2MCTA

Nmr structure of the protein zp_02042476.1 from ruminococcus gnavus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
102
structure length
102
Chain Sequence
GSPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein ZP_02042476.1 from Ruminococcus gnavus.
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 13
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.320 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2mctA00
2MCTA
chains in the Genus database with same CATH superfamily
1VBHA 4YQWA 3GIIA 1HR0H 1FJGH 2I87A 4DUYH 5EWGA 3RAQA 4ED1A 4JV0A 2XCAA 1JDEA 4K0KH 5LOVF 4F50A 4ECWA 4LFBH 1XNQH 1WCMG 1JLLB 1JDBB 2I80A 1WCMA 3Q2OA 1S97A 4A2BA 1S0MA 4F4YA 4QWCA 4KHPH 5IYDG 2IBKA 4O3OA 2YL2A 1KJQA 2QYZA 1RK6A 3HKZE 3N6XA 4WD3A 2R92A 2R87A 4ZI7F 5KT3A 3OSPA 3GV8B 2UUAH 4FBUA 3PR4A 4UCOA 4GLXA 3IG0A 2FMAA 3PO3G 4NXNH 4EG0A 4O4LF 2W9CA 3EYYA 3N8DA 3PW7A 2VQFH 4IRKA 4EBCA 3AYHB 3QZ8A 3L4JA 5KG3A 1I94H 2W6QA 3FDSA 2UUBH 4HNUA 2HJWA 3M9OB 4TV9F 3RUPA 4JI5H 3GIKA 4ECSA 1XMOH 2FB9A 3PR5B 3MFHA 2V9WA 4RB0A 3BA9A 1OWTA 3T5LA 1SFOA 2R92G 2RDIA 3FKIG 3K5HA 1FVIA 2AQ4A 4C2MA 3HOVG 1JKJB 1K1QA 3RB6A 5KT6A 2PVPA 4O3PA 2WE6A 4QJFA 2E5LH 1N56A 2W9AA 1BNCA 5KG6A 4BWSC 4YHHH 4JV2A 5C4XG 4FU0A 3MR3A 2VA3A 2YZMA 2VOBA 1Y14B 4MA0A 2R8JA 3C0FB 5C3EG 4QW8A 3VPCA 4JI0H 3T5HA 2UU9H 2XIGA 2R7ZG 3NGDA 4ED2A 3GTKA 5C5JA 1M0TA 5KT4A 1JX4A 5KG2A 3G6YA 4RUCA 5CAEB 3TINA 3H4BA 1E4EB 2R84A 3MJFA 3BQ2A 3UQ8A 4GKKH 5KG1A 2ZJTA 4LSAA 1ZHSA 5JVDF 5JVLA 2NU9B 1V4YA 4IR1A 4A93G 1L2ZA 3L4KA 2R7NA 4DL4A 2ASLA 4PWQA 2W6OA 2O03A 1TA8A 1TWCA 1WSCA 4YR3A 1GSAA 1RYSA 2V59A 4O3NA 3RAXA 1B04A 5KFBA 4DV1H 2WDTA 4MV3A 1N48A 1EUCB 4DL5A 2E2IA 1XNRH 1TWHA 2ZDQA 5DG7A 4J9RA 2ALZA 2FLPA 3I4NG 2Y0SA 4EBDA 3RBDA 2C2DA 1HNZH 1XDNA 5CA0F 3V6JA 2JEGA 1N32H 1TWAA 3H3VH 1IBMH 5FPOA 5HV6A 4A3CG 1ZETA 2W7PA 4JI7H 4LH6A 2JA7G 2R93A 2XGPA 2R93G 3GTMA 2IMWP 1I6UA 5EOYA 1VAJA 4A3EG 2FE3A 4YY3H 3OUUA 4NXMH 1IOWA 4QWBA 4WBNF 5D8DA 2IP4A 3J80W 4A3JG 4I55F 3KTMA 3PVXA 2YZGA 4UFZA 3RB0A 3G8CA 2C2EA 2W9BB 2FLNA 4NLGA 2J6SA 2B63A 2HGSA 3UFXB 4MV6A 3EPIA 2WB1E 1Y1WA 5C44G 3H40A 4RNNA 4IHJF 2W8LA 3RJ0A 1A0IA 3GTJA 4MV1A 4JYAH 2VQDA 4LH7A 2UVUA 1Z2NX 5IP7G 4RZRA 4ZQIA 2FLLA 3GQCA 2MCTA 5GONF 5KFEA 4LMYA 2ZM6H 2VUMG 5IYBG 1VBGA 3RFCA 5LMUH 3FKIA 1KC7A 4J9MA 3ORQA 2WTFA 5KFTA 4O3RA 3GTLA 4L1KA 3JSLA 3EPGA 1WR2A 5IP9G 3PW0A 4O3SA 3RV3A 3V4SA 3WO1A 2J6UA 4JUZA 4UCUA 3TQ1A 3I12A 1IBLH 4FM9A 2R8IA 2ASDA 4X65H 1JIHA 3QFFA 5DG8A 