2MCTA

Nmr structure of the protein zp_02042476.1 from ruminococcus gnavus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
102
structure length
102
Chain Sequence
GSPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein ZP_02042476.1 from Ruminococcus gnavus.
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 13
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.320 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2mctA00
2MCTA
chains in the Genus database with same CATH superfamily
2C35B 5I47A 3Q8PB 3JSNA 3RGXA 2VPSA 2NU7B 1CQIB 3JRXA 1Y1WG 2QYZA 4JI8H 4NLGA 3IG0A 5L1IA 2RDJA 2PBZA 4TV9F 4BWSC 3H3VH 2R8IA 4C2MA 3KHLA 5BR8H 4JI1H 1ZQ7A 2BQUA 4DL5A 4X65H 3GTLA 2ZM6H 4ED2A 3PVXA 4LFBH 3J81W 4XYMB 4LSXA 3LP8A 1GSAA 2J6TA 1I7NA 3TINA 3WNZA 1BJTA 2GPSA 3V6HA 1PX2A 2W6ZA 4UFZA 4JI2H 3TIIA 4QW9A 2BQRA 1RK5A 4MV6A 4TQSA 4HNUA 2HHHH 3T5JA 3GTPA 5DGBA 3L4KA 1EZ1A 4ECSA 2W6QA 4RUCA 4A3FG 4E4TA 1B6SA 1ULZA 5KFHA 2FMAA 3KHHA 4DR3H 4F4ZA 3TQTA 4M9UA 4DL3A 4O4HF 2ALZA 3JSLA 3PO3G 1N32H 3RAXA 2CW7A 4TV8F 2ATLA 2NVYA 4AQYH 3FMAA 5F9NA 2HVRA 1XNRH 3L2PA 4JUZA 2GLTA 5DLGA 1E4GT 2FLNA 3HXLA 5C4XG 1IOVA 2V58A 2WAQA 1RJPA 4O2AF 1T36A 1TWFA 5IYDG 4A3GG 4U6PA 4FBUA 1WH2A 3Q1KA 3N44B 3Q2OA 2V4QA 3GIKA 5CA1F 4ED1A 4X64H 1B6RA 3RV3A 4HQ6A 1TA8A 4HNVA 2AQ4A 3C0FB 2UXDH 2YRXA 3HOXG 1WSCA 2JA6A 4YBZB 4B3SH 1WCMA 1AN7A 1KJJA 1OWTA 2FK1A 3RBDA 3BA9A 4MV8A 3V4SA 5FLXW 4M7EA 3GIJA 5LMUH 4Q8EA 2JA7G 1DV1A 3OUUA 5KG6A 2W8KA 1HNWH 4ECQA 1DGSA 1Z2PX 4EGQA 1ZHSA 4OX9H 4FS2A 3HOVG 3RB0A 2JEIA 1CS0A 5IYZF 5DGAA 3MWMA 3V6JA 3N6XA 1I50A 2R92G 3HOZG 5EZYF 2B63A 5H80A 4CC5A 3H4BA 2VQFH 4J9SA 3VPDA 1XDNA 3Q8SB 2WE6A 3RF2A 3UFXB 2V5AA 4ECVA 3BQ1A 2YS7A 5F9LA 1I6UA 3GQCA 4ECUA 1I3QA 4DR6H 1XNQH 4FS1A 3H40A 5KFJA 1RYRA 3DF7A 4JV5H 2XIGA 2UVUA 4YAKB 4ZHQF 4EYHB 2WDTA 