA9A 3SBWA 4XCYA 1SY6H 1F4HA 5EU3A 4F33B 1MY7A 1LO0L 2C1PA 3NIFF 3TFKD 1KJ2B 3P4NB 3JV4B 4ZS6D 3P0VH 3DPBA 3EZ8A 2GAZA 1NJ9A 1ONQA 3S96A 1IQWH 3FFDA 2BVQB 2VISA 4FQQB 4P23A 3GKWH 4P49A 5HYEA 3LKPB 3QQ3B 4J12A 3ZL4L 4J3OC 4ODUB 3ZT7A 5BJTA 5HGHB 5KSBF 1UM5H 1NGPL 1CFVL 2BJML 3ETBF 2RCSL 4NJAL 4MX7B 3MNWA 3L3KA 5CSZA 3S36X 4MSWA 1NANH 2F54D 3AXLA 2EDRA 2HLFC 1LO5A 1HCVA 2ORBH 5A1AA 1I8LA 2YMXL 3UPRA 4O9HH 5TDOA 2C4XA 3L5WA 3L1OH 1T3FA 2BERA 4TUOA 1HHJA 3CFDA 5D7LA 5HHXL 4XBPB 1MUJA 1N6QH 1SM3L 1ADQA 4PV9A 4WI7A 3EYFB 5FECB 3B5TA 2VDNH 2NW3A 1K5NB 2H6PB 3MRGA 1T21B 3UPCA 5I76A 4M1GL 3WD5H 2EDYA 5IFJB 5HHOB 3WNOA 5IIEA 1CVSC 4I3GA 4MJ6B 2EXWD 5GJTL 5F7UA 5HJ3A 4N90E 4IOIA 2PN5A 1X4YA 2D7PA 3KPMA 2FO4B 1AQKH 4WW2A 5F8QC 1WAAE 1YJDH 1MNUL 4OJFL 3I50H 1CXFA 3O3EA 4U05A 2EKJA 3EGSA 3DVNB 4KHTH 4MJIB 3I6LD 3GBNH 4PJ7E 3BSZL 3JZ7A 4JKWA 3CDYA 3PV6B 4WFFE 4TVPE 5JHLH 1NCDH 2QHRL 1MCFA 5FCUH 4U1NB 4ZTPH 3MREA 4L4VB 1TQBC 3QEUA 3VDAA 4YHYC 3TBVA 5FA4A 1TZHA 3W0WB 4BSWB 3AREB 4H20H 3RX7A 1U91A 3ILQD 2PW1A 5AG9A 3IU4H 1F58L 4GUPA 4OV5B 1KELL 5EU6E 2Z31D 3HZYA 4ZXBB 3B3IA 4ZO8A 5DDHB 1QUNA 3DTXB 4N9GA 4Y1AD 2NYYD 5B38A 4WHCA 4LCCA 3G5ZB 5J06A 4Q2ZA 3CFEA 3O11B 4G8GD 3F7VB 4OIIL 2R56H 3HUJF 4KJQD 4HIEA 4JPWL 3OPZL 5IP4A 1D5IL 3TT3H 1XF1A 4PJ8A 5DK3A 5H2BA 1KYOK 3VRJA 2R8SL 3K80A 4NKDB 2R0KL 4F7MA 4LRIC 4R26L 2C7UA 4JM4H 4CUCA 4NN6B 1ZGLP 1KN4H 2BCKB 1J87A 5D9SA 1ZEAL 1JWUA 1MPAL 4Q74A 1U8JA 5J56B 2X4PA 1GOGA 4RISH 3RWIB 4XHJC 4RBPH 3N1GC 2PO6B 1AD0B 5C07D 3IDUA 3L95A 3HLAB 5ECJE 4M93B 1UXSA 4PJCE 3OG4B 3DUUB 3MUHL 3DSFL 1ED3B 5DA4A 1KACB 1PSKH 2DQCL 4MA1B 4V2BA 4HXAL 4HMEA 2EDEA 3VXSB 3NFPA 1NCCL 2CLVB 3PL6B 1G84A 5C0AE 5EUOA 2VLME 2PXYD 1RIVL 5J6HB 2UY6A 4OGYH 3VI4F 5JW5A 1H5BB 3ARBD 4LHJB 1PGRB 2FGZA 3PWJA 3QH3B 2PW2B 3JV6A 3MYJB 1VADA 3RZCA 5JOPE 1FLTX 1KBGL 2W92A 3UDWA 1U8HA 1T89A 3RPIA 1BFSA 1HINL 1RZ7H 3MJ9L 1OSZA 5LGKA 4ODSH 1NSNL 2BNRA 3LDBB 3U7AA 4YXKH 1JYVA 1HNFA 4JHBA 4KKLD 3N06B 5E5MA 2GI7A 1GC1C 4P2RB 3TEUA 2XPGA 4XPBH 4DOHB 4MD0B 1B0RA 2VLKD 2I9LA 5ENWB 3S9DB 3QWOB 5T1KD 4XXDA 4D2NA 3VXUD 3NCCB 5EUKA 5A43C 4ZD3H 4G6MH 1F90H 4LOUD 1XGPA 2O5XH 1D7FA 2GITB 5DS8B 4PG9B 3TZVD 1QR1B 4U4BA 5CLTA 3PWVA 1JF5A 3BVNB 2CKBH 1A7PH 1WWWX 3LIZH 4PRAB 2ESVE 5I19L 4TUJB 1N0XL 1LE5A 5J0BA 5DD0L 1NBYB 4WHYG 4P59H 5JW3H 3AREC 2WSKA 2M26A 4HX1A 1GGYA 5I15L 1RIUH 2CJUH 1DE4A 4PV8A 2OL3B 1HCFX 1HHIB 4KC3B 3EKCA 1XGUB 3QNYB 4DUVA 4ZXBC 1IGML 2EEAA 4QNPF 4J6RL 3JWOL 3PJSB 1OAZL 4HWEH 4M43H 5E6IA 3N1FC 2X6MA 3ZDZF 4LIQH 3F65A 3FN0H 4TYUA 3OKDA 4ONOA 2ARJA 1Q9KA 1RZGA 5FAAA 4MAYD 4JLRA 4HUXB 1NAMB 1ZHKA 3CFJB 5KG9A 1JGLL 5DURD 4YX2H 1OD9A 3RJQB 1QQDB 5CHNA 1KNOB 3TO2A 4QHNA 4Q9CA 3NA9L 2V5MA 4Q9QL 2YXFA 4F7PB 4FG6C 4QCIB 4ONGH 3T77B 4NN6C 5CKGA 4YGVA 3VXMB 1YEHL 2NXYB 3MX0A 4R7NB 1FIGL 1I7ZB 3RVWD 4WO4A 5CD5C 5J9PA 5FUOL 4WI3A 1QSVA 3TBSB 1DBBH 1V05A 2B1AH 4AEHH 3QISA 3EYQD 2PO6C 4UV7H 1DN0B 2FX9L 4OD2B 4M93C 4BZYA 3TBTB 1KIUA 2JIXD 3UMTA 4F9LA 3WSQH 1MEXH 2XG4A 1IAIM 1OGAE 1EJ6A 1OOAA 3DX9A 4MA1C 4WU5A 3UJIH 1ACYH 3PL6C 5ERWB 5JXEA 2UWEE 3P3YA 2IQAA 4J3XA 1J1PL 2Y5TA 1DBAH 2LAAA 3M1BB 1H5BC 5EOCL 2P24B 3MV7D 2YPKA 1Z9MA 1PYWB 4ZFZB 3VRIB 3U2SA 5C71A 2FIKB 3U7YH 1HXYB 3PDOA 5HYFA 1ADQL 1R5VB 4GKNA 1YEEH 4Y5VA 4OD3H 2JB5H 5FM5O 3SGJA 5IKCB 2AXFB 1TETL 2G2RA 3SDCA 2WAHA 4FP8H 25C8L 2X40A 3AB0B 4LEOB 1AC0A 1EFQA 3NTCL 3QIUB 1BQHA 5KVFL 3W2DH 3LDBC 5KS9E 4C56A 5IHBA 5DVOA 3F6LA 4Y2DB 2XWTB 4YE4L 1LEKA 4CDHA 3MA9H 1S7UA 1V3KA 5FK9A 2XRAL 1S7XB 3DVGB 4PJEA 2Z0BA 4I0PB 4PD4J 2X70B 5ID0B 3FRUB 3M8OH 3WFDL 1WZKA 2HA1A 1A14H 4IIQB 4WFGD 1JTPA 3FQRA 1NC4D 4PJHE 1MLCB 3HI5H 3QDJB 4HC1H 4XVJH 5GRJH 1QR4A 1XF4A 3HS0B 3RI5K 5IF0A 2FJFB 5ADOL 4JRXE 3C6LA 2VTFA 2DKUA 4LSDA 3D39B 3R8BB 5GRUH 1IM3B 4GRMA 4PB0H 1CDIA 5IB1B 2YSSB 5J7CC 2Q76B 3VXRB 4U6TA 4EKXA 4M1DL 2A9MH 4U1LA 2NX5B 2AGJL 4RSVA 2WP3T 1F6AA 4JG0H 3EYSH 3D3VB 3CXDL 1X7QA 3PDDA 1N26A 4K7PX 4A2MA 5C8JB 1U8LA 1KIPB 4AH2A 4UNUA 3EOBB 1RUPL 4GBXB 3G9AB 3KPTA 4JM2F 3SE3C 4EVNA 5I0ZA 5HPMA 3O4OC 1FVEB 5DI8A 5TE7H 3U0TA 1TNNA 2QQQA 1CDCA 5DK2A 1U3ZA 4HSQA 4KKAC 4GO6B 3KPOB 2BVOB 1NLDL 4KVCH 3BZEB 2ITDA 5DD1L 3MACL 4GXVL 2NXYC 1QSZA 35C8L 5MENA 1KTKE 5DRXB 3FAXA 3ZE1E 4XNQB 1RUAH 1IZKA 1RZKL 