3BJYA 2JA6G 3PO2G 2R7LA 2WYOA 2PMZE 5BPFA 1N36H 2VA2A 4X62H 4DV2H 4ED8A 3HOYG 2SCUB 4J9OA 5KFNA 2W6PA 4QIWA 3PW5A 2DLNA 2R8GA 3QZ7A 1SCUB 4RAYA 2QK4A 3RGZA 4J9NA 2RGVA 4R8UA 1K83A 4DL2A 4O2AF 5KFWA 4JI8H 4JI3H 4A3FG 4J9PA 3LMLA 4Q8EA 1N34H 4JI6H 5D1OA 4FS1A 5KFLA 1CQJB 3GV7B 4TUYF 4QWAA 4BY1G 5A2QW 2W71A 1N33H 2YS7A 4C5AA 3V6HA 2NVYA 2FK2A 5JH7F 3KAJA 3VMMA 4DR2H 2UUCH 2OH2A 3H0GG 3N41B 1CE8A 2W9CB 4ECVA 2RGRA 5EWFA 2HVSA 2R7ZA 4IWXA 4DV5H 3ETHA 2W70A 4APMA 4MTEA 1EUDB 1EZ1A 4EYHB 1FKAH 4LF4H 2XCPA 5KFQA 4G3IA 3OTOH 5KG7A 2W7OA 4ECXA 1S68A 5C8YF 3GIJA 3LP8A 4YJ3F 4ZOLF 3KHHA 2Y0SE 4HYKA 1UC9A 3MR6A 2JA7A 3RGXA 2HHHH 4JV1A 1I3QA 1ZHQA 4LF7H 3HBLA 1B6SA 3MR5A 3N44B 5LA6F 2C2RA 1Y1WG 4J9SA 5IYZF 3JSNA 4EFEA 5J2TF 2NU6B 3RBEA 4DR4H 4RAZA 2FKLA 3JRWA 2HVQA 3R5XA 2DPIA 2VUGA 1DV1A 1TWFA 3BQ0A 4DV4H 1R9TA 4EGQA 2ZDHA 4JV5H 1M0WA 5LL6b 4AQYH 4MV8A 4HNVA 3OUZA 3ORRA 5KG4A 4B3SH 4ED3A 1CS0A 1KJ9A 4M9UA 4DUZH 2CKZB 4FS2A 3GIMA 4AYBA 3BAAA 4EFBA 4ECZA 2W6NA 4BXXG 5KFUA 3PW4A 3VPDA 4A3DG 5FLXW 1GGOA 4IAJA 4XYMB 5KFAA 3U9SA 2C28A 5CB4F 5LP6F 5IWAH 4TQRA 1GSOA 4HQ6A 1GYFA 5BPHA 2W6MA 4B3MH 4R8UB 4RB1A 4AYBE 4GKJH 2FPIB 3V4ZA 5DGAA 5KFVA 4EBEA 4O4IF 2UXBH 2YCHA 5D1OB 4QWDA 5FD5A 3JAMW 5KFSA 5KKNB 2DIKA 3H4DA 2W6ZA 4BY7G 4ETSA 1RJRA 1S0OA 2YRXA 1IOVA 4YB8B 2PMZA 3MWMA 3H0GA 4B3RH 2NVXA 1GLVA 3Q8QB 4YR0A 2YU9A 4RNMA 1DGSA 4O2BF 1S0NA 5L9XA 2DWCA 4DLKA 3GLKA 3TIGA 5EZYF 5JUMA 4J9LA 3T1HH 2J6TA 2XCLA 1HNWH 2R8KA 4ED0A 5KFYA 2XD4A 1B6RA 4LF5H 2GPSA 3HOUG 4A3IG 3RB3A 4Q8FA 3HOXG 2UVRA 1MZBA 3RTXA 4TV8F 5F9LA 3GTPA 3K3VA 1GO3E 4DR6H 3G6XA 4I7HA 4I50F 1GSHA 1E4GT 4C5BA 5DGBA 1V51A 2ZDGA 4MV4A 1I7NA 5FJ8G 4Q44A 3BQ1A 5L1KA 4RB3C 4DL3A 1K1SA 4MTDA 1RK5A 2CW7A 2RF4A 3OHBA 3DF7A 4GC6A 5FLMG 3PW2A 2PBZA 4RZQA 4JI2H 5KFOA 4DV7H 3T5JA 5BR8H 2X0SA 2YZNA 2NU7B 2PN1A 3GIQA 5C1OA 2VQEH 4E4TA 4XYLB 2B63G 3RV4A 4ED6A 4A3GG 4HR7A 4X64H 2Q2TA 3F8NA 3N43B 2BR0A 4DR7H 4IZOA 4XZ3B 3V6KA 2CQYA 3GTOA 3HOWG 4RUAA 4QIWE 4EEYA 2YYAA 4A3MG 3R23A 5DLFA 4Q45A 1VS0A 3T5KA 1X9NA 1S03G 1I7LA 4Q43A 4JI1H 1E4EA 3CQZA 5L1LA 1I50A 4GC7A 5DQGA 4IRDA 3HOZG 2AGQA 2JA5G 4OX9H 3GV5B 5EWEA 3IN5A 1KEEA 3Q8SB 1T36A 3KHLA 5K2MA 1M7JA 4DR1H 3RIZA 1ULZA 2DPJA 3N40P 2P0AA 3Q8RB 2C35B 4F4WA 2W57A 2JA5A 5IT9W 3RF2A 2R82A 3M4IA 1BJTA 3KALA 2JA6A 2VPSA 3KHRA 4BBSG 4TQSA 4J0MA 1SEIA 4R7RA 4LF6H 4IR9A 1TWGA 1B33N 2AGOA 1UC8A 3MWDA 1E4FT 4ECUA 2FPGB 2HVRA 5LYJF 4DV6H 4RNOA 4YAJB 4A3BG 3LWBA 1AUVA 3PN1A 4BBRG 5KFKA 4EGJA 4QW9A 5KFIA 