2MCTA

Nmr structure of the protein zp_02042476.1 from ruminococcus gnavus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
102
structure length
102
Chain Sequence
b'GSPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Ruminococcus gnavus
publication title NMR structure of the protein ZP_02042476.1 from Ruminococcus gnavus.
rcsb
total genus 13
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.320 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2mctA00
2MCTA
chains in the Genus database with same CATH superfamily
1JDEA 3G6VA 5JUMA 1I7NA 4ECZA 2R8JA 4DV2H 4DR4H 5FPRA 2XGPA 4JV2A 3V4SA 4A3IG 4LF7H 5L1IA 1HR0H 4J9MA 4IAJA 5KG2A 4ECSA 2W6QA 3RBEA 1N33H 5IYCG 4KHPH 4DL5A 4Q44A 4ETSA 1C30A 5KFXA 3BA9A 4X62H 2HVSA 4GKKH 1DV1A 4EBDA 2GLTA 3G6YA 2XCLA 2FK2A 2BQUA 2NVXA 4BBSG 5KT4A 4J9KA 2V9WA 1UNNC 4ED0A 3KHGA 3G8CA 4Q43A 3HKZA 4ECRA 1I6UA 5KFSA 2HVRA 1JIHA 2WB1A 2YZGA 4IRDA 3MWEA 4YB8B 4HR7A 4Q45A 4R7RA 5LMUH 3GTOA 1WSCA 1RJPA 4EBEA 4FBTA 2QK4A 5EDWA 3I12A 3EPGA 3RB4A 3MR2A 2WAQA 2IA6A 2E2IA 2UUAH 4DV6H 1B33N 2HVQA 2JA7A 5CA1F 4MTDA 4UCVA 2ASDA 2DZDA 3G6XA 2FLPA 4NLGA 3PW2A 1ZETA 4MV3A 3T5LA 5CB4F 4MV9A 2W8KA 5KG0A 3WNZA 2R82A 3M9NB 2UUCH 3PR5B 1S03G 3H0GA 3GIKA 4YR2A 2FLNA 3U9SA 1KBLA 2C28A 3GTLA 2W70A 3RGXA 5DG8A 3N40P 2SCUB 4RU9A 4YBZB 3TQ1A 3PW7A 1X9NA 1MZBA 2YRXA 4PDBA 5KFPA 5KFWA 3VPDA 4JI3H 1S97A 4MA0A 4DV4H 4B3TH 4M7EA 4TQSA 3IG0A 3KXYT 5KFNA 5T14A 1UC8A 1M7JA 4EEQA 1L2ZA 4UFZA 3MWMA 2R8IA 2R7NA 4LH7A 2ZDHA 2C35B 2JEIA 4EEYA 1XMOH 2YZMA 4QJFA 4J0MA 4F4XA 1Y14B 4HQ6A 4RB0A 3Q8PB 2IMWP 4XYMB 4QW8A 1VBGA 4ED6A 2HGSA 4YJ2F 4YAJB 4RUCA 4ECYA 4FBUA 4DR7H 5DQGA 3Q8RB 5A2QW 4EGJA 4A3KG 2FK1A 4JI0H 1S10A 5KFGA 4ECQA 1JX4A 1EHIA 3OTOH 5DQHA 4EBCA 2AU0A 4RNMA 4G3IA 1Y1WA 2CKZB 3N43B 5GONF 4LSXA 4UCUA 2V4QA 4TV8F 1M6VA 4DUZH 3PN1A 3VPCA 1I3QA 2C2DA 3SI8A 5KG4A 2W9BB 5FPOA 5DG9A 4YAKB 4DR1H 1ZHQA 5LMNH 2V59A 2RDIA 3KHHA 1S0NA 2C22A 1JLLB 4DV7H 4IR9A 1ZHSA 2O03A 2V58A 1T3NA 3GV5B 2WDTA 3RAQA 4A3BG 2HHHH 2YCHA 1M0TA 4FM9A 2CW7A 3RV3A 1V4YA 5KFHA 4DUYH 1SFOA 2J6SA 1T94A 4RB2C 4DL3A 4A3MG 3PW5A 4I7HA 3EYYA 2ZDGA 3NGDA 2OLSA 1RYSA 4RZQA 2DPIA 1OWTA 2VA3A 4O2BF 2OWOA 3GTQA 1ULZA 3N6XA 4ECXA 3KAKA 4WD3A 5F9NA 4C5BA 2YS6A 3HOUG 4O3QA 3K3PA 1O75A 3HXLA 2CW8A 3HB9A 2Q2UA 3GV7B 2FJZA 1BXRA 4HNTA 4C5AA 5EZYF 4DR2H 4BY7G 4JI6H 3Q8SB 4ZQIA 4FS1A 5KFDA 3KAJA 4A3DG 3MWDA 4J9PA 4HNUA 3RFCA 2VUMG 1B04A 3RUPA 4DV5H 3H0GG 3T1YH 2NU7B 1R9TA 2WYOA 4O2AF 4R8UA 4IZOA 1TA8A 4C2MA 2R7KA 