4YB8B 3GTGA 5DQHA 5FJ8G 5KFAA 3J7AK 4JI0H 5C1OA 4YP3A 4LF9H 3GTMA 3K5IA 2PVPA 2UVWA 4MA5A 4RZQA 5KT7A 5BPFA 5L1LA 4YY3H 1Z2OX 1B33N 4EGJA 4BY1G 2CKZB 2FP4B 4DR1H 4QJFA 2R7MA 2GPWA 2MCTA 4ED6A 3RFCA 4DLKA 4Q43A 2UUCH 3ORQA 5JH7F 3OUZA 4EBDA 4O3OA 1GO3E 1GSHA 1JLLB 4UCVA 3SE7A 5FD5A 4QW8A 4DL4A 4F4YA 4EG0A 4RU9A 1IBKH 4ED8A 5DQIA 2UVVA 2Q2UA 5IWAH 5KFTA 5DQGA 5KFCA 1SEIA 2VUGA 4TQRA 1N34H 3TQ1A 3RBEA 5HBRB 2IP4A 5T14A 3ORRA 4RB1A 4ECWA 1M0WA 4ECXA 4U7CA 1JKJB 1IOWA 2J9GA 1K1SA 4RAYA 5DLFA 3M4IA 3PW5A 1FKAH 4I55F 2JA6G 2FK2A 2FKLA 1WCMG 3T5LA 4IAJA 5L1KA 5IP9G 2C28A 4BXXG 2JA5G 1M7JA 3GILA 4LF4H 1N33H 1PK8A 3QZ7A 4ZOLF 4DV6H 2YZGA 2AGPA 2M05A 5IP7G 2UUAH 3GIIA 4GLXA 3H0GG 4MTDA 1VAJA 4BBRG 2R84A 3OHAA 2DWCA 5KFGA 5BMVF 3RJ0A 2B63G 4A3CG 4DUYH 2UVRA 1Y1VA 4I4TF 3WO0A 3RAQA 4LF7H 3OSNA 3L4JA 4Y8VB 2W70A 4DL6A 2VUMA 3WO1A 3M9NB 1N48A 4ED7A 3GV7B 4ECZA 4GKKH 4F50A 3FKIA 1GGOA 1K1QA 4DV7H 5C1PA 3K5HA 4J9RA 4FU0A 2AU0A 1A0IA 1BGWA 4A2AA 4DR4H 3RTXA 3NGDA 1V9PA 4EBCA 3RB4A 4GC6A 4QWEA 1R9TA 1V51A 2V9WA 4UCSA 1KJQA 2CQYA 2FK3A 4X62H 5FPRA 5IYCG 2WTFA 4MV7A 4EEYA 5KFVA 1L2ZA 3G8CA 3Q8RB 2J6SA 1UC9A 1M0TA 5KFIA 4ECTA 4DL2A 1K83A 1Y14B 2DLNA 5D8DA 3RV4A 5KT4A 2R7NA 1BXRA 2C2DA 1B04A 5LMNH 4DV2H 2J6UA 3GTOA 2W7OA 2XCPA 3UQ8A 3KAJA 4HYKA 4IZOA 5DG8A 2AGOA 2UXCH 2DZDA 1IBLH 3HOYG 3K3VA 5LYJF 2C22A 2BR0A 3ETHA 3MWEA 5D1PA 5CA0F 5KFSA 3PR5B 2Y0SE 1KEEA 4UCRA 3I4NG 2R7ZA 1RJRA 4RZRA 4LF6H 4LH7A 4RB2C 4LF5H 5C8YF 4YJ3F 4DV5H 5GONF 5A2QW 2W9CA 2E2IA 5KG0A 5KKNB 5KFPA 4EEQA 3HOWG 2HGSA 1I7LA 2NUAB 2C00A 2I8CA 3HKZE 3QFFA 3IN5A 2JA8G 3GV8B 1MZBA 3BG5A 4J9KA 2VOBA 5C44G 5IYBG 4IRCA 2R8JA 4MV1A 2RGRA 2YZMA 2ZJTA 2FLPA 1GSOA 5BPHA 3G6XA 2W9CB 2ASJA 2PN1A 1HNXH 4RAZA 2YL2A 2R93A 3KALA 1T3NA 5LP6F 3JZIA 3T5HA 2UUBH 3VPBA 4C5CA 1KJ9A 5C3EG 1KJ8A 3PW2A 1C3OA 