3Q1KA 4ECTA 1VKZA 2Q2UA 2WAQA 3TIIA 3HB9A 1DIKA 5KFJA 1P8LA 4Y8VB 4YP3A 4JI4H 5LMNH 1JXLA 3ETJA 4ECRA 1PK8A 1PX2A 3H20A 3M9MB 3MFIA 2JEJA 4LFAH 4CC6A 3GIPA 2V4QA 2R7MA 2NU8B 4UCRA 4O3QA 3U9TA 2XC9A 4J9KA 4DV3H 3KXYT 3G6VA 2V4RA 5CA1F 4ME6A 2BQRA 1S10A 1RJPA 2R7KA 1IBKH 3GTQA 1RJQA 2XGQA 4A3KG 2YS6A 4EEQA 3PZPA 2RDJA 2J9GA 3FMAA 1T94A 2BQ3A 2DZDA 1SYXB 1BGWA 2GLTA 5KX5F 4X66H 2W8KA 4F4XA 5KG0A 1RYRA 1M6VA 3T1YH 1EHIA 2FK1A 5KT7A 2VPQA 4MA5A 3BABA 2NUAB 4M7EA 4YAKB 1HNXH 3HXLA 4PDBA 1Y1VA 2JEIA 5C1PA 4F4ZA 4LSXA 3JZIA 4MAMA 1S9FA 3KAKA 4O4HF 4LF8H 1TAEA 3E5NA 1A9XA 5DQHA 3M9NB 2GPWA 5HBRB 2R6FA 4DL6A 3KHGA 2ATLA 1T3NA 3WNZA 4YJ2F 3GILA 5I47A 2FPPB 5DG9A 4FBTA 3J81W 2VUMA 2KSWA 4DL7A 3K5IA 3CVZA 1Y1VG 4ED7A 2R85A 4EYIB 1XMQH 4UCTA 5KFGA 3VPBA 4I4TF 4UCSA 4QWEA 3OSNA 2C22A 1J5EH 1KJJA 1C30A 5KFMA 5FD6A 2WB1A 5DLGA 3HKZA 2UXCH 5KFCA 5L1JA 3N42B 5KFXA 4RU9A 3J7AK 5KFRA 1KBLA 1V9PA 5BMVF 5KT2A 2VR1A 2JA8G 3K3PA 4XX0B 1EYZA 5KT5A 1AUXA 5L1IA 1DV2A 1CQIB 2FJZA 2AGPA 3I4MG 2E2HA 5KFFA 2JEFA 3BA8A 2R8HA 5KG5A 1KJ8A 2C00A 4MV9A 3Q8PB 2W9BA 5JQWA 2AU0A 2CW8A 5IYCG 5F9NA 4U6PA 3WO0A 4J9QA 3MR2A 2OWOA 2UXDH 4MV7A 5KFHA 4YBZB 1C3OA 5LXTF 2CZGA 5FPRA 5KFDA 3OHAA 3R5FA 2UVWA 4DR5H 1W93A 4UCVA 2OLSA 2WAQE 4DR3H 5T14A 4B3TH 3SE7A 4C5CA 2UVVA 2I8CA 5KFPA 4ECQA 3R5HA 4HNTA 4LF9H 1KJIA 4A3LG 3JRXA 4DV0H 3SI8A 3RB4A 4ZHQF 4YR2A 2F4VH 4Q0YA 1ZQ7A 1UNNC 1BXRA 1W96A 3TQTA 4A2AA 5J2UF 4RB2C 4LFCH 5DQIA 5EDWA 2V5AA 1O75A 2YW2A 5H80A 1Z2OX 1Z2PX 2BQUA 1WH2A 2FK3A 4ECYA 4CC5A 3GIDA 2ASJA 4U7CA 3L2PA 2V58A 5KFZA 3MWEA 2M05A 2FP4B 2YRWA 4IWYA 5D1PA 1AN7A 2R86A 3BG5A 2IA6A 4IRCA 3GTGA
chains in the Genus database with same CATH topology
1HR0H 1FJGH 4DUYH 2HGSA 5FLXW 4IAJA 1P8LA 4JI4H 5LMNH 4K0KH 5IWAH 4LFBH 1XNQH 3RJ0A 3H20A 4LFAH 1A0IA 4CC6A 4A2BA 4JYAH 4LH7A 1GYFA 1Z2NX 4UCRA 4B3MH 4DV3H 3KXYT 2MCTA 4RB1A 4KHPH 4LMYA 2ZM6H 4GKJH 5LMUH 1IBKH 2UXBH 2YCHA 5D1OB 3N6XA 5FD5A 3JAMW 3JSLA 4EEQA 3FMAA 2UUAH 4ETSA 1SYXB 1BGWA 4UCOA 4X66H 4GLXA 3MWMA 3IG0A 4UCUA 4B3RH 4NXNH 3T1YH 3EYYA 2VQFH 1IBLH 3BABA 4M7EA 4FM9A 1DGSA 3L4JA 1I94H 4X65H 1HNXH 3T1HH 2WYOA 3HXLA 4JI5H 1HNWH 1N36H 4LSXA 1XMOH 3KAKA 4X62H 4LF5H 4DV2H 4RB0A 4LF8H 1TAEA 3BA9A 1MZBA 3RTXA 4RAYA 3RGZA 2RGVA 1FVIA 3K3VA 4DR6H 4I7HA 4JI8H 3J81W 4JI3H 1E4GT 3LMLA 2KSWA 3CVZA 1N34H 4JI6H 2E5LH 2WE6A 5D1OA 4RB3C 4MTDA 1XMQH 2CW7A 4UCTA 3DF7A 4BWSC 5A2QW 4YHHH 4UCSA 1J5EH 4RZQA 4JI2H 4DV7H 2UUBH 1N33H 5BR8H 5FD6A 2VOBA 2UUCH 3KAJA 4DR2H 2UXCH 3N42B 