3L4KA 2R7ZG 2UXBH 1JDBB 3GIJA 3OHAA 5EWFA 4TQRA 4RNOA 3RV4A 3EPIA 3V6KA 5IYDG 1IBMH 2GPWA 4DR6H 3RB3A 4NXNH 1WH2A 1PX2A 4TV9F 2KSWA 2R85A 1AN7A 3UQ8A 2Y0SA 5KFJA 5KX5F 3MR6A 1RK5A 4J9LA 2C2EA 4O3SA 1KJQA 5D1OA 4BBRG 3CVZA 5CA0F 1PK8A 4HNVA 4X64H 3H40A 2R8KA 2JA5G 1K1SA 1VBHA 2JA5A 5DLFA 4J9SA 1IOVA 1VS0A 2M05A 3GLKA 4EFEA 3GTJA 2B63G 1EUDB 4ECUA 4C5CA 3JSNA 2UXDH 5BMVF 1V51A 2YRWA 5KFOA 2YZNA 1A0IA 1XMQH 1TWGA 4ECVA 1RJQA 5KFYA 1EYZA 4Q8FA 5CAEB 2FLLA 4A93G 5KKNB 4JI4H 2R93A 3H20A 4AQYH 2VPSA 4XYLB 4ZOLF 2ZDQA 4IR1A 4F4ZA 2J6UA 2W7PA 5L1KA 4JV5H 1FKAH 2QYZA 4F50A 4YJ3F 3HOYG 2PVPA 4JUZA 2UVWA 2R92A 4O3OA 3I4NG 2DLNA 1SYXB 4ED2A 2FPIB 3ETJA 4APMA 1SEIA 2JEFA 1RYRA 3MJFA 2W9CB 5EWGA 3BAAA 2UVRA 2YL2A 3T5JA 3RGZA 5KFMA 2YW2A 2DPJA 2HJWA 3QZ8A 3Q1KA 4DL7A 3K5HA 5K2MA 3J80W 3RF2A 3BQ0A 5JH7F 2I80A 4YQWA 4A3GG 4ED3A 3GTGA 1DGSA 1GGOA 4PWQA 1HNZH 4UCTA 4MTEA 3RB6A 3R5XA 3GTMA 4JI1H 1VKZA 3JZIA 5BPFA 2AQ4A 1B6RA 3ORRA 2VA2A 3PO2G 3FMAA 4EYIB 1Y1VA 4JI5H 3WO0A 2R86A 4L1KA 3GTPA 2MCTA 4MV7A 2RGRA 4NXMH 4Q0YA 5KT5A 4FS2A 3N8DA 2OH2A 1RK6A 5KFFA 4YP3A 2ALZA 2RF4A 4I4TF 1KJ8A 3JSLA 2IP4A 4IRCA 4LF5H 1K83A 3GIQA 1CQIB 4DV1H 4MV1A 1WCMG 2ZJTA 3H3VH 3N41B 5FD5A 1GSOA 4LH6A 2WAQE 3GILA 3E5NA 1Z2PX 4ECWA 4ME6A 5LXTF 4YY3H 5KFKA 5IT9W 3JRXA 4MV8A 4A2BA 4GC6A 1JXLA 5KFUA 3AYHB 3HOVG 4YR0A 3MR3A 1N34H 3ETHA 5H80A 5KFBA 4X66H 4HYKA 5KFTA 3OSNA 4DLKA 5IP9G 3C0FB 4A3LG 3BQ1A 4R8UB 4WBNF 5F9LA 3KHRA 1I94H 5C44G 2W9CA 2AGOA 3JRWA 2W6ZA 3FDSA 2PMZA 4IHJF 4FU0A 1W93A 5KG5A 1BJTA 5KFQA 2WTFA 4DL6A 2CZGA 1M0WA 5J2TF 3TQTA 4DL2A 4RAYA 4O4IF 1J5EH 2W6NA 2FK3A 2R7ZA 4GKJH 2DWCA 4DV3H 3GQCA 4O3RA 5DGAA 2YYAA 1ZQ7A 5KFZA 5LA6F 4AYBE 4LF8H 3HOWG 3K5IA 4JI2H 2P0AA 4LF4H 4A3EG 4A3CG 5BR8H 4XX0B 3V6HA 4X65H 3K3VA 3QFFA 3R5HA 3PO3G 1KEEA 1Y1WG 2UUBH 3RB0A 5I47A 1AUXA 3HOZG 4B3SH 2UU9H 4UCSA 1RJRA 5KT7A 3OHBA 3BABA 5KFRA 4O4HF 5KFVA 2V4RA 4F4WA 3FKIA 4ED8A 1Y1VG 1KJIA 2VOBA 5DGBA 2W9BA 2DIKA 4LMYA 5L1LA 4I50F 4M9UA 2JA7G 2ATLA 5L1JA 2R6FA 2RDJA 3TINA 4E4TA 1CQJB 1HNXH 1K1QA 5IYBG 3HBLA 1A9XA 3PVXA 3Q8QB 2FMAA 4DR5H 4GC7A 2C2RA 4A3FG 5DLGA 3HOXG 2YS7A 3RBDA 2RGVA 4A2AA 4U6PA 4Y8VB 1E4EB 4B3RH 1N32H 3QZ7A 2UVVA 4F4YA 5C1OA 5JVDF 3BQ2A 4RUAA 4CC5A 1IOWA 4RZRA 2PBZA 4UCOA 2W7OA 1XNRH 1DV2A 1E4EA 4LF9H 1DIKA 3PZPA 4EFBA 1BGWA 3OUUA 2R93G 4JYAH 3WO1A 4CC6A 3LMLA 5KT3A 4LF6H 3M9OB 2JEJA 1HNWH 2C00A 4ZHQF 4Q8EA 1E4FT 5C3EG 4QW9A 1KJ9A 1TAEA 4DL4A 4OX9H 4MV4A 4QWCA 3KALA 3ORQA 1W96A 2VUMA 3BG5A 5C1PA 1EZ1A 5LL6b 