4FQCH 3VFWA 1N8ZA 3FMGH 3ZKMC 3O6KH 3DURA 2H2SD 3BDBA 3EOAB 2E8YA 1LO0H 1MRFL 5HGAA 4V1DB 4JY4B 3QCUH 2XNAA 1EZVY 5C0IB 2ZJSL 3V4VL 1HI6A 4P2CG 4WEMB 1NGYB 3T2OA 4LSRL 1WT5A 5C0CA 2YUXA 4QOKA 1INQA 1G7JB 5A2JH 1U8PB 2ICEB 1MCWW 1VHPA 1RK1B 1YEGL 1YEDA 4Z7WA 2BSSA 3TO4A 4OZ4A 1FYTA 1ZKAA 2AEPL 5HVHB 1HXMA 4QHUB 1NGPH 3RTQD 2IFFH 3RWCA 2WZPD 4FQXA 2BJMH 4UAOB 2UZXB 2NY0B 2YEZA 1XEDA 2D31A 4YC2B 1DQQA 4X5XB 1S9VB 3FFCB 3AB0C 2APTA 2Z92A 1E27B 3QIUC 2VO5A 1UH4A 5DO2C 1PX3A 5I1KH 2YMXH 1W8NA 3F58L 4Y2DC 3H9YA 1MF2L 4PJFA 3WUWB 1NFDF 5B4MC 1E6OL 1WZMA 3GMPA 3CMOH 2P5ED 4FHBD 5HHXH 4KDTC 4H1LA 4Z5RA 1SM3H 4OZGB 1CDHA 1KLUA 4I77L 4M03A 1U8OA 3OGCA 5TGBB 4HPYH 5INDB 4I0PC 3HMXA 2F53B 3B9VA 4YO0A 4L8DB 1BM3H 4CADB 1IM9D 4M1GH 4IIQC 4AENB 4RZCA 3OQ3B 3QZWA 2OZ4A 4U1KA 2IH3A 3ZT5A 1C12A 3MLZH 4L4TB 3H0TA 4YNYA 1BOGA 3QXAB 4Q0XL 4BYHA 4DZ8B 4UDUA 1U3HA 4N8VB 1RVFH 5GJTH 4M1CC 2AJ3B 4HH8A 1MFBL 3AU1A 3V5KB 3O3BA 5FOBB 5B3NA 1EAPB 5BRZD 2W0PA 2AI0L 5ICZA 1A7QH 4FMKA 1MNUH 4NQCB 4OJFH 1BZ7A 2H9GA 1NC2B 1RURL 1HOCA 4CRPA 3LKOB 1GSMA 5ICYB 1MOEA 4ONFL 1ZWIA 5HHME 4GBXC 4D9RE 2PTTB 3RKDD 5EZIL 3QT2A 1PZUB 1MCBA 4YHPA 1J8HD 2FEEL 3EJJX 3RDTB 3GZKA 4NQDB 2ZOLB 1S9WA 4XPGL 3QXUA 2VXUL 2CRMA 4KV5F 4MNHA 4P5TB 2G60H 3CMGA 2G5BB 5FOJA 4NQSA 3S35L 3P30L 3VWJB 3BEWB 1OL0A 4XBEL 4MCZA 1BOYA 2I26N 1VGEH 3B9EA 2QBWA 4K8RH 5LCVL 3IRPX 1Q8MA 5H94A 2MCPL 5HYIA 2E5EA 5EZLA 4ZUWA 4GRLB 3RWJB 1JNLH 4PGCB 1J1XH 4Z7UA 1JHLL 4HBCL 4OIIH 1WF5A 4HT1L 2XQBL 4JHAL 3KPSE 4XVSL 1WSST 2W60B 1ITCA 3OPZH 3DV4A 5CP3H 4FQHB 3A6CH 4JZJA 1C1EL 4QT5A 5C7XL 1K6QL 3WIIL 3HI1A 3GB7B 4D0BB 3HG1B 5JIKA 2P42B 3MV8D 1DVFD 3MOQA 4F3FB 2Z9TA 2R8SH 1FNLA 1GRWA 2HRLA 2VLLA 5HVHC 5IM7B 3OJDB 2HYMA 2R0KH 2OK0L 4R3SA 4UAOC 3GJFH 4WU7B 4R26H 2D9CA 2NY0C 2XN9E 1W72B 4IRJD 1EIBA 4H26B 4YC2C 3PWPD 5FYKU 4JE4B 3LPGA 1CGYA 1ZEAH 3OWEA 3TGXA 1MPAH 3VGAB 4PGBB 3MSPA 1T20B 5CZKA 3OJ2C 4JGJA 3LQAC 3OKEA 4P2YA 1KFAL 2BNQA 1SQ2N 4EUPB 1N59B 5JNYB 3WUZA 4PLNC 3VA2C 1YY9C 2Q8BL 2DQCH 2VR9A 1IEBA 4HBQA 4Z7VB 5DQ9B 2EH7L 3BD5A 1NCCH 4RWYL 4NZJA 5C0FB 1UJ3B 1DQML 1ZOXA 4KY1L 1QBML 1MWAB 1M6OB 2XV6B 1ZVSA 1A9EB 2V5YA 3QHTC 1MJJA 5FO7A 1UM4H 4KQ3L 3RWDA 6CGTA 2VUYA 3MNZA 5GS3A 3MROB 2FEDD 4PRPD 4J8RA 4XVTL 1HINH 1FYHB 2R4RL 3MJ9H 5DD6A 2RAMA 1YYLL 1TXKA 3CSYB 3TYFA 3OV6A 2VZVA 1S7TB 5DJCA 3F12A 4LCWD 3SKNB 2NW2A 4LGSB 2D0FA 1SVCP 1HE7A 1BZ9A 4OUOA 4UQ3A 3FO1A 5IMMA 1I7RA 1OWWA 3NIFE 3O3AB 3VD7A 4MZ2A 1XZ0A 2UV3A 2GTWA 2H32A 1C7SA 3NPSB 3BRGC 2WWKT 3O9WD 4OLVH 4ZUUA 1F6LL 5KSBE 4N0UE 3RDTC 3UTZB 1P7KA 4WUKH 4JY6B 4CL7A 5FUZH 3C5ZB 2CR6A 4K55A 3LRGA 4FA8A 3HZVA 2D2OA 1P7QB 2DYPA 4P5TC 3CNKA 1QRNB 2H26B 4PJGB 2CD0A 1FL3B 4L8SB 1UA6L 3VWJC 3B8SA 1KCVL 2A77L 1UACL 5F8RC 4GG8A 4GH7B 2YA2A 4GAYA 3RWHB 3BKMH 1OAZH 32C2B 3VFNA 5EH1A 4GRLC 5FB8A 4NOBA 4ZYKA 4OZFG 3MRHA 4LSVL 5D2LB 1PG7X 3DECA 3NZ8B 1ZVYA 5CILH 2XFXB 4LCUA 3BJLA 3OF6A 5IW3A 1CFSA 1YN6A 5EZJB 4EN3A 3GMRB 4TNVF 2ZCLL 1S7RA 3QB7C 3BQUB 3QHZH 1BJMA 4Q9QH 1TDQA 3CFKB 3JUZA 3IYLW 1IRAY 4PB9H 3WEXB 3GMLB 1YEHH 1HQRA 1ZSDA 1FIGH 4R4ND 5J1TC 1F3JA 3VGAC 3UXFA 1XMWA 1NCTA 2F74B 1BQUA 2VLJA 2V5TA 3MV9A 4PJXB 3VFPB 1ZS8B 1EEUA 3ZKXB 1SHMA 5IV2B 3QDMB 4P2QB 4R7DB 5D6DC 5F1NB 1EFXA 3NVQA 4S1QH 5HYJB 3F7RA 1J1PH 1UJ3C 5E2WL 4F33A 4ZAKA 1ORQB 5TE6L 2CQVA 2IANB 1KJ2A 2MOVA 2ZSVB 3JV4A 3P11L 3P4NA 4JN1L 3GGWB 2Y4SA 1X5IA 4WUUB 1HZHL 1KOAA 5I18H 1IC4L 4FQQA 1O5DT 2R0WL 3LKPA 1ADQH 1XF5A 2EO1A 3QQ3A 1VFAB 4ODUA 1V3LA 4IS6B 1TETH 3KYOB 1GGBH 3HMXL 1FN4B 25C8H 3LRSB 4LAQL 2ADGB 3TC9A 3JWDL 3KNBB 5A16B 4PUBH 3MQIA 3QIBB 4WHTB 1JGUH 4MX7A 4BFEA 4P3CH 4NNYA 4FFZH 3BGFB 5I1IL 2OZ4L 3U9UB 5EO1B 4Z78B 1CFNB 3D5OF 2EIZB 2CIKB 3HUJE 1NDGB 4JFEE 3PV7A 5A2LH 2EICA 1FZJB 3NPSC 4KKBD 4XBPA 4CJ1A 4KRPB 3I9GH 4F80A 5ISZB 1TJHL 3C5ZC 2DRUA 3EYFA 3ZT6A 2UUDH 2X4QB 1JPTH 4DVRH 5D1ZB 2H6PA 1FJ1B 5IVOA 1EVTC 1T21A 4L8SC 4AT6B 3QO1B 2BVUA 5IT2L 4AQOA 5CD3B 4I48A 5K9JL 1CGSL 5IFJA 2BRRH 5HHOA 5D7LD 3RWFB 1VB9A 5EN2B 4XC1H 4NC1E 3ZTNL 5DHVB 1UWGH 2HJFB 3CC5B 4OFIA 5JMRA 4LARH 1T04A 4APQB 4JRYE 4MJ6A 5ILTL 4P9MH 1XR9B 5DFVD 2C26A 3BJ91 1MJUH 2CPCA 2ITCB 1KTLB 2VH5L 3T3MF 5JHDE 5C0BE 1ZLWH 3CXDH 4L3EE 2FO4A 4KQ4H 5E2VL 4HUWB 4MMZC 5DEFA 3VI4E 3HE7B 5TF1L 1HNGA 4F2MB 