2VQEH 3J7AK 3C0FB 3N41B 4JV5H 1V9PA 4JI0H 2UU9H 2XIGA 2HVSA 2RGRA 4PDBA 4X64H 4DV5H 1M0TA 3F8NA 3N43B 2Q2TA 4APMA 4DR7H 4MTEA 4LF4H 1FKAH 3OTOH 1S68A 3UQ8A 4GKKH 3BA8A 1VS0A 2ZJTA 4LSAA 1ZHSA 1S03G 1X9NA 4MV9A 3RGXA 2HHHH 3L4KA 4JI1H 2CW8A 4LF7H 1ZHQA 2O03A 3N44B 1TA8A 2OWOA 4OX9H 2UXDH 4MV7A 5FPRA 1B04A 4DV1H 2WDTA 3JSNA 4EFEA 4DR5H 4DR1H 4DR4H 4RAZA 4UCVA 3RIZA 1XNRH 4DR3H 3N40P 2HVQA 4B3TH 2W57A 4LF9H 2VUGA 1HNZH 1XDNA 4DV4H 1N32H 5IT9W 4DV0H 1IBMH 3RF2A 3M4IA 5FPOA 1BJTA 3KALA 2F4VH 2VPSA 1M0WA 4Q0YA 5LL6b 4RB2C 4A2AA 4LH6A 4J0MA 4AQYH 1SEIA 4R7RA 4JI7H 4LF6H 4LFCH 4B3SH 1O75A 1I6UA 1Z2OX 1Z2PX 5EOYA 1E4FT 1WH2A 2HVRA 2FE3A 4YY3H 4DV6H 4CC5A 4DUZH 4NXMH 3L2PA 3PN1A 3BAAA 4EFBA 3J80W 5D1PA 1AN7A 1L2ZA 2Q2UA 4UFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCT A; 
#chains in the Genus database with same CATH topology
 1VBH A;  4YQW A;  3GII A;  1HR0 H;  1FJG H;  2I87 A;  4DUY H;  5EWG A;  3RAQ A;  4ED1 A;  4JV0 A;  2XCA A;  1JDE A;  4K0K H;  5LOV F;  4F50 A;  4ECW A;  4LFB H;  1XNQ H;  1WCM G;  1JLL B;  1JDB B;  2I80 A;  1WCM A;  3Q2O A;  1S97 A;  4A2B A;  1S0M A;  4F4Y A;  4QWC A;  4KHP H;  5IYD G;  2IBK A;  4O3O A;  2YL2 A;  1KJQ A;  2QYZ A;  1RK6 A;  3HKZ E;  3N6X A;  4WD3 A;  2R92 A;  2R87 A;  4ZI7 F;  5KT3 A;  3OSP A;  3GV8 B;  2UUA H;  4FBU A;  3PR4 A;  4UCO A;  4GLX A;  3IG0 A;  2FMA A;  3PO3 G;  4NXN H;  4EG0 A;  4O4L F;  2W9C A;  3EYY A;  3N8D A;  3PW7 A;  2VQF H;  4IRK A;  4EBC A;  3AYH B;  3QZ8 A;  3L4J A;  5KG3 A;  1I94 H;  2W6Q A;  3FDS A;  2UUB H;  4HNU A;  2HJW A;  3M9O B;  4TV9 F;  3RUP A;  4JI5 H;  3GIK A;  4ECS A;  1XMO H;  2FB9 A;  3PR5 B;  3MFH A;  2V9W A;  4RB0 A;  3BA9 A;  1OWT A;  3T5L A;  1SFO A;  2R92 G;  2RDI A;  3FKI G;  3K5H A;  1FVI A;  2AQ4 A;  4C2M A;  3HOV G;  1JKJ B;  1K1Q A;  3RB6 A;  5KT6 A;  2PVP A;  4O3P A;  2WE6 A;  4QJF A;  2E5L H;  1N56 A;  2W9A A;  1BNC A;  5KG6 A;  4BWS C;  4YHH H;  4JV2 A;  5C4X G;  4FU0 A;  3MR3 A;  2VA3 A;  2YZM A;  2VOB A;  1Y14 B;  4MA0 A;  2R8J A;  3C0F B;  5C3E G;  4QW8 A;  3VPC A;  4JI0 H;  3T5H A;  2UU9 H;  2XIG A;  2R7Z G;  3NGD A;  4ED2 A;  3GTK A;  5C5J A;  1M0T A;  5KT4 A;  1JX4 A;  5KG2 A;  3G6Y A;  4RUC A;  5CAE B;  3TIN A;  3H4B A;  1E4E B;  2R84 A;  3MJF A;  3BQ2 A;  3UQ8 A;  4GKK H;  5KG1 A;  2ZJT A;  4LSA A;  1ZHS A;  5JVD F;  5JVL A;  2NU9 B;  1V4Y A;  4IR1 A;  4A93 G;  1L2Z A;  3L4K A;  2R7N A;  4DL4 A;  2ASL A;  4PWQ A;  2W6O A;  2O03 A;  1TA8 A;  1TWC A;  1WSC A;  4YR3 