4JI8H 1Z2NX 3GTKA 3IN5A 1UC9A 1C3OA 1S68A 4RNNA 1N56A 2W71A 4BY1G 5IYZF 5FD6A 1WCMA 5KT6A 2VUGA 1CE8A 4DR3H 4DV0H 3N44B 2NUAB 2R92G 3PW0A 4MV6A 5C8YF 2PN1A 2ASLA 1S0OA 3Q2OA 1GO3E 5KFAA 3VMMA 5C4XG 2W57A 1TWAA 5IWAH 2W8LA 3L2PA 4J9NA 4TUYF 5JQWA 2F4VH 3R23A 1IBKH 3N42B 3OUZA 3RTXA 1E4GT 2ZM6H 1VAJA 3MR5A 3LP8A 4XZ3B 4YHHH 3M9MB 3M4IA 2ASJA 2W6PA 5KFLA 4UCRA 5KG6A 2NU9B 4JI7H 1BNCA 3UFXB 4LFCH 1EUCB 5LOVF 4ED7A 1XDNA 2IBKA 2R8HA 1Z2OX 3RJ0A 2FB9A 2NU6B 2BR0A 4U7CA 2AGPA 2FP4B 5D8DA 2PMZE 4QIWE 1SCUB 2UVUA 4O3PA 4BWSC 4EG0A 2XD4A 5DQIA 3GIIA 5EWEA 5LYJF 2R7MA 3CQZA 4I55F 2W6MA 2X0SA 5IP7G 4QWDA 4IWYA 4MA5A 5FJ8G 5KFIA 3PW4A 1P8LA 2WE6A 4O4LF 1GSAA 3FKIG 4AYBA 1AUVA 2JA6G 1T36A 1JKJB 3PR4A 1FVIA 5HV6A 3SE7A 4QIWA 3KHLA 1WR2A 2VPQA 2FPGB 3F8NA 4MAMA 5KG1A 5KT2A 3T5KA 4IWXA 1IBLH 3H4DA 3J81W 1N48A 2BQRA 1FJGH 1V9PA 5EOYA 3TIGA 4BXXG 2GPSA 4IRKA 3BJYA 2NU8B 3RIZA 2R87A 1KC7A 4JV0A 4RB1A 3T1HH 1GSHA 4JV1A 2JA8G 3JAMW 5J2UF 3GIPA 1GLVA 5L9XA 5HBRB 4O3NA 2UXCH 2JEGA 3V4ZA 1GYFA 4QWAA 4QWBA 5BPHA 2W6OA 2R7LA 4GLXA 5KG7A 3U9TA 2XIGA 5JVLA 2XC9A 2YU9A 2Q2TA 2VQDA 3DF7A 2CQYA 1S9FA 2FE3A 3VPBA 2XCAA 4RB3C 3V6JA 2WB1E 5D1OB 1TWHA 5KG3A 1N36H 1XNQH 1TWCA 5C5JA 3HKZE 4EGQA 1KJJA 5DG7A 3TIIA 2BQ3A 3H4BA 5KFCA 2E5LH 2JA6A 2NVYA 5LP6F 2V5AA 1CS0A 2J6TA 4RAZA 2XCPA 2FPPB 4ED1A 1B6SA 3MFIA 3KTMA 3BA8A 4LSAA 4ZI7F 5FLXW 3MFHA 2VR1A 4QWEA 2W9AA 2VQFH 2B63A 3J7AK 2I87A 2R84A 4J9OA 2AGQA 3LWBA 3R5FA 4LFBH 2FKLA 2XGQA 3RAXA 3GIDA 2J9GA 5FLMG 4EYHB 3T5HA 1S0MA 1I7LA 4B3MH 2E2HA 3I4MG 3L4JA 4J9QA 3OSPA 2Y0SE 5KFEA 1TWFA 4A3JG 2I8CA 2VQEH 2R8GA 4K0KH 3GV8B 4J9RA 4LFAH 3GIMA 1I50A 4YR3A 5D1PA 4ECTA
chains in the Genus database with same CATH topology
4DV0H 3N44B 3N6XA 4LH6A 3KAKA 1Z2PX 4DV2H 4YY3H 4DR4H 5FPRA 1O75A 5IT9W 4LF7H 3HXLA 2CW8A 4A2BA 2Q2UA 2W57A 5IWAH 1HR0H 3L2PA 4IAJA 1N33H 1N34H 4X66H 2F4VH 4DR2H 3N42B 1IBKH 3RTXA 4KHPH 1E4GT 4ETSA 2ZM6H 4JI6H 3BA9A 4X62H 2HVSA 3C0FB 4GKKH 3KAJA 4YHHH 3M4IA 4UCRA 1I94H 4JI7H 1B04A 4LFCH 4DV5H 3T1YH 1BJTA 2WYOA 1XDNA 1M0WA 1I6UA 2HVRA 1Z2OX 4RAYA 3RJ0A 1J5EH 1TA8A 4R7RA 5LMUH 3L4KA 4GKJH 2UXBH 4DV3H 1IBMH 5FD5A 4BWSC 2HVQA 4DV6H 2UUAH 4JI2H 4MTDA 4LF8H 4NXNH 1WH2A 4UCVA 2KSWA 4LF4H 1AN7A 3UQ8A 5BR8H 4X65H 1P8LA 2WE6A 3K3VA 4MV9A 5D1OA 5FD6A 3CVZA 4X64H 2UUBH 1FVIA 4B3SH 3F8NA 2UUCH 2UU9H 1S03G 4UCSA 1IBLH 3J81W 1VS0A 4EFEA 3BABA 1FJGH 3JSNA 3RGXA 1V9PA 5EOYA 3N40P 4DR6H 2UXDH 1X9NA 1MZBA 4PDBA 3RIZA 1A0IA 1XMQH 4JI3H 2VOBA 4DV4H 4B3TH 4LMYA 4M7EA 