5F7MC 2MNUA 3BQUC 4U3XA 3DVNA 1NLDH 2E6JA 4MJIA 4JFDB 2DD8H 3GM8A 5E8EB 1I1RA 1FFOB 1X5GA 5DD1H 5I1AB 5L2JA 3MACH 3PV6A 4YBLB 3TBYB 1A02N 3MCLL 4N5ED 2VDLL 4L4VA 4AL8L 4DN3L 3RUGA 3W0WA 4BSWA 3AREA 1RZKH 3GHEH 2AK1H 2MPAH 5FHBL 4JDVB 1YEJH 4OV5A 1DLHA 1F3DJ 4ZXBA 3SGDH 4XAKD 5DDHA 5I1CL 2ZJSH 3DTXA 3G5ZA 4X0KA 2DIAA 3QG6B 3O11A 3F7VA 1BJ1H 5DRNB 4LSUL 4B41A 4NFDA 3S4SB 3BAEL 5GPRA 3LHPL 1YQ2A 4L4JA 3MFFA 1RZJH 3QUZB 2C1OB 2QADB 3VGEA 4NKDA 2A1WH 2HT2C 1G1CA 4X8JB 3DVFA 1RK0B 3QIBC 4QNPE 1T1ZB 3PHOB 1NUFA 4NGHH 2BCKA 3F58H 3BGFC 3H42L 1E6OH 3ARFD 3ZDZE 5TDPB 2PYFA 5I8KL 3RGVD 3RWIA 4LSPH 4PJ8D 1AD0A 3V5DB 5T3XE 3HLAA 4I77H 5LQBL 1HSAB 2ARJQ 2LU7A 3OSKA 5I75B 1ED3A 4KRPC 5CEZE 1CICD 3P9LB 3VXSA 3DX6B 3PL6A 2CLVA 3CK0L 3IVKA 5J6HA 5D1ZC 2OS7A 3UAJC 1H5BA 2O5YL 1NCAL 1L7TL 3SQOL 3CPLB 3MO1B 2PW2A 3MYJA 3QXTA 4LNRB 3QJFA 3V4PH 1A1MB 2YD4A 5JA9A 3QYCA 1MFBH 3TT1H 4XP6L 4APQC 1BBJA 1TCRB 4ZPTB 3WLWC 5KSUB 1RHHB 2VKWA 1AXSA 3C08L 3C2AL 4MNQA 4QO1A 3BP6B 3DGCR 3DYMA 2DTMH 1T4KA 1BD2D 3MTRA 5BVJB 4P2RA 1I9RH 1BAFH 4MD0A 5DHYB 5D7SL 5EZIH 5ENWA 3ULVC 3HE7C 5HVWA 4JPKL 1UZ6F 5EULV 3PDGA 2R4SH 4HS6B 2C5DC 4ALAL 3G5YA 3SE8H 3LB6D 5E9DE 5CSGA 4ZFFA 2GITA 2X44D 3SKMA 4H25B 2Y36L 4YBLC 5DS8A 4B5EA 2QV2A 4PG9A 4O5LL 3S35H 5T3ZD 3KDMB 1I1AD 3BW9B 5E8PB 1I9EA 4PRAA 4TUJA 5ITFB 5LCVH 4FFWD 4GT7A 1S78C 4PGZA 1DQLL 3GK8H 4NKMB 3BKYL 4PJ9B 2OL3A 5MEPB 1MVFA 1HHIA 3QNYA 1XGUA 4F37F 5JXAL 3L9RA 4HBCH 4HGWB 4HT1H 2H1PH 3PJSA 2DJUA 5EU7C 4DUXA 2XQBH 2DQIH 4PRHB 4XVSH 4CVWA 5KW9L 5EIIB 5L8JB 2OXGA 4DK6A 3VD9A 5C7XH 1EEYB 3C09B 1K6QH 3EO1B 4PGEB 5BS0D 4HWBH 3E0GA 2W59A 4B53A 3SKJL 4LDLB 1AO7E 2DAVA 5K93A 3ULUD 1NAMA 3Q6FB 3SE3A 2OK0H 4G9FE 3CFJA 5EO9B 1OQXA 4Z0XA 4YHOH 2Y7QB 3QUZC 2QADC 4QCIA 3T77A 1KJ2L 3VXMA 1VDGA 2FD6H 4R7NA 2ICCA 4BK4A 2XA8L 4ODBD 3BZ4B 1I7ZA 4LDEB 1KFAH 3MUGB 4OQTA 1LD9B 1MI5B 2Q8BH 1DN0A 5E95B 3IFPB 3K81A 1I1YB 4OD2A 5KOMC 1T7WA 1K2DA 3NBNA 3V7MA 5I75C 3E8UL 3SDDB 1DQMH 4KY1H 3DXAD 4OLWH 5ERWA 3GUTB 4UDTA 1G9MH 4YHZL 4JO2H 4RMQA 5D96C 3SKUD 2Z8RA 4KQ3H 1QKZL 5DRWB 2AS5M 1YQVL 4PJ5D 3M1BA 1ZGLB 1LDPL 3FQWB 3D0VB 3G6JF 5I8OL 1X5ZA 3NCJL 4Q9RL 4JANB 1PYWA 2YD5A 1RY7B 1YYLH 4ZOBA 4ZFZA 3VRIA 1RPQA 1CL7I 1HXYA 3GDBA 2BSRB 4PTTB 1R5VA 3Q1SH 4LSQL 4LEOA 3WHXB 3QIUA 3UBXI 4OZHB 3CLFL 5E1AB 4KI5F 3HR6A 4ENEC 4Y2DA 3EYUL 2J7LA 3QAZB 5GZND 4NM8L 4KDTA 3NOIA 4CJ0A 3NABL 3SPVB 4G8IB 3MRFB 4JVPA 3SDCD 2BZDA 1F3RB 4YWGL 4I0PA 1LO2H 2X70A 4NYLB 1ZANL 3OKYA 4HIXH 5F7DA 1KGCE 4JY5L 1MCOL 2QSVA 1YPZB 3BPLB 5LWYL 3H3PL 1MLCA 3MMEB 1HHKB 3GSWB 1UACH 3IDNB 3KXFE 3QDJA 3HS0A 1JRHI 2FJFA 4UV4L 2VLRE 4IOSD 1P2CB 1CQKA 4OCSL 1NFDE 4PJ9C 1RIHH 1IM3A 2I27N 2X42A 1C5DA 2J8UF 3LKSB 2WBWB 3F7PC 5ANMB 5FYJD 5T5FL 1QBBA 4OI9A 3VXRA 1KPRA 3VFRB 5F3HB 3CFCH 3C09C 4XP9L 4OZIB 2P47B 3D3VA 3VG0H 5C8JA 1KIPA 2ZCLH 3EFDL 3ALWA 3V8OA 1A0QL 1SEQL 1MCRA 1YYMH 1EBAA 1FVEA 3ARDB 8CGTA 3KHOA 1JUFB 4I2XE 1WBXB 4M7ZB 3KPOA 2BVOA 4M9PA 4OFDA 4O58L 4S11A 3DHMA 2ED8A 5FM8A 2FBJH 3PQYB 4H5SB 2BHUA 3W39A 3H7LA 5C92A 1KIRB 2Z8SA 3H9ZA 3ZYIA 5DRXA 4D8PB 1INEL 1Q0YL 1QFOA 4XNQA 4LSTH 5LXGL 1MFAL 3GNML 1B4JL 2QR0B 3EOAA 3SDDC 4HH9B 1IGCH 4JY4A 4MMXC 5BCAA 4KV5E 4Z0BL 1HZHH 2XKNB 5CJ5A 4U1JB 1IC4H 5CAYB 1NGYA 5DMKB 1JGDA 1HILA 2GHWB 4G6FD 2X1XR 1G7JA 3OAUH 4K3JH 1U8PA 2ICEA 2V5SA 2PF6A 1RK1A 5TDNB 1Y0LB 3ARXA 3HMXH 4ZUVB 4LAQH 4QHUA 4X9IA 3MLRL 3JWDH 5HDBF 1DBJL 4U1IA 4X5XA 1DSFH 1S9VA 3FFCA 4MDJB 1E27A 3IT8D 1U6AL 3NACL 5B39G 1BQSA 1QHPA 4GQ9H 3WUWA 3QAZC 4N0CD 1KENH 1I7UB 1C8PA 3G9VA 4GMTH 3S97C 4RAHA 4OGAD 2DM3A 2FCBA 1G7LB 2X4SB 3QQ4A 5INDA 2F53A 1VEMA 4OCRH 2NQCA 4CADA 3BPLC 2GJJA 3D1MC 4BQ8A 3ET9F 5IK3B 4AENA 5IT2H 5HI3D 4OLXL 1CGSH 3JTSB 5E1HB 4P5KB 1Y6KR 4HPOL 3ZTNH 4L4TA 3TCLB 5DT1H 1AGDA 2B4CC 4FTVB 4PJIB 4N8VA 3P4LA 5ILTH 1QACA 2BHYA 2AJ3A 5BZDA 3V5KA 4I9WE 1E4WL 5FOBA 4HKBA 1SYSA 1EAPA 3AMLA 5E2VH 1CDBA 1W2KT 1URLA 4NQCA 4IOFD 5IBLC 4HFWB 4WEBH 1NC2A 3MR9B 1INDH 1K8DB 3UTSB 3UTOA 3LKOA 1MCSA 5C2BL 5ICYA 2OL3L 4BJLA 1WTLA 4AEIL 4BQ6A 3OKOB 1O7SA 5FXCH 3QEQD 2PTTA 2JJSC 3ARDC 3RFZC 3QR2A 3RDTA 3RBGA 4M7ZC 4NQDA 4X83A 3S7GA 3MCLH 1NANI 4NZTL 4UMGA 4JHZA 1KCLA 4AL8H 5DJYB 2OMNA 4KK8D 4KJPD 3STZB 2G5BA 3BWAA 4H0GA 1HDMB 4XT1C 3BEWA 3VCLB 3VXNA 4F7CA 