A;  1GSA A;  1RYS A;  2V59 A;  4O3N A;  3RAX A;  1B04 A;  5KFB A;  4DV1 H;  2WDT A;  4MV3 A;  1N48 A;  1EUC B;  4DL5 A;  2E2I A;  1XNR H;  1TWH A;  2ZDQ A;  5DG7 A;  4J9R A;  2ALZ A;  2FLP A;  3I4N G;  2Y0S A;  4EBD A;  3RBD A;  2C2D A;  1HNZ H;  1XDN A;  5CA0 F;  3V6J A;  2JEG A;  1N32 H;  1TWA A;  3H3V H;  1IBM H;  5FPO A;  5HV6 A;  4A3C G;  1ZET A;  2W7P A;  4JI7 H;  4LH6 A;  2JA7 G;  2R93 A;  2XGP A;  2R93 G;  3GTM A;  2IMW P;  1I6U A;  5EOY A;  1VAJ A;  4A3E G;  2FE3 A;  4YY3 H;  3OUU A;  4NXM H;  1IOW A;  4QWB A;  4WBN F;  5D8D A;  2IP4 A;  3J80 W;  4A3J G;  4I55 F;  3KTM A;  3PVX A;  2YZG A;  4UFZ A;  3RB0 A;  3G8C A;  2C2E A;  2W9B B;  2FLN A;  4NLG A;  2J6S A;  2B63 A;  2HGS A;  3UFX B;  4MV6 A;  3EPI A;  2WB1 E;  1Y1W A;  5C44 G;  3H40 A;  4RNN A;  4IHJ F;  2W8L A;  3RJ0 A;  1A0I A;  3GTJ A;  4MV1 A;  4JYA H;  2VQD A;  4LH7 A;  2UVU A;  1Z2N X;  5IP7 G;  4RZR A;  4ZQI A;  2FLL A;  3GQC A;  2MCT A;  5GON F;  5KFE A;  4LMY A;  2ZM6 H;  2VUM G;  5IYB G;  1VBG A;  3RFC A;  5LMU H;  3FKI A;  1KC7 A;  4J9M A;  3ORQ A;  2WTF A;  5KFT A;  4O3R A;  3GTL A;  4L1K A;  3JSL A;  3EPG A;  1WR2 A;  5IP9 G;  3PW0 A;  4O3S A;  3RV3 A;  3V4S A;  3WO1 A;  2J6U A;  4JUZ A;  4UCU A;  3TQ1 A;  3I12 A;  1IBL H;  4FM9 A;  2R8I A;  2ASD A;  4X65 H;  1JIH A;  3QFF A;  5DG8 A;  3BJY A;  2JA6 G;  3PO2 G;  2R7L A;  2WYO A;  2PMZ E;  5BPF A;  1N36 H;  2VA2 A;  4X62 H;  4DV2 H;  4ED8 A;  3HOY G;  2SCU B;  4J9O A;  5KFN A;  2W6P A;  4QIW A;  3PW5 A;  2DLN A;  2R8G A;  3QZ7 A;  1SCU B;  4RAY A;  2QK4 A;  3RGZ A;  4J9N A;  2RGV A;  4R8U A;  1K83 A;  4DL2 A;  4O2A F;  5KFW A;  4JI8 H;  4JI3 H;  4A3F G;  4J9P A;  3LML A;  4Q8E A;  1N34 H;  4JI6 H;  5D1O A;  4FS1 A;  5KFL A;  1CQJ B;  3GV7 B;  4TUY F;  4QWA A;  4BY1 G;  5A2Q W;  2W71 A;  1N33 H;  2YS7 A;  4C5A A;  3V6H A;  2NVY A;  2FK2 A;  5JH7 F;  3KAJ A;  3VMM A;  4DR2 H;  2UUC H;  2OH2 A;  3H0G G;  3N41 B;  1CE8 A;  2W9C B;  4ECV A;  2RGR A;  5EWF A;  2HVS A;  2R7Z A;  4IWX A;  4DV5 H;  3ETH A;  2W70 A;  4APM A;  4MTE A;  1EUD B;  1EZ1 A;  4EYH B;  1FKA H;  4LF4 H;  2XCP A;  5KFQ A;  4G3I A;  3OTO H;  5KG7 A;  2W7O A;  4ECX A;  1S68 A;  5C8Y F;  3GIJ A;  3LP8 A;  4YJ3 F;  4ZOL F;  3KHH A;  2Y0S E;  4HYK A;  1UC9 A;  3MR6 A;  2JA7 A;  3RGX A;  2HHH H;  4JV1 A;  1I3Q A;  1ZHQ A;  4LF7 H;  3HBL A;  1B6S A;  3MR5 A;  3N44 B;  5LA6 F;  2C2R A;  1Y1W G;  4J9S A;  5IYZ F;  3JSN A;  4EFE A;  5J2T F;  2NU6 B;  3RBE A;  4DR4 H;  4RAZ A;  