4RB1A 3T1HH 3IG0A 3KXYT 3JAMW 1L2ZA 4EEQA 4UFZA 3MWMA 4JI4H 3H20A 1HNXH 4AQYH 2VPSA 4LH7A 2UXCH 1GYFA 1XMOH 4DR5H 4J0MA 4JV5H 1FKAH 4RB0A 4GLXA 2RGVA 4A2AA 2XIGA 1SYXB 2HGSA 4B3RH 2Q2TA 4DR7H 3DF7A 4APMA 1SEIA 1N32H 2FE3A 5A2QW 4RB3C 5D1OB 1N36H 1XNQH 3BAAA 4JI0H 3RGZA 3OTOH 4CC5A 2E5LH 4UCOA 3J80W 3N43B 3RF2A 1XNRH 4LSXA 4UCUA 4LF9H 1DGSA 4RAZA 4EFBA 4DUZH 1BGWA 1HNZH 3PN1A 4UCTA 4MTEA 4JYAH 3BA8A 4LSAA 5FPOA 5FLXW 2VQFH 4JI1H 4CC6A 3LMLA 3J7AK 4LF6H 4DR1H 1ZHQA 5LMNH 1HNWH 3FMAA 1E4FT 4OX9H 4LFBH 4JI5H 1TAEA 4DV7H 1ZHSA 2O03A 2MCTA 3KALA 4MV7A 2RGRA 5LL6b 4Q0YA 2WDTA 4B3MH 4JI8H 2HHHH 1Z2NX 4NXMH 2YCHA 1M0TA 3L4JA 2CW7A 4DUYH 4FM9A 4RB2C 3JSLA 4LF5H 1S68A 2VQEH 4I7HA 3EYYA 4K0KH 4LFAH 4DV1H 2OWOA 4RZQA 2ZJTA 5D1PA 3N41B 4DR3H 2VUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCT A; 
#chains in the Genus database with same CATH topology
 1JDE A;  3G6V A;  5JUM A;  1I7N A;  4ECZ A;  2R8J A;  4DV2 H;  4DR4 H;  5FPR A;  2XGP A;  4JV2 A;  3V4S A;  4A3I G;  4LF7 H;  5L1I A;  1HR0 H;  4J9M A;  4IAJ A;  5KG2 A;  4ECS A;  2W6Q A;  3RBE A;  1N33 H;  5IYC G;  4KHP H;  4DL5 A;  4Q44 A;  4ETS A;  1C30 A;  5KFX A;  3BA9 A;  4X62 H;  2HVS A;  4GKK H;  1DV1 A;  4EBD A;  2GLT A;  3G6Y A;  2XCL A;  2FK2 A;  2BQU A;  2NVX A;  4BBS G;  5KT4 A;  4J9K A;  2V9W A;  1UNN C;  4ED0 A;  3KHG A;  3G8C A;  4Q43 A;  3HKZ A;  4ECR A;  1I6U A;  5KFS A;  2HVR A;  1JIH A;  2WB1 A;  2YZG A;  4IRD A;  3MWE A;  4YB8 B;  4HR7 A;  4Q45 A;  4R7R A;  5LMU H;  3GTO A;  1WSC A;  1RJP A;  4EBE A;  4FBT A;  2QK4 A;  5EDW A;  3I12 A;  3EPG A;  3RB4 A;  3MR2 A;  2WAQ A;  2IA6 A;  2E2I A;  2UUA H;  4DV6 H;  1B33 N;  2HVQ A;  2JA7 A;  5CA1 F;  4MTD A;  4UCV A;  2ASD A;  2DZD A;  3G6X A;  2FLP A;  4NLG A;  3PW2 A;  1ZET A;  4MV3 A;  3T5L A;  5CB4 F;  4MV9 A;  2W8K A;  5KG0 A;  3WNZ A;  2R82 A;  3M9N B;  2UUC H;  3PR5 B;  1S03 G;  3H0G A;  3GIK A;  4YR2 A;  2FLN A;  3U9S A;  1KBL A;  2C28 A;  3GTL A;  2W70 A;  3RGX A;  5DG8 A;  3N40 P;  2SCU B;  4RU9 A;  4YBZ B;  3TQ1 A;  3PW7 A;  1X9N A;  1MZB A;  2YRX A;  4PDB A;  5KFP A;  5KFW A;  3VPD A;  4JI3 H;  1S97 A;  4MA0 A;  4DV4 H;  4B3T H;  4M7E A;  4TQS A;  3IG0 A;  3KXY T;  5KFN A;  5T14 A;  1UC8 A;  1M7J A;  4EEQ A;  1L2Z A;  4UFZ A;  3MWM A;  2R8I A;  2R7N A;  4LH7 A;  2ZDH A;  2C35 B;  2JEI A;  4EEY A;  1XMO H;  2YZM A;  4QJF A;  4J0M A;  4F4X A;  1Y14 B;  4HQ6 A;  4RB0 A;  3Q8P B;  2IMW P;  4XYM B;  4QW8 A;  1VBG A;  4ED6 A;  2HGS A;  4YJ2 F;  4YAJ B;  