4ZQIA 1S10A 3LMLA 5KG7A 4ED0A 3RIZA 4RNMA 3R5XA 4YR0A 1VBGA 4O2BF 3FKIG 4HR7A 4A3LG 1EUDB 1TWAA 4JI3H 4XZ3B 3F8NA 3N42B 5K2MA 4RNOA 2ASDA 5CAEB 4WBNF 3GTKA 4DR2H 2R82A 2NU6B 1RJQA 4ME6A 1A9XA 5KFRA 4DUZH 4JYAH 5KT2A 2JEJA 4A93G 4RUAA 4IRKA 2C2EA 2Q2TA 4J9MA 4DV3H 4O3NA 2FPIB 2ZDGA 5LA6F 3N40P 3AYHB 5KFYA 2DPIA 3BQ0A 4EYIB 1E4FT 1TWHA 5KG1A 2W71A 3GV5B 2P0AA 4J0MA 4ED3A 2W7PA 3BQ2A 2XCLA 5D1OA 4RB3C 1KC7A 1S97A 3I12A 1W93A 5KG2A 4Q44A 3G6VA 1X9NA 2R7LA 1S68A 4JI5H 5JUMA 4O4LF 5KFMA 5JVLA 4O3PA 3T1YH 2PMZE 3BA8A 1S03G 2R7ZG 1TAEA 4R8UA 4MV3A 5D1OB 1SYXB 4A3IG 1HNZH 5KFOA 3BJYA 2W6OA 2VQDA 3GTJA 5L9XA 1N56A 4XX0B 2R8KA 4NXNH 2VQEH 3H4DA 2OWOA 2R7KA 1VBHA 4O3QA 1VS0A 1AUXA 2NVXA 2Y0SA 2WB1A 4ECRA 2OLSA 2CZGA 2RGVA 4R8UB 4BY7G 1CQJB 4B3TH 2E2HA 2YS6A 3RGZA 4J9PA 3LWBA 4YJ2F 4A3BG 3RB3A 2UXBH 4YHHH 4IHJF 2R8HA 4EFBA 4RNNA 2VR1A 3ETJA 4L1KA 3GIQA 5KFZA 1E4EA 1SCUB 2ZDHA 3HKZA 5KG4A 5KFKA 4LF8H 4WD3A 4TUYF 5KX5F 4A3KG 2XD4A 4IRDA 2R92A 3BAAA 2VPQA 3MR3A 4QWCA 4DR7H 2WYOA 3BABA 4I50F 3PW7A 4IR1A 4O4IF 4YR3A 4LFAH 2YZNA 3MR5A 5KFFA 5FLMG 4A3EG 4J9QA 5DG9A 3TIGA 2FJZA 3HBLA 5KG3A 3U9SA 1UC8A 1TWCA 5JVDF 1P8LA 1E4EB 3KHRA 1DIKA 1T94A 3J80W 3KHGA 5KFNA 4Q8FA 2QK4A 2R8GA 2AGQA 5KFEA 2HVQA 2RF4A 2NU9B 1EUCB 1XMOH 1S9FA 5KFWA 4A3JG 3RB6A 4GC7A 3PZPA 4K0KH 4I7HA 2XGPA 2JEGA 4MV4A 4F4XA 1W96A 5EDWA 4LSAA 3I4MG 4Q0YA 4IWYA 2XC9A 3MR2A 4QWDA 2BQ3A 1ZETA 3HOUG 2W9BA 3PR4A 4J9OA 1JXLA 2OH2A 3T1HH 3U9TA 1I94H 2O03A 3VPCA 3GTQA 4PDBA 3GIMA 1RYSA 2WB1E 2YYAA 1EYZA 3FDSA 3PW0A 2IA6A 3OTOH 4J9NA 4DV4H 2YCHA 1XMQH 3M9MB 2F4VH 3PO2G 4R7RA 5KT3A 1JIHA 4F4WA 2V4RA 4FM9A 1S0NA 4HNTA 4KHPH 2W9BB 3M9OB 4JV2A 3PN1A 4JV1A 2YRWA 3EYYA 4LH6A 1VKZA 4O3RA 5KFXA 3G6YA 1EHIA 5DG7A 3R5HA 5KFBA 3Q8QB 1SFOA 4QWBA 2NU8B 1S0MA 3OHBA 4DL7A 4EFEA 3GIDA 2PMZA 2VA3A 2E5LH 4FBTA 3GIPA 