4QRRB 1NAML 3IDMB 3N85H 4KZDH 1S7WB 3FTGA 3C60B 4PLJC 1Q0XH 2IBZY 3ZSSA 2K9UA 2RGSA 3DMMB 1RUMH 1GZPB 1PBYA 3MRJB 1S7QB 3RWJA 4PGCA 5D1QB 4QRPD 3Q0HA 5BVPH 5IB2B 2W60A 4PJDF 4JPVL 4FQHA 5J57B 4OQTL 3GB7A 3HG1A 5KZCD 3JSSA 4F3FA 3LHPH 3LV3B 1CE1L 5IM7A 3CU1A 3OJDA 3T0EA 5DHXB 4WU7A 2OBGA 5FUCC 3KPQB 3V52L 3VMOA 4H26A 3X13A 1U8MA 3P9MA 3H42H 4PGBA 5JW4M 2VXQL 4HG4K 3VRLF 1T20A 3QUMH 5JZ7D 4X4XB 3HZMA 5IBUB 3WFEL 4Y88A 5LQBH 4K23H 4DJMA 3QRFM 1AJ7H 4EUPA 5CJOL 4QF1B 5DQ9A 4Z7VA 4OB5L 2RBLA 2VZUA 2NZ9C 2F9BT 5C0FA 1DJSA 4EQ2A 1T7XA 2EDLA 3MRRB 3P9WB 4L9DA 4WWKB 1OB1B 2IAMA 1NCAH 3MBEB 1MWAA 1M6OA 2VRAA 3FQNB 3QCTL 5C0DB 4XWOC 4MXWL 2AJYL 2ZUUA 3MROA 4XP6H 2QQKL 5HSFA 3IAGC 1OM3L 3ARGD 2A2QT 3C08H 3MRLB 4ZUTB 4QRSB 1S7TA 3X3GL 4RRPG 3SKNA 3MJ7A 4G3YH 4YHLL 4OBSA 1QA9B 2D0GA 3HR5B 3AUVA 2Q3AA 3QDGD 4NWTL 4OBRA 4X5WA 1N4XL 3O3AA 3CU7A 5E5UB 4PGJA 5F9OL 3D69B 4ALAH 1R3LA 4OSUL 1NL0H 1NGZA 3CSGA 5GS0D 2Y36H 3UTZA 1D5BB 2H8PB 5MI0B 4JY6A 1IC7H 4MQTB 4O4YL 4M3KB 4C59B 1P7QA 2CRYA 4H88L 1QRNA 1HSBA 4PJGA 3O45B 1FL3A 4L8SA 5JR1L 1UJTA 4DKEH 4E9LA 2GKIA 2XICA 3RWHA 1KB9J 3DMMC 4UI2A 2P45B 2CKBB 2LVCA 1ZA6B 2M8XA 4L9LB 3GRWA 4W70A 5D1QC 4G8EB 1TENA 4WFFD 5D2LA 3NZ8A 3SKJH 5KOVC 1LP9F 2XFXA 5EBWB 5JORB 3G5VA 3F8UB 2HTKD 1FZMB 4POUB 2VMFA 5EZJA 3GMRA 1D5XB 4OT1H 1FVCB 3BQUA 2GJ6A 3CFKA 1JZ5A 1JNJA 3WEXA 3GMLA 3OX8B 1BBDL 2JKXA 2F74A 4G5ZH 5IFHL 4GAJH 3VFPA 1ZS8A 4PRIE 3T3ME 3UJTH 1RUQH 5D7KD 1H3PH 3MLXH 5IV2A 1UWXH 3DRTB 3QDMA 3QPXL 4FNLH 2BK8A 4P2QA 2FH6A 5I1JL 5F1NA 3O6FD 4OGXL 1CU4L 1N5AB 3E8UH 3OJMB 2DQUH 3RU8L 3EJYC 5HYJA 4R4BB 3I02B 2ZG3A 4YHZH 2VAJA 4XZUB 4RA3A 1H0DB 1QKZH 2OJEB 2VXSL 1ORQA 1YQVH 4WWKC 2IANA 2WW8A 1LDPH 5BQ7B 3MBEC 3GSVB 5I8OH 1M71B 1FLRL 3GGWA 4PBVC 1N5YH 4Q9RH 4NQEE 1MLBA 1TNMA 3LQAL 4WUUA 4KGLA 3I84A 1JGEB 1XIWB 2IMMA 2QHLA 4CN6A 1QFWM 5DMYA 2FB4L 3LRSA 2ADGA 3KNBA 5A16A 5D7IB 3MXWL 4WW2F 3CLFH 3K2MC 1JYWA 5JA8B 2AP2A 4X7TA 4U6VH 5IVXB 3BP7B 5C0AD 3RY6C 2VLMD 5CMAB 3V0VA 5EO1A 4Z78A 1CFNA 2KL6A 1MHPH 2EIZA 3LZFH 4HQQL 1NDGA 1FGNH 1AE6L 3O8XB 3X17A 1Z9OA 2VLKE 4J23A 1CIUA 1FZJA 4U49A 5JOPD 3VXUE 5MI0C 5IUSA 3L3DA 4JY5H 1MCOH 1Z9LA 5LWYH 1AKJD 1H3TA 5I1LB 5JIPA 2IADB 4YXLH 3VFMB 2AAVA 2DQDL 5D1ZA 1FJ1A 1WZLA 4XHJD 1W0WA 4UV4H 2YKLH 3QO1A 1FL6B 4OCSH 5CD3A 3UTTE 5HHQB 3NCEB 4EI5B 5EN2A 1G1YA 1CLOL 5CGMA 5DHVA 5IWLC 1QSFB 3CC5A 1T5XB 1M7DB 2DIBA 1OT2A 4P0DA 1Z5LA 1A6TA 1XR9A 4L9LC 4HG4J 4E41E 4XCFL 5EC1B 2ITCA 4XP9H 1KTLA 2NY6D 3PABB 5DQJB 3CH1B 4EI6B 4D9LH 1ZV5A 3EFDH 2X09A 4PP2B 1A0QH 2BSED 4U1MB 2K7QA 1SEQH 5HHOD 4OD1L 4XNYL 3V6OC 4DK3A 1ULVA 4HUWA 2MFNA 3RA7L 3I75A 3HE7A 1R3IL 1F4AA 4JFDA 3O41B 1VSCA 4P3DB 3LY6A 4WGVB 1FFOA 5I1AA 2GJZA 2ILLA 3TBYA 3QUYB 3UTQB 4F8TA 4MQ7B 1BF8A 5GRVL 5ACLA 4K07A 1YN7B 2HRPL 2VQ1B 1B2WL 1INEH 1Q0YH 3C9NB 4O2CB 4E5XB 5F7NC 5LXGH 4FQJH 1UB6B 1RHFA 1MFAH 3GNMH 1B4JH 4MJID 1I1CA 4JDVA 1GHFH 5JPMA 1QYGH 3MODL 3IXAB 5EUOF 1UZ6E 4FQ1L 1TJGL 2BOCB 2ZG2A 5D7JD 1GGCH 4L4VD 4XX1E 2X41A 1U2HA 3VFSB 5IJKC 4MWFA 1BREA 3U0PB 5DRNA 5JOEA 3W0WD 4LKCB 3MLRH 3WHE1 1XIWC 3S4SA 5JO5B 4QXGH 1DBJH 5C0NC 3QUZA 2C1OA 5KAQF 2O93L 5FM4A 2CGRL 1ETZB 2F58H 3DBXA 1RK0A 4HV8B 1Q94B 5I8CB 1T1ZA 1U6AH 3PHOA 1MWAL 1WBYB 1A6VL 4LSSH 3E3QC 3Q5TA 2QKIB 5CWSB 1M1SA 2GIYA 5TDPA 1MY5A 1A4KB 4WTXA 3HB3D 4TSAH 5F9JB 2JTDA 3V5DA 3ECBB 3O8XC 2OP4H 3A0OA 2AK4B 1HSAA 3MRPB 3MRIA 4S1SL 4FG6D 1JI1A 5GZOC 3EFFB 3O3UN 3VGBA 4KK5C 4TQEL 3DX6A 4BM7A 1IEAB 2Y1VA 5CD5D 5GSRB 1KCRH 4K3EL 4OLXH 5D6CB 2RR3A 3QRGH 3Q5YA 2PO6D 4HPOH 4K7PY 2VDOL 3CPLA 3MO1A 3WDIA 4LNRA 5DEZA 1A1MA 4EI5C 4ESKA 2V2WB 3GIVB 4W81A 1R3HB 2DLIA 1KC5H 4YIQB 5IFAL 4WDIB 4WHDA 1AR1D 1T6VN 2AXGA 1TCRA 5DRZB 4ZPTA 1NKRA 1RHHA 1IGTB 1UCBH 5MHSD 2YK1H 4P2OB 4QHKI 3BP6A 5ELIA 3CDGB 5BVJA 5AWNL 5C2BH 1FBIL 4AEIH 5DHYA 4JRXD 3G6JE 4XP1H 4ODHH 3T1WA 4HS6A 4NZTH 3GRWL 2EKSA 5ADPH 1RULH 4H25A 4BFIB 3QUYC 3QFJB 3P2TA 3FZUC 3BW9A 4PFEA 4P2RD 4RNRB 5E8PA 1NAMH 1JGVL 4NHCL 1YUHB 1DEEA 5C08E 5ITFA 3DUHA 2EDQA 4KI5E 4U0RB 1VPOH 3HNSH 1X5YA 4JZOB 3IF1A 3LN9A 4XC3H 4NKMA 4PJ9A 1IGIL 5EU6A 1DP0A 5MEPA 5J1AA 5CCKL 3CGTA 4S1RH 3LH2L 3MXVL 5LGJB 4OF7A 3LD8B 5EIIA 4YHKL 3LN5B 1EEYA 3EO1A 1ZHNB 4LU5L 4ELMF 3CUPB 4XPTL 1MAKA 2R1YB 3Q6FA 2AJVL 2VL4A 5EO9A 3T2QA 