4RUC A;  4ECY A;  4FBU A;  4DR7 H;  5DQG A;  3Q8R B;  5A2Q W;  4EGJ A;  4A3K G;  2FK1 A;  4JI0 H;  1S10 A;  5KFG A;  4ECQ A;  1JX4 A;  1EHI A;  3OTO H;  5DQH A;  4EBC A;  2AU0 A;  4RNM A;  4G3I A;  1Y1W A;  2CKZ B;  3N43 B;  5GON F;  4LSX A;  4UCU A;  2V4Q A;  4TV8 F;  1M6V A;  4DUZ H;  3PN1 A;  3VPC A;  1I3Q A;  2C2D A;  3SI8 A;  5KG4 A;  2W9B B;  5FPO A;  5DG9 A;  4YAK B;  4DR1 H;  1ZHQ A;  5LMN H;  2V59 A;  2RDI A;  3KHH A;  1S0N A;  2C22 A;  1JLL B;  4DV7 H;  4IR9 A;  1ZHS A;  2O03 A;  2V58 A;  1T3N A;  3GV5 B;  2WDT A;  3RAQ A;  4A3B G;  2HHH H;  2YCH A;  1M0T A;  4FM9 A;  2CW7 A;  3RV3 A;  1V4Y A;  5KFH A;  4DUY H;  1SFO A;  2J6S A;  1T94 A;  4RB2 C;  4DL3 A;  4A3M G;  3PW5 A;  4I7H A;  3EYY A;  2ZDG A;  3NGD A;  2OLS A;  1RYS A;  4RZQ A;  2DPI A;  1OWT A;  2VA3 A;  4O2B F;  2OWO A;  3GTQ A;  1ULZ A;  3N6X A;  4ECX A;  3KAK A;  4WD3 A;  5F9N A;  4C5B A;  2YS6 A;  3HOU G;  4O3Q A;  3K3P A;  1O75 A;  3HXL A;  2CW8 A;  3HB9 A;  2Q2U A;  3GV7 B;  2FJZ A;  1BXR A;  4HNT A;  4C5A A;  5EZY F;  4DR2 H;  4BY7 G;  4JI6 H;  3Q8S B;  4ZQI A;  4FS1 A;  5KFD A;  3KAJ A;  4A3D G;  3MWD A;  4J9P A;  4HNU A;  3RFC A;  2VUM G;  1B04 A;  3RUP A;  4DV5 H;  3H0G G;  3T1Y H;  2NU7 B;  1R9T A;  2WYO A;  4O2A F;  4R8U A;  4IZO A;  1TA8 A;  4C2M A;  2R7K A;  3L4K A;  2R7Z G;  2UXB H;  1JDB B;  3GIJ A;  3OHA A;  5EWF A;  4TQR A;  4RNO A;  3RV4 A;  3EPI A;  3V6K A;  5IYD G;  1IBM H;  2GPW A;  4DR6 H;  3RB3 A;  4NXN H;  1WH2 A;  1PX2 A;  4TV9 F;  2KSW A;  2R85 A;  1AN7 A;  3UQ8 A;  2Y0S A;  5KFJ A;  5KX5 F;  3MR6 A;  1RK5 A;  4J9L A;  2C2E A;  4O3S A;  1KJQ A;  5D1O A;  4BBR G;  3CVZ A;  5CA0 F;  1PK8 A;  4HNV A;  4X64 H;  3H40 A;  2R8K A;  2JA5 G;  1K1S A;  1VBH A;  2JA5 A;  5DLF A;  4J9S A;  1IOV A;  1VS0 A;  2M05 A;  3GLK A;  4EFE A;  3GTJ A;  2B63 G;  1EUD B;  4ECU A;  4C5C A;  3JSN A;  2UXD H;  5BMV F;  1V51 A;  2YRW A;  5KFO A;  2YZN A;  1A0I A;  1XMQ H;  1TWG A;  4ECV A;  1RJQ A;  5KFY A;  1EYZ A;  4Q8F A;  5CAE B;  2FLL A;  4A93 G;  5KKN B;  4JI4 H;  2R93 A;  3H20 A;  4AQY H;  2VPS A;  4XYL B;  4ZOL F;  2ZDQ A;  4IR1 A;  4F4Z A;  2J6U A;  2W7P A;  5L1K A;  4JV5 H;  1FKA H;  2QYZ A;  4F50 A;  4YJ3 F;  3HOY G;  2PVP A;  4JUZ A;  2UVW A;  2R92 A;  4O3O A;  3I4N G;  2DLN A;  1SYX B;  4ED2 A;  2FPI B;  3ETJ A;  4APM A;  1SEI A;  2JEF A;  1RYR A;  3MJF A;  2W9C B;  5EWG A;  3BAA A;  2UVR A;  2YL2 A;  3T5J A;  3RGZ A;  5KFM A;  2YW2 A;  2DPJ A;  2HJW A;  3QZ8 A;  3Q1K A;  4DL7 A;  