3N43B 4IWXA 2UU9H 2CW8A 3KTMA 5LXTF 4A3DG 4IR9A 4QIWA 1J5EH 2IBKA 2VA2A 2JA5A 2R6FA 4XYLB 1FVIA 1Y1VG 2FB9A 4JV0A 3E5NA 1KBLA 5KG5A 5KFUA 4YQWA 3MFIA 1Y1WA 1HR0H 4AYBA 4NXMH 2W6NA 4O3SA 4DV0H 2I87A 2IMWP 1IBMH 5CB4F 3H0GA 2W57A 5KFLA 3V4ZA 2VUMG 5IT9W 3KAKA 4X66H 3H20A 2FPPB 3N41B 4MAMA 3MWDA 2W8LA 1ZHQA 4ECYA 3V6KA 2YU9A 4APMA 1S0OA 4DV1H 1WR2A 2KSWA 5EWFA 2ASLA 4LFCH 4C5BA 4DR5H 1DV2A 2RDIA 2SCUB 2R85A 5FPOA 2R86A 3HB9A 4UCTA 2DPJA 3MJFA 2FE3A 2XGQA 4EBEA 4BBSG 4QWAA 3CVZA 2HVSA 3RUPA 2W9AA 3JAMW 1M6VA 3CQZA 3R23A 1AUVA 5J2UF 2JEFA 2WAQE 5KFQA 1JX4A 4MA0A 1O75A 5LL6b 3QZ8A 5KT6A 5L1JA 3MFHA 2DIKA 2YW2A 3KXYT 4LMYA 4MTEA 5C5JA 5KT5A 4Q45A 2X0SA 4ETSA 4B3RH 1C30A 4YR2A 1V4YA 4YAJB 4CC6A 1BNCA 4MV9A 3MR6A 2HJWA 4UCUA 2R87A 5J2TF 3GLKA 5LOVF 4G3IA 5KFDA 1RK6A 1Z2NX 1JDBB 5EWEA 4JI4H 4QIWE 5FD6A 3EPIA 1N36H 1FJGH 3JRWA 2V59A 4JI6H 1UNNC 3OSPA 4C5AA 1JDEA 1KJIA 3R5FA 4AYBE 2ZDQA 2I80A 1GLVA 4UCOA 3T5KA 4A3MG 1CE8A 5HV6A 2W6MA 4RB0A 3PW4A 3EPGA 5EOYA 2C2RA 1TWGA 4B3MH 3SI8A 4A2BA 4J9LA 1GYFA 4ZI7F 2JA7A 2XCAA 3VMMA 4PWQA 2FPGB 4GKJH 4JI7H 3N8DA 2FLLA 3K3PA 2W6PA 5EWGA 5JQWA 2R93G
chains in the Genus database with same CATH topology
3JSNA 3RGXA 2VPSA 2UUCH 4DR7H 1HNXH 4RAZA 1I94H 4JI8H 2O03A 3IG0A 3KALA 4PDBA 2UUBH 4JI3H 4BWSC 3OTOH 4UCVA 4DV4H 2YCHA 5FD5A 1XMQH 2F4VH 5BR8H 1IBKH 4JI1H 4X65H 4R7RA 2Q2UA 2ZM6H 5IWAH 3LMLA 4LFBH 3J81W 3RIZA 4FM9A 4KHPH 4LSXA 1SEIA 2VUGA 1N34H 3PN1A 4RB1A 1M0WA 1BJTA 3EYYA 4UFZA 4LH6A 4JI2H 3F8NA 3N42B 4RAYA 3M4IA 1FKAH 4DR2H 4JYAH 4DUZH 2HHHH 4IAJA 3L4KA 2Q2TA 4DV3H 4EFEA 4LF4H 2E5LH 3N40P 1N33H 3N43B 1E4FT 4DV6H 4DR3H 2UU9H 2CW8A 4J0MA 2UUAH 3JSLA 1N32H 1J5EH 2CW7A 4GLXA 1FVIA 4MTDA 4AQYH 3T1HH 5D1OA 3FMAA 4RB3C 2HVRA 1XNRH 3L2PA 1HR0H 4NXMH 3RJ0A 4DV0H 4DUYH 1E4GT 1IBMH 2W57A 3HXLA 1X9NA 4LF7H 5IT9W 3KAKA 