4KZEL 5LAXB 2Y7QA 3IDJB 5LVEA 3QQ9D 2CIIB 3LQMA 1BJ1J 2J8UE 2VXQH 1MFDL 4PBWD 3WFEH 4P9HH 1NFIB 3BZ4A 4UT6H 4K7FA 3BEVB 1KJ3L 4LVOB 3MUGA 2DJSA 3F7YB 1LD9A 1MI5A 4X4MA 1P5VA 4PJEF 4X7SH 5HYSG 1N0LA 3FQXB 3IFPA 1I1YA 2KQMA 2W9EL 4OB5H 2P5EE 4JFQB 3D18B 2N56A 2JJWA 1U0QA 4FQ2L 5IJVA 2ENYA 4TPRH 3Q6GL 1I9JL 5ICXB 3VXMD 5L2KE 2NXYD 2EIEA 3CZFB 3GUTA 2DM2A 5DRWA 1GOHA 3VA6A 3RX8A 4HEME 1S9KC 4M8QB 3FQWA 1B6UA 4Z7NF 3D0VA 3Q5OA 3DYPA 2XTLA 2QQKH 3ZKMD 4JANA 2OR9L 2XWJB 3QEHB 2YUVA 2BSRA 5DJ2B 4PTTA 4FOMA 1QBLH 3DI3B 3X3GH 2IQ9L 4FXGA 2X4NB 4KKCD 5GRXG 1EGJA 2Z8VC 1GOFA 3PP4L 4OZHA 4P2OC 1TTGA 3JBG7 1NLBL 1N4XH 5E1AA 2NY7H 3H9SB 2BY3A 2YD9A 1FAIL 1I85C 5E8DH 4OSUH 4YDKL 2DI8A 4G8IA 3MRFA 2CLRB 4G6AD 4OTXH 2DJ4A 2XXMB 5CGTA 4JEGB 2EDBA 4RFOH 1J8HE 2R2CA 5HDBE 4MZ3A 5DO2D 2YD6A 4H88H 1MVUB 3KPRE 4DTGL 1X44A 2ID5A 1YPZA 3BUTA 4Y89A 5GGRY 5B4MD 1HHKA 3GSWA 3IDNA 2LABA 4HLZH 4U0RC 1P2CA 2DLFL 1D6VL 5HHMD 4I0PD 3LKSA 1MCWM 5ANMA 3GSXA 5IMLB 3THMH 4NC2B 4XPFL 3S37H 1XH3A 3LD8C 1YA5A 3PXHA 5IROA 2HJLB 3VFRA 3QI9A 4K8RC 5F3HA 3QDJD 5JPNA 1T03L 3RJDA 2WMPA 4Z7WF 1LK3H 4OZIA 5DF0A 3MGOB 3D39D 3ARYA 3VI3F 4CMHB 1MCQA 4M1CD 2JJSA 1JUFA 2HP4A 1WBXA 4QYOB 1MFEH 5E03A 4S10A 2HT3D 4EOWL 3BRFA 1EO8H 2NX5D 7FABH 3PWPE 2O26U 2CK0H 3PQYA 4H5SA 4PJFF 5DD3H 4XCYB 3KPSD 3O6ML 3QPXH 2AJXL 4GBXD 4G80A 1KIRA 4LVOC 4OGXH 4D8PA 1CU4H 1P4BL 3GMNB 1NJ9B 3D2UB 3B8YA 1ONQB 3OB0K 4MDIB 4ETYA 3TNMB 4YDIH 4XNXL 2QR0A 1TTUA 4HIHB 4H0IA 5T5NG 1DCLA 2A9NL 2P5WB 1IKFL 4L29B 5BJTB 4HH9A 4KUZL 2XN9D 3VXQB 5EPMA 4IDJH 3QP3A 4UB0H 2KPNA 2WIMA 1FLRH 2IFGA 1YNLL 1PAMA 4M5ZL 1KCUL 2XKNA 4NRYB 4JDTL 1MREL 4U1JA 3MNWB 5DMKA 4S0SD 2AJUL 2ZWLT 4WV1B 4RX4A 1GH7A 1PJ9A 3QQNA 3BGAA 3QBTB 4ZUVA 5TDOB 4PRPE 4V1DD 3N50A 1PEWA 3VWKB 3CFDB 1ODAA 4LP4A 5HPOA 4MDJA 1MUJB 5KS9A 4LCWE 1E4XH 5E8OB 4HQQH 1IGJB 1AE6H 5ALBL 4PJDE 1SJHB 3QIWD 1OW0C 2CMRL 1ITBB 4W6XB 1A5FH 2NY0D 1G7LA 4FMFA 4HJ0C 3FFCD 4OCYL 3RX5A 5SWSE 1GGUA 2X4SA 1HKFA 4OKVB 2DQDH 5CP7B 2M2DA 3MPCA 1YECL 4G7YL 4PJHA 2ZPKH 5BV7B 5IK3A 4F37K 1XR8B 4AEEA 3JTSA 3VRLE 4P5KA 2DTSA 3TCLA 4MVBC 4FTVA 4PJIA 4Z7UF 3MNVB 2F53D 2DQGL 2P1YA 3BOVA 5F6HJ 3RY5A 1MCJA 5GGSY 2DIJA 1S5HA 3EYVA 1E4JA 2Y23A 4MHHI 3ULUH 3QUXC 4OD1H 4XNYH 3SE9L 5LG1A 4HFWA 3T4YB 5K9OB 3MR9A 4Y4HB 3UTSA 3EOTL 2KQNA 3PP3K 4JO4H 4CMHC 3TBVB 2E7MA 4OF6A 2PW1B 5GGVY 1CLZL 2YN3A 3NA4A 4NRXA 3K8KA 3IAPA 3QPQC 1V8HA 3B3IB 2NZIA 2AJSL 1B2WH 4NQCD 5DJYA 3STZA 1VFUA 4W68A 1HDMA 2X9YA 5J11B 1UKQA 3VCLA 4QRRA 1YDPA 2R2HB 3NCYP 3IDMA 2YC1B 2KUTA 2EDXA 1S7WA 1Q9WB 3C60A 4UT7L 3RDTD 3MODH 4HXBL 3DMMA 5DVKA 1GZPA 4FQ1H 3RPKA 3MRJA 1Y6NR 2EE3A 5BXFB 2D03L 4NWUL 4ONHB 4ZDHB 3SDYL 4P5TD 1S5IL 2ZCHL 3VWJD 1WC7B 3RAJH 3BN3B 4M7LT 3IDIB 2C7UB 2PYEE 4ELKA 3GM0A 3ZSTA 3SGEH 4WCYH 5SWZE 1JWUB 2I5YH 4DN4L 3LV3A 4WV1C 2VQTA 4RIRB 1LE9B 4GRLD 4X4YB 1H8NA 1EUTA 3HC4H 3WIHA 2CGRH 2FIRT 3OAYK 3VFOB 5HHNB 3VWKC 4HLJA 1A6VH 4TSBL 2OLDA 1UC6A 1VESA 1A7RL 5AYUL 1JHKL 3HG1D 4CDGC 3AS3A 4X80L 3PUCA 1K4CB 1LP9E 2ADIB 1GPOL 5DZLA 1A7OL 3RZCB 1VADB 4HMDA 1J18A 1EGJL 5HD8D 4WY7L 4GW5B 4W6WB 4K3EH 2VYRE 1DL7H 4X6DB 3KYAA 3VU2A 1OB1A 1YZZA 4WIQA 3MBEA 5BV7C 2XQYG 3FQNA 3S6CA 5I1GL 2FH8A 5C0DA 2PR4L 5SX5H 1BFVH 3S98A 3SGDI 5FYLD 3OMZA 5D7LE 2YRLA 3ZE2F 1JHTB 1VFBB 2AEQH 4ZUTA 2KH2B 2OM5A 4QRSA 2EH8L 4I3RL 4LEXL 3OXRB 5EWIL 5CUSL 2G75B 5DJ6B 5L9DH 4JFZL 3S88L 1QA9A 5CJQH 1SBSL 2DLHA 3HR5A 3RY6A 1FBIH 2KBGA 4LLMB 2DL9A 3PWLB 3EHBC 2QQLH 4Y4HC 5J13B 5A3IC 3D69A 1FZOB 4UINH 2IEPA 1SMOA 2JLLA 3O4LB 3OL2A 1D5BA 2H8PA 3NH7L 1U8NB 2AQ3A 5I66B 5T1MA 1L9MA 5C2UB 4GRWF 1Y6MR 5ALCH 4POZC 4ZUSB 4UT9L 3RRQA 3K7UA 3MYZA 3TWCH 3O45A 5J11C 3TA3D 1OGTB 1ZMYA 3ZYJA 1IGIH 3TYGH 3U0WL 1Q9KB 3LH2H 2QSQA 3CSPA 2CKBA 3T1FB 3C5ZD 1ZA6A 4YHNB 3FO0H 3MJ8B 2VWEC 5KG9B 1P7QD 4U1HB 4XAKE 4L9LA 5DC9B 2X05A 1RZKC 1FCCA 4EDWL 4Z77B 2IPTL 3TJHD 3TO2B 4QHNB 1EAJA 5C0RL 3V6OA 5JORA 1RZIA 4JO1L 2Z91B 1FZMA 4K9EL 4KZEH 2ZSWB 5I0DA 1D5XA 2J8HA 1NCWL 4JFOB 4MJ2A 2X89D 1MFDH 1OAUH 2GK0A 5GIRB 2EYRB 5JMOC 3OX8A 5D71L 4DZBA 1C7TA 3MLWH 4DAGL 6FABH 1KJ3H 3DX9B 3RIFK 5EO0B 3WNNA 1RZJC 2OQJB 2F54B 4XMPH 4XHQA 5KJRL 2FEEI 2YN5A 4YR6B 2W9EH 3DRTA 4ORGA 4W6YB 3ZHLA 3B2VH 4FFYH 1Q38A 4M8VA 1HEZA 1N5AA 1A4JB 3RZCC 2YRPA 1IQWL 3MLUL 