3K5H A;  5K2M A;  3J80 W;  3RF2 A;  3BQ0 A;  5JH7 F;  2I80 A;  4YQW A;  4A3G G;  4ED3 A;  3GTG A;  1DGS A;  1GGO A;  4PWQ A;  1HNZ H;  4UCT A;  4MTE A;  3RB6 A;  3R5X A;  3GTM A;  4JI1 H;  1VKZ A;  3JZI A;  5BPF A;  2AQ4 A;  1B6R A;  3ORR A;  2VA2 A;  3PO2 G;  3FMA A;  4EYI B;  1Y1V A;  4JI5 H;  3WO0 A;  2R86 A;  4L1K A;  3GTP A;  2MCT A;  4MV7 A;  2RGR A;  4NXM H;  4Q0Y A;  5KT5 A;  4FS2 A;  3N8D A;  2OH2 A;  1RK6 A;  5KFF A;  4YP3 A;  2ALZ A;  2RF4 A;  4I4T F;  1KJ8 A;  3JSL A;  2IP4 A;  4IRC A;  4LF5 H;  1K83 A;  3GIQ A;  1CQI B;  4DV1 H;  4MV1 A;  1WCM G;  2ZJT A;  3H3V H;  3N41 B;  5FD5 A;  1GSO A;  4LH6 A;  2WAQ E;  3GIL A;  3E5N A;  1Z2P X;  4ECW A;  4ME6 A;  5LXT F;  4YY3 H;  5KFK A;  5IT9 W;  3JRX A;  4MV8 A;  4A2B A;  4GC6 A;  1JXL A;  5KFU A;  3AYH B;  3HOV G;  4YR0 A;  3MR3 A;  1N34 H;  3ETH A;  5H80 A;  5KFB A;  4X66 H;  4HYK A;  5KFT A;  3OSN A;  4DLK A;  5IP9 G;  3C0F B;  4A3L G;  3BQ1 A;  4R8U B;  4WBN F;  5F9L A;  3KHR A;  1I94 H;  5C44 G;  2W9C A;  2AGO A;  3JRW A;  2W6Z A;  3FDS A;  2PMZ A;  4IHJ F;  4FU0 A;  1W93 A;  5KG5 A;  1BJT A;  5KFQ A;  2WTF A;  4DL6 A;  2CZG A;  1M0W A;  5J2T F;  3TQT A;  4DL2 A;  4RAY A;  4O4I F;  1J5E H;  2W6N A;  2FK3 A;  2R7Z A;  4GKJ H;  2DWC A;  4DV3 H;  3GQC A;  4O3R A;  5DGA A;  2YYA A;  1ZQ7 A;  5KFZ A;  5LA6 F;  4AYB E;  4LF8 H;  3HOW G;  3K5I A;  4JI2 H;  2P0A A;  4LF4 H;  4A3E G;  4A3C G;  5BR8 H;  4XX0 B;  3V6H A;  4X65 H;  3K3V A;  3QFF A;  3R5H A;  3PO3 G;  1KEE A;  1Y1W G;  2UUB H;  3RB0 A;  5I47 A;  1AUX A;  3HOZ G;  4B3S H;  2UU9 H;  4UCS A;  1RJR A;  5KT7 A;  3OHB A;  3BAB A;  5KFR A;  4O4H F;  5KFV A;  2V4R A;  4F4W A;  3FKI A;  4ED8 A;  1Y1V G;  1KJI A;  2VOB A;  5DGB A;  2W9B A;  2DIK A;  4LMY A;  5L1L A;  4I50 F;  4M9U A;  2JA7 G;  2ATL A;  5L1J A;  2R6F A;  2RDJ A;  3TIN A;  4E4T A;  1CQJ B;  1HNX H;  1K1Q A;  5IYB G;  3HBL A;  1A9X A;  3PVX A;  3Q8Q B;  2FMA A;  4DR5 H;  4GC7 A;  2C2R A;  4A3F G;  5DLG A;  3HOX G;  2YS7 A;  3RBD A;  2RGV A;  4A2A A;  4U6P A;  4Y8V B;  1E4E B;  4B3R H;  1N32 H;  3QZ7 A;  2UVV A;  4F4Y A;  5C1O A;  5JVD F;  3BQ2 A;  4RUA A;  4CC5 A;  1IOW A;  4RZR A;  2PBZ A;  4UCO A;  2W7O A;  1XNR H;  1DV2 A;  1E4E A;  4LF9 H;  1DIK A;  3PZP A;  4EFB A;  1BGW A;  3OUU A;  2R93 G;  4JYA H;  3WO1 A;  4CC6 A;  3LML A;  5KT3 A;  4LF6 H;  3M9O B;  2JEJ A;  1HNW H;  2C00 A;  4ZHQ F;  4Q8E A;  1E4F T;  5C3E G;  4QW9 A;  1KJ9 A;  1TAE A;  4DL4 A;  4OX9 H;  4MV4 A;  4QWC A;  3KAL A;  