2FKL A;  3JRW A;  2HVQ A;  3R5X A;  2DPI A;  2VUG A;  1DV1 A;  1TWF A;  3BQ0 A;  4DV4 H;  1R9T A;  4EGQ A;  2ZDH A;  4JV5 H;  1M0W A;  5LL6 b;  4AQY H;  4MV8 A;  4HNV A;  3OUZ A;  3ORR A;  5KG4 A;  4B3S H;  4ED3 A;  1CS0 A;  1KJ9 A;  4M9U A;  4DUZ H;  2CKZ B;  4FS2 A;  3GIM A;  4AYB A;  3BAA A;  4EFB A;  4ECZ A;  2W6N A;  4BXX G;  5KFU A;  3PW4 A;  3VPD A;  4A3D G;  5FLX W;  1GGO A;  4IAJ A;  4XYM B;  5KFA A;  3U9S A;  2C28 A;  5CB4 F;  5LP6 F;  5IWA H;  4TQR A;  1GSO A;  4HQ6 A;  1GYF A;  5BPH A;  2W6M A;  4B3M H;  4R8U B;  4RB1 A;  4AYB E;  4GKJ H;  2FPI B;  3V4Z A;  5DGA A;  5KFV A;  4EBE A;  4O4I F;  2UXB H;  2YCH A;  5D1O B;  4QWD A;  5FD5 A;  3JAM W;  5KFS A;  5KKN B;  2DIK A;  3H4D A;  2W6Z A;  4BY7 G;  4ETS A;  1RJR A;  1S0O A;  2YRX A;  1IOV A;  4YB8 B;  2PMZ A;  3MWM A;  3H0G A;  4B3R H;  2NVX A;  1GLV A;  3Q8Q B;  4YR0 A;  2YU9 A;  4RNM A;  1DGS A;  4O2B F;  1S0N A;  5L9X A;  2DWC A;  4DLK A;  3GLK A;  3TIG A;  5EZY F;  5JUM A;  4J9L A;  3T1H H;  2J6T A;  2XCL A;  1HNW H;  2R8K A;  4ED0 A;  5KFY A;  2XD4 A;  1B6R A;  4LF5 H;  2GPS A;  3HOU G;  4A3I G;  3RB3 A;  4Q8F A;  3HOX G;  2UVR A;  1MZB A;  3RTX A;  4TV8 F;  5F9L A;  3GTP A;  3K3V A;  1GO3 E;  4DR6 H;  3G6X A;  4I7H A;  4I50 F;  1GSH A;  1E4G T;  4C5B A;  5DGB A;  1V51 A;  2ZDG A;  4MV4 A;  1I7N A;  5FJ8 G;  4Q44 A;  3BQ1 A;  5L1K A;  4RB3 C;  4DL3 A;  1K1S A;  4MTD A;  1RK5 A;  2CW7 A;  2RF4 A;  3OHB A;  3DF7 A;  4GC6 A;  5FLM G;  3PW2 A;  2PBZ A;  4RZQ A;  4JI2 H;  5KFO A;  4DV7 H;  3T5J A;  5BR8 H;  2X0S A;  2YZN A;  2NU7 B;  2PN1 A;  3GIQ A;  5C1O A;  2VQE H;  4E4T A;  4XYL B;  2B63 G;  3RV4 A;  4ED6 A;  4A3G G;  4HR7 A;  4X64 H;  2Q2T A;  3F8N A;  3N43 B;  2BR0 A;  4DR7 H;  4IZO A;  4XZ3 B;  3V6K A;  2CQY A;  3GTO A;  3HOW G;  4RUA A;  4QIW E;  4EEY A;  2YYA A;  4A3M G;  3R23 A;  5DLF A;  4Q45 A;  1VS0 A;  3T5K A;  1X9N A;  1S03 G;  1I7L A;  4Q43 A;  4JI1 H;  1E4E A;  3CQZ A;  5L1L A;  1I50 A;  4GC7 A;  5DQG A;  4IRD A;  3HOZ G;  2AGQ A;  2JA5 G;  4OX9 H;  3GV5 B;  5EWE A;  3IN5 A;  1KEE A;  3Q8S B;  1T36 A;  3KHL A;  5K2M A;  1M7J A;  4DR1 H;  3RIZ A;  1ULZ A;  2DPJ A;  3N40 P;  2P0A A;  3Q8R B;  2C35 B;  4F4W A;  2W57 A;  2JA5 A;  5IT9 W;  3RF2 A;  2R82 A;  3M4I A;  1BJT A;  3KAL A;  2JA6 A;  2VPS A;  3KHR A;  4BBS G;  4TQS A;  4J0M A;  1SEI A;  4R7R A;  4LF6 H;  4IR9 A;  1TWG A;  1B33 N;  2AGO A;  1UC8 A;  3MWD A;  1E4F T;  4ECU A;  2FPG B;  2HVR A;  5LYJ F;  4DV6 H;  4RNO A;  4YAJ B;  