4R4BA 3U2SB 4XZUA 1VCAA 4Y5VB 1H0DA 1T89C 1X9QA 1CGTA 2G2RB 5BQ7A 3HAEA 2BY2A 1M71A 1BQHB 2Y5EA 2OR9H 2PETA 4KRMB 1XCQB 4C56B 1JGEA 2MKWA 4M48H 1XIWA 4F7TB 2CO6B 1R6VA 1LEKB 5F7KC 2W65B 2WP3O 2ORBL 4AMKH 1EHAA 3QDAA 1FHGA 5L0QB 3U36B 3L1OL 5CEZD 5D7IA 2EIBA 5EUOE 1CQYA 4IMLB 4JGMA 4WUUD 1JZ7A 1QFHA 5IVXA 1FAIH 3BP7A 3FHAA 1JP5A 3MCKA 1L0YA 4HW6A 3O8XA 4XPAL 5J13C 5HYQB 4C4KT 5C0GA 3C6LB 1VGKB 5KSBA 4OFYD 4N0UA 3QIBD 2X4UB 4BH8A 2C3WA 3VFUB 4GRMB 3RVUC 5E6YA 1BEYH 4LCIL 4DTGH 2BNRE 2IADA 5DLML 2Q7NA 3VFMA 3VXTA 2ZKHH 4WI5A 3KAAA 3U1SL 1LEGA 4U1LB 1FL6A 5CIPA 2DLFH 5HHQA 4EI5A 5IQ9B 4UOW1 1AY1L 3FJTA 4QWWC 4CW1B 3D25A 5ISZD 1AQKL 3NGBB 1D6EB 1T5XA 2Z31B 1EXUA 1WWAX 3DI2B 1M7DA 4HC1A 1TIUA 3U0TB 4PP1C 4Y1AB 1ZA3A 5EC1A 3UAJD 4KHTL 4S1DC 3PABA 5DQJA 3CH1A 3HFMH 4G8GB 4M7JH 3TFKC 4M02A 1W0VB 2ITDB 4PP2A 4U1MA 5BS0E 3S35X 1NCDL 3AS1A 4ZTPL 4XNZB 4J1UB 1B4RA 4APQD 2W0KA 5B21A 4MD5A 4H20L 5EBMB 3IU4L 3QUYA 2YXMA 3PG2A 1DEDA 4MQ7A 3QJHB 4Y0GA 4F9LC 4PJAB 1YN7A 3O6MH 5FYKL 5DSCB 5HGAB 5M94B 2XNAB 4RGMB 5JXEC 4E5XA 3HE7D 1IL1A 3ULVD 1JIBA 4BZ1H 4F9PC 3BO8B 1UB6A 4Q6YA 4XNXH 2FHBA 2HFFB 5C07B 2R56L 2Q7YA 3LEYH 3WIHL 4G9FD 5GGSA 4KUZH 1WZ1H 1FYTB 1HXMB 2XI9A 2BOCA 4FQXB 1YNLH 2EDOA 1KCUH 4Y5VC 1MREH 3SGJC 2GSGA 2D31B 3BPOB 3VFSA 1F4YH 3U0PA 4J4PD 2DQHL 1MFNA 2AJUH 3TN0B 3DHJA 1S78D 4PJ5E 5ITBH 4BKLB 5KVEL 3FQTB 3FCTA 4L5FH 3WNPA 4ZFOA 5JO5A 3S36H 1G9MC 4XRCB 4Z95H 2WK2A 2B0SL 1KF9B 4JM2D 4Z5RB 5L0QC 3FB8B 3GI9H 1ETZA 4HV8A 1Q94A 5I8CA 2EXWC 3OGCB 2HT4D 1OAYH 2QKIA 5CWSA 2R2BB 4ELME 1YC8A 2Q1EA 3LPWA 1YMMB 3L3OB 4L8CB 3QUZD 3ECBA 3QZWB 4U1KB 4OCYH 2EDHA 1IAIL 2QADD 4OGYL 5DTFB 3C6LC 3H0TB 3MRPA 4ODVL 3D9AH 4ODWB 3EFFA 4HS3B 3QSKB 2J12B 4G7YH 1TFHA 1IEAA 4WI8A 3IXTA 5GSRA 5KN5B 4UU9B 3AU1B 5D6CA 3BHBB 4CGTA 1A6ZB 5DJXB 1RZ7L 5DFWH 2R1WB 1DFBH 1C5CH 2E7LC 5ICZB 4UZGA 5SWQB 2WLYA 4PPTA 2ADFH 3IKCB 1BZ7B 4YXKL 2V2WA 3GIVA 1R3HA 1NGWB 4TVPH 3AC0A 5EOTB 4OKDA 4PJEE 4YIQA 2ICES 3NGBC 4WDIA 5EB9A 2Z31C 4XPBL 5IBTH 4JRYA 5IHLB 3GEWB 5DRZA 2BVEA 1IGTA 4P2OA 3U79A 4G6ML 3O2WH 2C4FT 1KGCD 4L3EA 1F90L 4QHLA 2EYTA 3CDGA 2O5XL 2D4FA 3LN4B 4TNWF 3IJSB 2D0HA 4NQSB 1KTDB 3KXFD 4ODTL 3BDYH 4Z7NE 1YEIL 4XNZC 2CKBL 3C6SA 1A7PL 3LIZL 4TTGA 3SJVB 3P4MA 2CK2A 4P59L 5JW3L 1GGIH 2I60H 4TVSa 2AJSH 4RAUA 3GHBH 2MTPA 4PJBB 4BFIA 1RIUL 2CJUL 4UIKL 3ZDYF 5BO1L 3QFJA 4ENED 3GSRB 4LASL 4CMMB 2R9HC 1NBVL 4RGMC 2N4IA 1YUHA 4OLEA 1VACA 1X5JA 1F97A 4M43L 1CXHA 4M62H 2SEBB 4UT7H 3RL2A 4JZOA 4XAWH 1IARB 1T0NB 3FN0L 2HMIC 1WT5C 4NWUH 1NPUA 1S5IH 2ZCHH 2BXZA 3IJYB 2JIXB 3IDGB 2HJKA 5LGJA 1C16A 4FQXC 1QEWB 1H3WM 2Y25A 3U4EB 5IMOB 2VC2L 3BPOC 3LN5A 3EJZC 1ZHNA 2FX8L 3CUPA 3RIAF 3TN0C 1CGVA 5MENE 2R1YA 4ONGL 4PJ9D 3MV7B 4X7DC 1IGYA 4RGNE 2FLBT 5LAXA 4CU8A 3IDJA 5CP3A 1DBBL 3BXNA 4PRHD 2CIIA 4AEHL 5JTWA 1CLCA 3WE6B 4UV7L 2AKRB 5AYUH 5CEYB 1IEBB 4JKKA 5DJ8A 4K3DH 3GSNH 4X80H 2WWKO 1NFIA 3WXWH 4NO3B 4YEFA 2X4RB 5C0CE 4QOKE 1GPOH 1A7OH 3UJIL 1ACYL 3WNKA 3F7YA 4Z7WE 4HWNA 1MJJB 4PYHA 3FQXA 2FJGB 1DBAL 4HKXB 3VI3E 3D18A 2D4DA 3QUMB 2VJXA 1I9IH 4OLUH 1MCIA 4LOUC 1BVKB 5ICXA 1LMKA 4KVNH 3HI6L 5HDLA 1UYWL 3U7YL 4AIZB 4OD3L 3F12B 1NC4B 3SGKA 3IAQA 4M8QA 4PJFE 4NN7B 4M7LL 4UQ3B 3W2DL 2XWJA 3VMPA 3CZJA 3SDDD 3KLHC 4HS8L 2DI9A 2X4NA 1K4DB 2WQ8A 4JFZH 3S88H 1U8IB 2I9TA 5KSAD 1SJEB 5CGYD 3FOLB 4NSKA 1LILA 3VFGH 2V9QA 4KFZC 3ORJA 3HZVB 1HWHB 3QWQB 4RQQB 3KJ4B 4G43B 1EDQA 3M8OL 1OW0A 1IAKB 5FYJU 2Y72A 3HE6D 3TH2T 1I3RB 1WTGT 3OBAA 1ERNA 3DV6B 1UEYA 3QEQE 4HC1L 1V3MA 2HLAA 3SOBL 4Z6AT 4JKLA 1LVEA 5BW7A 1MVUA 5FGBA 1DN2A 4I9WD 4NPYA 5GRUL 4ZYKB 1DUYB 1HH6B 3E6HB 3EO0A 4OV6F 3U0WH 3KPPB 3RVWC 2EE6A 3DUSA 3E1F1 1ZK9A 5BOZG 2FX7H 4NKQB 2BVYA 3PHQB 5E24E 4LF3A 4DGVL 2Q87A 4JG0L 3EYSL 1YNTA 4EN3B 4PLKD 1PG7L 1A6UL 2G5RA 4LHQB 5IMLA 1S7RB 2IPTH 4N0FB 3FB6B 3ZTJG 2UVEA 5TE7L 4Y4FB 3DGGB 3MRKA 2XTJE 2EECA 4QRPE 3NFNA 1ZSDB 1F3DH 4K9EH 1YEKL 3MGOA 1AO7A 3MV9B 2KDGA 3OB8A 3L5HA 3EZJB 1JMXA 4QYOA 4Z7UE 1U9KA 1RUAL 1W8OA 4JKMA 4FQCL 3G08B 3O6KL 4GAFB 1S7SB 5E4EB 1ZLSH 4D3CL 2IC2A 5KJRH 2FYYB 2WUCH 4ZAKB 5GGVL 3ARUA 3QCUL 4OZGF 4ZFOL 3ARDD 3GMNA 3TH3T 4F15B 3D2UA 4MDIA 2E8ZA 3TNMA 1NEUA 5EFIB 3MLUH 5DVMA 4HIHA 1XF5B 2P5WA 4L29A 4LLDB 3OAZH 1K9TA 5GISL 3VXQA 3PQYD 3AGVA 2G9HB 3FN9A 