3ORQ A;  1W96 A;  2VUM A;  3BG5 A;  5C1P A;  1EZ1 A;  5LL6 b;  4JI8 H;  1Z2N X;  3GTK A;  3IN5 A;  1UC9 A;  1C3O A;  1S68 A;  4RNN A;  1N56 A;  2W71 A;  4BY1 G;  5IYZ F;  5FD6 A;  1WCM A;  5KT6 A;  2VUG A;  1CE8 A;  4DR3 H;  4DV0 H;  3N44 B;  2NUA B;  2R92 G;  3PW0 A;  4MV6 A;  5C8Y F;  2PN1 A;  2ASL A;  1S0O A;  3Q2O A;  1GO3 E;  5KFA A;  3VMM A;  5C4X G;  2W57 A;  1TWA A;  5IWA H;  2W8L A;  3L2P A;  4J9N A;  4TUY F;  5JQW A;  2F4V H;  3R23 A;  1IBK H;  3N42 B;  3OUZ A;  3RTX A;  1E4G T;  2ZM6 H;  1VAJ A;  3MR5 A;  3LP8 A;  4XZ3 B;  4YHH H;  3M9M B;  3M4I A;  2ASJ A;  2W6P A;  5KFL A;  4UCR A;  5KG6 A;  2NU9 B;  4JI7 H;  1BNC A;  3UFX B;  4LFC H;  1EUC B;  5LOV F;  4ED7 A;  1XDN A;  2IBK A;  2R8H A;  1Z2O X;  3RJ0 A;  2FB9 A;  2NU6 B;  2BR0 A;  4U7C A;  2AGP A;  2FP4 B;  5D8D A;  2PMZ E;  4QIW E;  1SCU B;  2UVU A;  4O3P A;  4BWS C;  4EG0 A;  2XD4 A;  5DQI A;  3GII A;  5EWE A;  5LYJ F;  2R7M A;  3CQZ A;  4I55 F;  2W6M A;  2X0S A;  5IP7 G;  4QWD A;  4IWY A;  4MA5 A;  5FJ8 G;  5KFI A;  3PW4 A;  1P8L A;  2WE6 A;  4O4L F;  1GSA A;  3FKI G;  4AYB A;  1AUV A;  2JA6 G;  1T36 A;  1JKJ B;  3PR4 A;  1FVI A;  5HV6 A;  3SE7 A;  4QIW A;  3KHL A;  1WR2 A;  2VPQ A;  2FPG B;  3F8N A;  4MAM A;  5KG1 A;  5KT2 A;  3T5K A;  4IWX A;  1IBL H;  3H4D A;  3J81 W;  1N48 A;  2BQR A;  1FJG H;  1V9P A;  5EOY A;  3TIG A;  4BXX G;  2GPS A;  4IRK A;  3BJY A;  2NU8 B;  3RIZ A;  2R87 A;  1KC7 A;  4JV0 A;  4RB1 A;  3T1H H;  1GSH A;  4JV1 A;  2JA8 G;  3JAM W;  5J2U F;  3GIP A;  1GLV A;  5L9X A;  5HBR B;  4O3N A;  2UXC H;  2JEG A;  3V4Z A;  1GYF A;  4QWA A;  4QWB A;  5BPH A;  2W6O A;  2R7L A;  4GLX A;  5KG7 A;  3U9T A;  2XIG A;  5JVL A;  2XC9 A;  2YU9 A;  2Q2T A;  2VQD A;  3DF7 A;  2CQY A;  1S9F A;  2FE3 A;  3VPB A;  2XCA A;  4RB3 C;  3V6J A;  2WB1 E;  5D1O B;  1TWH A;  5KG3 A;  1N36 H;  1XNQ H;  1TWC A;  5C5J A;  3HKZ E;  4EGQ A;  1KJJ A;  5DG7 A;  3TII A;  2BQ3 A;  3H4B A;  5KFC A;  2E5L H;  2JA6 A;  2NVY A;  5LP6 F;  2V5A A;  1CS0 A;  2J6T A;  4RAZ A;  2XCP A;  2FPP B;  4ED1 A;  1B6S A;  3MFI A;  3KTM A;  3BA8 A;  4LSA A;  4ZI7 F;  5FLX W;  3MFH A;  2VR1 A;  4QWE A;  2W9A A;  2VQF H;  2B63 A;  3J7A K;  2I87 A;  2R84 A;  4J9O A;  2AGQ A;  3LWB A;  3R5F A;  4LFB H;  2FKL A;  2XGQ A;  3RAX A;  3GID A;  2J9G A;  5FLM G;  4EYH B;  3T5H A;  1S0M A;  1I7L A;  4B3M H;  2E2H A;  3I4M G;  3L4J A;  4J9Q A;  3OSP A;  2Y0S E;  5KFE A;  1TWF A;  4A3J G;  2I8C A;  2VQE H;  2R8G A;  4K0K H;  3GV8 B;  4J9R A;  4LFA H;  3GIM A;  1I50 A;  4YR3 A;  5D1P A;  4ECT A; 