4A3B G;  3LWB A;  1AUV A;  3PN1 A;  4BBR G;  5KFK A;  4EGJ A;  4QW9 A;  5KFI A;  3Q1K A;  4ECT A;  1VKZ A;  2Q2U A;  2WAQ A;  3TII A;  3HB9 A;  1DIK A;  5KFJ A;  1P8L A;  4Y8V B;  4YP3 A;  4JI4 H;  5LMN H;  1JXL A;  3ETJ A;  4ECR A;  1PK8 A;  1PX2 A;  3H20 A;  3M9M B;  3MFI A;  2JEJ A;  4LFA H;  4CC6 A;  3GIP A;  2V4Q A;  2R7M A;  2NU8 B;  4UCR A;  4O3Q A;  3U9T A;  2XC9 A;  4J9K A;  4DV3 H;  3KXY T;  3G6V A;  2V4R A;  5CA1 F;  4ME6 A;  2BQR A;  1S10 A;  1RJP A;  2R7K A;  1IBK H;  3GTQ A;  1RJQ A;  2XGQ A;  4A3K G;  2YS6 A;  4EEQ A;  3PZP A;  2RDJ A;  2J9G A;  3FMA A;  1T94 A;  2BQ3 A;  2DZD A;  1SYX B;  1BGW A;  2GLT A;  5KX5 F;  4X66 H;  2W8K A;  4F4X A;  5KG0 A;  1RYR A;  1M6V A;  3T1Y H;  1EHI A;  2FK1 A;  5KT7 A;  2VPQ A;  4MA5 A;  3BAB A;  2NUA B;  4M7E A;  4YAK B;  1HNX H;  3HXL A;  4PDB A;  1Y1V A;  2JEI A;  5C1P A;  4F4Z A;  4LSX A;  3JZI A;  4MAM A;  1S9F A;  3KAK A;  4O4H F;  4LF8 H;  1TAE A;  3E5N A;  1A9X A;  5DQH A;  3M9N B;  2GPW A;  5HBR B;  2R6F A;  4DL6 A;  3KHG A;  2ATL A;  1T3N A;  3WNZ A;  4YJ2 F;  3GIL A;  5I47 A;  2FPP B;  5DG9 A;  4FBT A;  3J81 W;  2VUM A;  2KSW A;  4DL7 A;  3K5I A;  3CVZ A;  1Y1V G;  4ED7 A;  2R85 A;  4EYI B;  1XMQ H;  4UCT A;  5KFG A;  3VPB A;  4I4T F;  4UCS A;  4QWE A;  3OSN A;  2C22 A;  1J5E H;  1KJJ A;  1C30 A;  5KFM A;  5FD6 A;  2WB1 A;  5DLG A;  3HKZ A;  2UXC H;  5KFC A;  5L1J A;  3N42 B;  5KFX A;  4RU9 A;  3J7A K;  5KFR A;  1KBL A;  1V9P A;  5BMV F;  5KT2 A;  2VR1 A;  2JA8 G;  3K3P A;  4XX0 B;  1EYZ A;  5KT5 A;  1AUX A;  5L1I A;  1DV2 A;  1CQI B;  2FJZ A;  2AGP A;  3I4M G;  2E2H A;  5KFF A;  2JEF A;  3BA8 A;  2R8H A;  5KG5 A;  1KJ8 A;  2C00 A;  4MV9 A;  3Q8P B;  2W9B A;  5JQW A;  2AU0 A;  2CW8 A;  5IYC G;  5F9N A;  4U6P A;  3WO0 A;  4J9Q A;  3MR2 A;  2OWO A;  2UXD H;  4MV7 A;  5KFH A;  4YBZ B;  1C3O A;  5LXT F;  2CZG A;  5FPR A;  5KFD A;  3OHA A;  3R5F A;  2UVW A;  4DR5 H;  1W93 A;  4UCV A;  2OLS A;  2WAQ E;  4DR3 H;  5T14 A;  4B3T H;  3SE7 A;  4C5C A;  2UVV A;  2I8C A;  5KFP A;  4ECQ A;  3R5H A;  4HNT A;  4LF9 H;  1KJI A;  4A3L G;  3JRX A;  4DV0 H;  3SI8 A;  3RB4 A;  4ZHQ F;  4YR2 A;  2F4V H;  4Q0Y A;  1ZQ7 A;  1UNN C;  1BXR A;  1W96 A;  3TQT A;  4A2A A;  5J2U F;  4RB2 C;  4LFC H;  5DQI A;  5EDW A;  2V5A A;  1O75 A;  2YW2 A;  5H80 A;  1Z2O X;  1Z2P X;  2BQU A;  1WH2 A;  2FK3 A;  4ECY A;  4CC5 A;  3GID A;  2ASJ A;  4U7C A;  3L2P A;  2V58 A;  5KFZ A;  3MWE A;  2M05 A;  2FP4 B;  2YRW A;  4IWY A;  5D1P A;  1AN7 A;  2R86 A;  3BG5 A;  2IA6 A;  4IRC A;  3GTG A; 