2IFFL 4X9GA 1IAMA 4WI9A 4NRYA 1IM9B 1W0YT 2Y6SD 4NNYB 4PLJD 4NN7C 1BIIB 2BNQE 4WV1A 4C54A 5EOCJ 5I1KL 5MERB 4OGZA 3V0AC 3T0XA 3MLVH 4IMKC 2FJHB 1LWRA 4JFPB 3VWKA 3S3SA 1UQSB 3DVIA 3CMOL 1E6JL 2W0LA 5E8OA 3P4OB 5BRZB 5F93C 4HPYL 4OM0H 1IGJA 3QULB 4KMLB 3QDGE 4XPAH 3KJ4C 4NM4L 1SJHA 3SDAD 1BM3L 1BJ8A 3FRPG 2A6JB 2WBJD 4I48B 4B7IA 3IDXL 1YEFL 1WGOA 4LCIH 3MLZL 5CKAA 4KK6C 4L3CB 2VE6A 4OKVA 5CJBA 5DLMH 2CDGB 5EZOL 5FGCE 2CDFB 2EDNA 5CP7A 4WI6A 1T04B 4LPTA 3FOMB 1X6NA 3U1SH 1RVFL 1BFOB 1XR8A 5C3TA 4FQIH 1AY1H 1OSPH 1NEZB 1AGBA 3WIFA 3GSUB 1A7QL 3ZHDA 5DEFB 4O00A 1XGRB 3MNVA 4ZO6A 4EN3C 5D2NB 3L5JA 2H2SC 4K7PH 4DGIL 3CCHB 1MAJA 1UH3A 5DMGD 4WFHE 4Y4FC 3BH9B 3CX5K 5L2JB 2QQNH 2WBKA 2VKXA 1QLEL 1A22B 1QOKA 3T4YA 4AQ1B 5K9OA 4Y4HA 2XT1B 3MV8B 1DVFB 3RUGB 2G60L 1CGXA 4MLIA 4MQXD 2J6EL 3TVMA 4OFPA 2VABB 3ZE2E 2OI9B 4NOFA 4BH7A 4GW1A 1DLHB 1NUGA 3PWNA 1VGEL 5FYKH 3LS5H 4K8RL 1JPST 1DANU 1MH5B 3QA3B 3R0NA 2ICWJ 5E4EC 3UYRH 4MA3B 1CR9H 4X0KB 3MRCB 1JNLL 1J1XL 4ZAKC 2R2HA 4NJ9L 2YR3A 5F72S 1CS6A 2YC1A 5SX5K 5D7KE 1Q9WA 3WIHH 4Z7VF 4F15C 3ROLB 4XBGA 3PF2A 2ERJB 3A6CL 4B0MM 4ZSOB 5BXFA 1XGQB 4ONHA 4YDVB 1A2YA 4ZDHA 3MFFB 4H8WH 2DQHH 3KR3L 2VLJE 4Y4KB 1WC7A 4QRRD 1ZHBB 4GRWE 3IDIA 2EXYD 3LSOB 5KVEH 5E99L 4PRID 3K4AA 1U2CA 1JV5B 5T3XL 3DMMD 5CFHA 4RIRA 1LE9A 2B0SH 5K9QI 4JCLA 2ZNWA 5FEBA 1OP3K 4MXQC 1F02I 2PYFB 4X4YA 2YUWA 4ACPA 5EORH 5D1QD 4HWUA 4KI1A 3VFOA 5HHNA 3L7FB 5JIIA 2A73B 4X98B 5IG7A 3GKZA 4JREB 5GS2D 1UH2A 2ADJA 3IVKB 1K4CA 1PKOA 4NQED 1IAIH 4Z76B 4OIBA 2ADIA 1L9NA 4G42A 4ODVH 1JNNH 2BVPB 4CAGA 4RWHA 2C3HA 3O9WB 1UM4L 3QJFB 4N0YH 4NO0B 4LLUB 4Y19B 3RKDC 1EZVX 1MIEH 4IHOA 4GW5A 5CBEB 3MBXH 5DMIL 5SV4A 3KS0H 4PJGF 4X6DA 4BFGA 1RFDL 1BBJB 3MUJA 4QXWA 2OYPA 1AXSB 5ID1B 3DO3A 4MNQB 1PZ5B 4KAQL 2C3VB 3HCVA 1T4KB 1YNKH 5ABDE 3VD4A 4FXLA 1JHTA 1VFBA 5D2NC 5D2LF 1H8SA 2X4TB 2DB8A 3ALPA 3G6DH 4WWKD 3G5YB 3OXRA 1A3LH 2G75A 5DJ6A 4OLVL 4ZFFB 5CEXB 3SKMB 4LLMA 4WUKL 4YFLI 5FUZL 3B9KD 4ODTH 3PWLA 2UY7A 3BFOA 1YEIH 5HHOE 1T2JA 1DVFC 3UTTD 1FZOA 3L3GA 1EHLL 2ATPB 5KVDL 4LGRB 4KKNA 2OCFD 3WKNA 1JYNA 3O4LA 4UIKH 1U8NA 5BO1H 1T7YA 2OI9C 1HHHA 4PY7B 4XWGH 4XNMA 5I66A 1I3VA 4PJXF 4LASH 2DQEH 3L9RB 4ZUSA 2I07A 3BKML 4E41D 1NBVH 4LKXB 1Q9OA 3LOWA 2EDKA 1OGTA 2V7NA 3CFBB 2JK5A 1F2XK 1T0MB 4JG1H 3PXJA 1NBZB 2EE9A 5CILL 4MJIE 2ERJC 3BWUC 3T1FA 1PW3A 4YHNA 3MJ8A 4Z0XB 1N3NB 4U1HA 1J12A 2VC2H 5FGRA 2FX8H 5DFTA 4Z77A 5J8OA 5K9KB 3QHZL 2F8VA 4UNVA 4Y4KC 4PB9L 4L4VE 2EDFA 4MA8H 3IS0X 2H41A 1G6RA 3IFLL 3W0WE 2Z91A 3L3HB 4LLYB 4P5MB 4O51A 3WLBB 5HTSA 2ZSWA 4JFOA 4HWBA 5GIRA 2EYRA 3HAEH 1S9XB 1K2DB 1QVOA 4J3SA 1CI5A 1UZ8B 3E6FB 2XG5A 4S1QL 2FR4A 5EO0A 5J3HC 2OQJA 4JREC 2F54A 2DWEA 4UDTB 5EA0H 1FO0L 4F9PA 1KPUB 4Q9BA 4YR6A 3O6LH 3T65B 5GSVB 3ZYZA 3T8XB 3B4NA 2V9TA 5C0EB 1XFPA 1A4JA 3O9WC 4JKPH 2AEIT 4BSJA 4O02H 5I18L 3HI6H 1UYWH 5JQ6H 5DJAB 1R5WB 3CX5J 1GGBL 2YD2A 3WXVL 4KMTL 2ATKA 4QGYA 2VN7A 4M7LH 3WDHA 4PUBL 1U3YA 3EYOB 1JGUL 1XCQA 4P3CL 4FFZL 4S2SB 4F7TA 1PLGL 1OAKH 4HS8H 5F7EL 3V2AR 4LL9A 2W65A 1N64L 4XP5L 3U36A 3VXSE 2V7HA 4ZFGL 1JVKA 1NH6A 2X2YA 4IMLA 5BV7L 5CIPH 4OM1H 5MHSE 3I9GL 5F7DB 3ULVF 2IGFL 2HKHH 1XIWD 1JWMB 1JPTL 2R39A 4DVRL 4RFEB 5HYQA 3SOBH 3MZGB 1VGKA 1KYOJ 1WICA 2X4UA 5I74B 1TMCB 3LKQA 1I75A 3VFUA 5CZVH 2BRRL 1OF2A 1C5DB 4XC1L 1UWGL 4R4NC 3FO9B 2A38A 4LARL 3TLRA 5F7FA 5AZEH 1KPRB 4P2RE 5EIVA 1DQTA 1LK2A 1G7MA 4P9ML 3O8XD 4DOHE 2E7LA 1MJUL 4N0RA 3TIEB 4DGVH 5IQ9A 5GQBA 5GZOD 1PG7H 1A6UH 1V7MH 4CW1A 4KQ4L 1AP2B 1D6EA 2Z31A 1J7VR 4KK5D 1CZ8H 4Y1AA 4L8BA 1U41A 1YEKH 4RMSA 2DD8L 3OXSB 4LQ1A 4UQ2A 4EZMA 4G8GA 1FQ9C 1A1NB 1W0VA 1R3KB 2HH0H 4LBEB 4W4OA 3UBXG 3ARSA 3H3BC 3SO3B 3W39B 4BQ9A 1QSFD 5C08D 3TPKA 4KI5D 4J1UA 4D94A 1BX2B 3BYYA 2N7AA 2IH1B 5DZNA 3QWRD 4X9HA 5HXMA 3RI5F 5EBMA 4R96B 3GHEL 2AK1L 2MPAL 4G8FB 1NBQA 3BIBX 3MOAH 4D3CH 5C6WH 1YEJL 4BSVB 3QJHA 2NTFB 5DUBB 1RV6X 4PJAA 5DSCA 5EDXA 5GGVH 15C8L 3B83A 4OZFA 3UX9B 2Y06L 3BO8A 3CDFA 1OLZA 1KULA 4HCRA 1JGDB 1HILB 2HFFA 5C07A 1K8IB 1P53A 3BZDA 4N1CA 4P9HC 5GISH 3NAAH 4U6XB 2YWZA 3QUYD 3FZUD 2DMKA 1ZT1B 3VXME 1T22B 4U1IB 1RZJL 5D5MB 3ZDYE 3TN0A 3RNKB 2A1WL 3QO0A 1V3JA 4BKLA 3FQTA 4M6AA 4K2UL 4NGHL 3K4DA 4PREB 4XRCA 8FABB 4LSPL 3BP4B 3HNTH 3LKNB 1E6JH 3FB8A 1JWSA 1ZTXL 5L2KD 