#chains in the Genus database with same CATH homology
 4DV0 H;  3N44 B;  3N6X A;  4LH6 A;  3KAK A;  1Z2P X;  4DV2 H;  4YY3 H;  4DR4 H;  5FPR A;  1O75 A;  5IT9 W;  4LF7 H;  3HXL A;  2CW8 A;  4A2B A;  2Q2U A;  2W57 A;  5IWA H;  1HR0 H;  3L2P A;  4IAJ A;  1N33 H;  1N34 H;  4X66 H;  2F4V H;  4DR2 H;  3N42 B;  1IBK H;  3RTX A;  4KHP H;  1E4G T;  4ETS A;  2ZM6 H;  4JI6 H;  3BA9 A;  4X62 H;  2HVS A;  3C0F B;  4GKK H;  3KAJ A;  4YHH H;  3M4I A;  4UCR A;  1I94 H;  4JI7 H;  1B04 A;  4LFC H;  4DV5 H;  3T1Y H;  1BJT A;  2WYO A;  1XDN A;  1M0W A;  1I6U A;  2HVR A;  1Z2O X;  4RAY A;  3RJ0 A;  1J5E H;  1TA8 A;  4R7R A;  5LMU H;  3L4K A;  4GKJ H;  2UXB H;  4DV3 H;  1IBM H;  5FD5 A;  4BWS C;  2HVQ A;  4DV6 H;  2UUA H;  4JI2 H;  4MTD A;  4LF8 H;  4NXN H;  1WH2 A;  4UCV A;  2KSW A;  4LF4 H;  1AN7 A;  3UQ8 A;  5BR8 H;  4X65 H;  1P8L A;  2WE6 A;  3K3V A;  4MV9 A;  5D1O A;  5FD6 A;  3CVZ A;  4X64 H;  2UUB H;  1FVI A;  4B3S H;  3F8N A;  2UUC H;  2UU9 H;  1S03 G;  4UCS A;  1IBL H;  3J81 W;  1VS0 A;  4EFE A;  3BAB A;  1FJG H;  3JSN A;  3RGX A;  1V9P A;  5EOY A;  3N40 P;  4DR6 H;  2UXD H;  1X9N A;  1MZB A;  4PDB A;  3RIZ A;  1A0I A;  1XMQ H;  4JI3 H;  2VOB A;  4DV4 H;  4B3T H;  4LMY A;  4M7E A;  4RB1 A;  3T1H H;  3IG0 A;  3KXY T;  3JAM W;  1L2Z A;  4EEQ A;  4UFZ A;  3MWM A;  4JI4 H;  3H20 A;  1HNX H;  4AQY H;  2VPS A;  4LH7 A;  2UXC H;  1GYF A;  1XMO H;  4DR5 H;  4J0M A;  4JV5 H;  1FKA H;  4RB0 A;  4GLX A;  2RGV A;  4A2A A;  2XIG A;  1SYX B;  2HGS A;  4B3R H;  2Q2T A;  4DR7 H;  3DF7 A;  4APM A;  1SEI A;  1N32 H;  2FE3 A;  5A2Q W;  4RB3 C;  5D1O B;  1N36 H;  1XNQ H;  3BAA A;  4JI0 H;  3RGZ A;  3OTO H;  4CC5 A;  2E5L H;  4UCO A;  3J80 W;  3N43 B;  3RF2 A;  1XNR H;  4LSX A;  4UCU A;  4LF9 H;  1DGS A;  4RAZ A;  4EFB A;  4DUZ H;  1BGW A;  1HNZ H;  3PN1 A;  4UCT A;  4MTE A;  4JYA H;  3BA8 A;  4LSA A;  5FPO A;  5FLX W;  2VQF H;  4JI1 H;  4CC6 A;  3LML A;  3J7A K;  4LF6 H;  4DR1 H;  1ZHQ A;  5LMN H;  1HNW H;  3FMA A;  1E4F T;  4OX9 H;  4LFB H;  4JI5 H;  1TAE A;  4DV7 H;  1ZHS A;  2O03 A;  2MCT A;  3KAL A;  4MV7 A;  2RGR A;  5LL6 b;  4Q0Y A;  2WDT A;  4B3M H;  4JI8 H;  2HHH H;  1Z2N X;  4NXM H;  2YCH A;  1M0T A;  3L4J A;  2CW7 A;  4DUY H;  4FM9 A;  4RB2 C;  3JSL A;  4LF5 H;  1S68 A;  2VQE H;  4I7H A;  3EYY A;  4K0K H;  4LFA H;  4DV1 H;  2OWO A;  4RZQ A;  2ZJT A;  5D1P A;  3N41 B;  4DR3 H;  2VUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...