#chains in the Genus database with same CATH homology
 1HR0 H;  1FJG H;  4DUY H;  2HGS A;  5FLX W;  4IAJ A;  1P8L A;  4JI4 H;  5LMN H;  4K0K H;  5IWA H;  4LFB H;  1XNQ H;  3RJ0 A;  3H20 A;  4LFA H;  1A0I A;  4CC6 A;  4A2B A;  4JYA H;  4LH7 A;  1GYF A;  1Z2N X;  4UCR A;  4B3M H;  4DV3 H;  3KXY T;  2MCT A;  4RB1 A;  4KHP H;  4LMY A;  2ZM6 H;  4GKJ H;  5LMU H;  1IBK H;  2UXB H;  2YCH A;  5D1O B;  3N6X A;  5FD5 A;  3JAM W;  3JSL A;  4EEQ A;  3FMA A;  2UUA H;  4ETS A;  1SYX B;  1BGW A;  4UCO A;  4X66 H;  4GLX A;  3MWM A;  3IG0 A;  4UCU A;  4B3R H;  4NXN H;  3T1Y H;  3EYY A;  2VQF H;  1IBL H;  3BAB A;  4M7E A;  4FM9 A;  1DGS A;  3L4J A;  1I94 H;  4X65 H;  1HNX H;  3T1H H;  2WYO A;  3HXL A;  4JI5 H;  1HNW H;  1N36 H;  4LSX A;  1XMO H;  3KAK A;  4X62 H;  4LF5 H;  4DV2 H;  4RB0 A;  4LF8 H;  1TAE A;  3BA9 A;  1MZB A;  3RTX A;  4RAY A;  3RGZ A;  2RGV A;  1FVI A;  3K3V A;  4DR6 H;  4I7H A;  4JI8 H;  3J81 W;  4JI3 H;  1E4G T;  3LML A;  2KSW A;  3CVZ A;  1N34 H;  4JI6 H;  2E5L H;  2WE6 A;  5D1O A;  4RB3 C;  4MTD A;  1XMQ H;  2CW7 A;  4UCT A;  3DF7 A;  4BWS C;  5A2Q W;  4YHH H;  4UCS A;  1J5E H;  4RZQ A;  4JI2 H;  4DV7 H;  2UUB H;  1N33 H;  5BR8 H;  5FD6 A;  2VOB A;  2UUC H;  3KAJ A;  4DR2 H;  2UXC H;  3N42 B;  2VQE H;  3J7A K;  3C0F B;  3N41 B;  4JV5 H;  1V9P A;  4JI0 H;  2UU9 H;  2XIG A;  2HVS A;  2RGR A;  4PDB A;  4X64 H;  4DV5 H;  1M0T A;  3F8N A;  3N43 B;  2Q2T A;  4APM A;  4DR7 H;  4MTE A;  4LF4 H;  1FKA H;  3OTO H;  1S68 A;  3UQ8 A;  4GKK H;  3BA8 A;  1VS0 A;  2ZJT A;  4LSA A;  1ZHS A;  1S03 G;  1X9N A;  4MV9 A;  3RGX A;  2HHH H;  3L4K A;  4JI1 H;  2CW8 A;  4LF7 H;  1ZHQ A;  2O03 A;  3N44 B;  1TA8 A;  2OWO A;  4OX9 H;  2UXD H;  4MV7 A;  5FPR A;  1B04 A;  4DV1 H;  2WDT A;  3JSN A;  4EFE A;  4DR5 H;  4DR1 H;  4DR4 H;  4RAZ A;  4UCV A;  3RIZ A;  1XNR H;  4DR3 H;  3N40 P;  2HVQ A;  4B3T H;  2W57 A;  4LF9 H;  2VUG A;  1HNZ H;  1XDN A;  4DV4 H;  1N32 H;  5IT9 W;  4DV0 H;  1IBM H;  3RF2 A;  3M4I A;  5FPO A;  1BJT A;  3KAL A;  2F4V H;  2VPS A;  1M0W A;  4Q0Y A;  5LL6 b;  4RB2 C;  4A2A A;  4LH6 A;  4J0M A;  4AQY H;  1SEI A;  4R7R A;  4JI7 H;  4LF6 H;  4LFC H;  4B3S H;  1O75 A;  1I6U A;  1Z2O X;  1Z2P X;  5EOY A;  1E4F T;  1WH2 A;  2HVR A;  2FE3 A;  4YY3 H;  4DV6 H;  4CC5 A;  4DUZ H;  4NXM H;  3L2P A;  3PN1 A;  3BAA A;  4EFB A;  3J80 W;  5D1P A;  1AN7 A;  1L2Z A;  2Q2U A;  4UFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...