4NQVB 3QQ4B 1H8OA 1RAMA 4NM4H 5DUMH 2R2BA 1BD2B 4OF0A 2CUIA 1YMMA 3OR6B 3L3OA 4L8CA 1T6WA 2YPLB 2VLKA 4XTRC 3PHSA 4M6OL 3IDXH 1YEFH 5T1KA 3X14B 5DTFA 1GZQA 3WS3B 2E3VA 3L3JB 2WIIA 4YBQC 5EZOH 1QFPA 4ODWA 1AGDB 5I74C 4HS3A 4Q7DA 2QLVB 3V4PL 1J0JA 1OTSD 4B7LA 5J1SC 4ZQKB 5KN5A 5BZDB 4UU9A 3TT1L 3BHBA 1I1AB 1WBZB 4EDXA 1OT1A 1A6ZA 5DJXA 4HKBB 1SYSB 2R1WA 1IBGH 1CD0A 2AK4D 5SWQA 3WN5B 2VIRA 4HDIB 1RZFH 3IKCA 1J86A 2DTML 1NGWA 4PY8J 5EOTA 4R0LB 4DGIH 1I9RL 1BAFL 3FONB 2MCG1 4URTB 1QLEH 3IFOB 2R4SL 5HDQH 1WCBB 3KPRD 3SE8L 2IWGA 3QDJE 4CBPA 2BFVL 3LN4A 3IJSA 1UXWB 3BWAB 3SO3C 4MAYA 1KTDA 4Y5XB 5F71A 3D39E 3M07A 3VXNB 4F7CB 2J6EH 3Q3GB 1FIEA 5FV2A 3SJVA 3FTGB 3VXRE 5E5RB 1E4XI 3VE0A 4PJBA 5FM5M 1M7IB 3GK8L 4KMQA 3GSRA 1G6VK 2NX5E 1QLFA 3K2UH 1CG9A 1G6RL 4NJ9H 4CMMA 3EDKA 2H1PL 5DWUH 3D3VE 1FFQA 2DQIL 4RA0C 2SEBA 1FVDA 4LHUD 1T0NA 1IFHL 1LQSR 1OTUC 2GFBB 2X7LA 4HWBL 3LS4L 1AFVH 2JIXA 3IJYA 3IDGA 3KR3H 3PIQB 4NCC2 4RDQG 5E2UH 3T0EB 4R2GB 1QEWA 3DXAB 3OZ9L 2XQYK 4YHOL 5IMOA 3U4EA 5E99H 3X13B 5T3XH 3DOSA 1U8MB 3P9MB 3MV01 2K7PA 3WV0A 1T1YB 4LQFL 2DF3A 3MV7A 2FD6L 5JIHA 3HZMB 1DUZA 1RD6A 2XY2A 3P0YH 1R0AL 1CYGA 5F9DC 1S9YA 3A6OA 3QEGH 4OZHF 3WE6A 4V1DE 3IJHB 4MAUL 2AKRA 4K8RD 4ERSL 3K1DA 4JJ5B 5CEYA 3GIZL 1U8KA 2WNGA 4PRBB 4UOJA 4NO3A 4S0TD 2X4RA 4TSCH 4XCNA 1EA9C 3VGHA 3DLQR 3EO9H 2IAMB 2NY5C 5MP6H 5C9JB 4JFYB 4OLWL 2E7BA 3U7WH 1G9ML 4JO2L 2FDBP 1QD0A 4JR9L 2NLJA 2FJGA 5I71B 4HKXA 1G9NH 2FLRT 3QUMA 5DMIH 1P6FA 4DKFH 3FFCE 1BVKA 1YPZF 3QFDB 5TF0A 4C58B 1AGEB 1RFDH 4BFBD 3CVHH 4R90H 5BMFL 3EDDA 3GJEB 3Q1SL 1IT9H 4NNPH 4AIZA 1I1AC 4KAQH 3MJ7B 5C86A 1NC4A 1WWBX 2Z4QB 3SCMD 1Q9LA 4MQSB 3IRZA 3WDJA 3F62A 3WN5C 4FFWC 4X5WB 4I18B 43CAA 4OZGE 5HI4D 2DICA 1A6WH 3HRPA 1YC7A 4R0LC 4XNUL 4IMKA 3LMJH 5EIQA 3ARWA 1K4DA 1WFNA 2F53E 1R3LB 5SWSD 1U8IA 1NGZB 2P8MB 1SJEA 5JDJA 2A0LC 3FOLA 4OZIF 3GMMB 2XXCB 4JQXC 3SGEI 3TNNA 1LO2L 2CH8A 1DLFL 4HIXL 4G43A 4RQQA 1U3JA 1XF3A 4L4TE 1HSBB 1EHLH 3HC3L 1FAKT 1IAKA 4Y5XC 5KVDH 5M95B 1I3RA 4XH2A 3ULUC 2OR7A 4NQXB 3FT4A 3DV6A 4X6CB 4Y5YB 1F2QA 4YZFF 3OAZK 3VH8B 1Q1JH 4G7VH 2MKLC 2AJZB 3CVIL 5E6ZA 2E9BA 5I30H 2Y9RT 4XMLL 3KGRA 1RIHL 4YFDB 4LPWA 2F5AH 4UIMA 1UVQA 3H9SD 4P46B 1DUYA 1WLHA 1DQJB 4MNGB 4NQCE 5DC4B 4DQOH 1HH6A 3E6HA 1FORH 5HHPA 5FO8B 3ZE0F 3KPPA 2MWCA 1JFQL 3IKKA 4WHYH 4K3GA 1TVHB 4UBDC 2F8XC 4HJ0D 2YZ1A 3CFCL 3GBLA 3G5VB 3PHQA 3ZKNC 4Y16B 3V9FA 5B8CA 5F89A 4NQDE 3VG0L 4HUUB 2PUQT 2O61A 2GJ6B 4N0FA 3FB6A 1YYML 5EU4B 3T0EC 4R2GC 1D9KD 2VNCA 4PLOB 4Y4FA 3DGGA 4RDQF 4WI4A 3IFLH 3BPCB 2HVJB 3QUKB 1JTTA 4BELD 1A1OA 4MVBD 4XCEB 4MD4B 1VEPA 4HCRL 4G6FB 1Z0NA 2FBJL 2B1HH 3T3PF 3BMWA 2VAAB 4NCDA 1SMAA 1T7ZA 1AIFB 5T33L 3PNWB 2ZOKB 5IBUG 3QUXD 1ZE3C 4LSTL 5DA0B 5D1XB 1A7BA 4BZ2H 5IVNA 3G08A 1S7SA 1FO0H 1DBKH 1FPTL 2FYYA 2ZUSA 3ME0A 3HG1E 1IGCL 2PYED 2IAMC 2ZZUT 2COQA 3MOBH 5SWZD 1MLBB 5GZNC 1RUKL 5I71C 5EFIA 4ISVA 4KTYA 2X1PA 1UWEH 4LLDA 3OAUL 4K3JL 3RVVD 2ZUTA 4ZOAA 2G9HA 3GSOB 3WXVH 1RSFA 1A7NL 4KMTH 4QLRA 3RWEB 1NCBH 1IM9A 4R97B 1I3GL 1EH9A 4NC0B 3DX8A 1P4IH 1DSFL 1PLGH 4JQIL 3CH8A 4X7TB 5F7EH 1BIIA 4PJIF 4BUGA 1KLGA 3FO2B 3V0VB 4P23D 4I18C 1Z9SA 1N64H 4XP5H 4JAMA 5MERA 2AEWA 5FYLE 4Z7VE 4GQ9L 2FJHA 4TRPH 4JFPA 3W11D 1KENL 4TNWK 1H9VA 4ZFGH 5HYSB 4GMTL 1UQSA 1FFNB 5BV7H 2A74B 3B43A 2IGFH 3L3DB 3P4OA 5BRZA 5GHWL 2J2ZA 3U9PH 3QULA 1TLKA 2JCCB 5TE4H 4GG6B 4OCRL 2Q6WB 2VZOA 1W0WB 2A6JA 1XF2B 2AXJA 1JMZA 4Y5YC 3FQUB 3P73B 1ZLVK 4L3CA 2DLGA 2CDGA 3MCG1 4M6MH 5DT1L 3SQBA 1QSEB 2CDFA 1FNEB 3FT3B 3VFVB 3PGDA 3FOMA 5DJZB 1EMTL 2XKSA 4P46C 4X6BA 1Z5LB 1A6TB 5FDYA 1BFOA 4Q6IB 3WFBL 1I8KB 5IVZB 2J88L 2BRQA 1NEZA 1M4KA 3OJVC 5CZXD 3W82A 3GSUA 4G6KH 4Y16C 3I75B 1XGRA 4WEBL 4NP4H 1INDL 3CLEL 5D2NA 2QJDA 3OKLA 4OIAA 4XX1G 4UILH 3CCHA 5DUPH 1QRNE 1PKQB 3KPLA 3BH9A 4PJGE 2GJZB 2BHZA 2XY1A 1Z6JT 1T83C 4JFFB 2XIDA 2GT9B 4ZNCD 1F4XL 2GTZB 3MV8A 5F1SA 3RL1B 1DVFA 1I4FA 4X7EC 3ZKXC 1KUMA 2DN7A 3O2DA 5SX4H 1CWVA 3EDJA 2VABA 3N85L 5C09B 4I4WB 4KZDL 4JN2A 3SDXB 5JPMB 1FSKB 1Q0XL 5D1XC 3LKRB 5D2LE 2CXKA 15C8H 1MH5A 1RUML 2JJUA 3QA3A 1FH5L 2K3TA 3EHBD 4MA3A 1T80A 2HVKA 2Y06H 3MRCA 4BQBA 3K1KC 3UZQA 1WEJL 3WS6A 4MWFB 1ND0A 4FS0A 3H9HB 4N0CC 5BVPL 3ROLA 1J1OH 4MYWB 4ORZC 4MB3A 4OGAC 1CLYL 4PY8I 4QRUB 4MS8C 4ZSOA