4X66H 3H20A 3N41B 1S68A 3L4JA 4JI5H 1ZHQA 4APMA 1WH2A 4DV1H 3N44B 3T1YH 2KSWA 3BA8A 4LFCH 1S03G 4GKKH 4X64H 4DR5H 1TAEA 4DV7H 5D1OB 1SYXB 5FPOA 4UCTA 1HNZH 2RGRA 1TA8A 3C0FB 2UXDH 2FE3A 1A0IA 1BGWA 4A2AA 4DR4H 4B3SH 3CVZA 2HVSA 3RTXA 4NXNH 1AN7A 2VQEH 1V9PA 3JAMW 2OWOA 3BA9A 5FLXW 1VS0A 4M7EA 5LMUH 4UCSA 1O75A 2RGVA 5LL6b 4X62H 5FPRA 4B3TH 1HNWH 3KXYT 4MV7A 4LMYA 1DGSA 4MTEA 3RGZA 1L2ZA 1Z2PX 4OX9H 1ZHSA 4ETSA 4B3RH 2UXBH 4YHHH 1M0TA 3MWMA 3N6XA 4EFBA 4CC6A 4CC5A 4MV9A 1B04A 2VQFH 5LMNH 4DV2H 1XDNA 4UCUA 4LF8H 2WE6A 3RF2A 3UQ8A 3KAJA 3BAAA 2UXCH 1I6UA 1IBLH 4DR6H 1Z2NX 2WYOA 3BABA 3K3VA 4JI4H 5D1PA 5FD6A 1N36H 1FJGH 4LFAH 3DF7A 4UCRA 4JV5H 2XIGA 4JI6H 2WDTA 4LF6H 4LH7A 4RB2C 4LF5H 4UCOA 1P8LA 3J80W 4DV5H 4RB0A 5A2QW 4JI0H 3J7AK 5EOYA 4B3MH 4EEQA 2HGSA 4LF9H 4A2BA 2HVQA 1GYFA 2ZJTA 1XMOH 4RZQA 1MZBA 4K0KH 4GKJH 4I7HA 4YY3H 1Z2OX 4JI7H 2VOBA 1XNQH 4LSAA 4DR1H 4Q0YA 2MCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCT A; 
#chains in the Genus database with same CATH topology
 2C35 B;  5I47 A;  3Q8P B;  3JSN A;  3RGX A;  2VPS A;  2NU7 B;  1CQI B;  3JRX A;  1Y1W G;  2QYZ A;  4JI8 H;  4NLG A;  3IG0 A;  5L1I A;  2RDJ A;  2PBZ A;  4TV9 F;  4BWS C;  3H3V H;  2R8I A;  4C2M A;  3KHL A;  5BR8 H;  4JI1 H;  1ZQ7 A;  2BQU A;  4DL5 A;  4X65 H;  3GTL A;  2ZM6 H;  4ED2 A;  3PVX A;  4LFB H;  3J81 W;  4XYM B;  4LSX A;  3LP8 A;  1GSA A;  2J6T A;  1I7N A;  3TIN A;  3WNZ A;  1BJT A;  2GPS A;  3V6H A;  1PX2 A;  2W6Z A;  4UFZ A;  4JI2 H;  3TII A;  4QW9 A;  2BQR A;  1RK5 A;  4MV6 A;  4TQS A;  4HNU A;  2HHH H;  3T5J A;  3GTP A;  5DGB A;  3L4K A;  1EZ1 A;  4ECS A;  2W6Q A;  4RUC A;  4A3F G;  4E4T A;  1B6S A;  1ULZ A;  5KFH A;  2FMA A;  3KHH A;  4DR3 H;  4F4Z A;  3TQT A;  4M9U A;  4DL3 A;  4O4H F;  2ALZ A;  3JSL A;  3PO3 G;  1N32 H;  3RAX A;  2CW7 A;  4TV8 F;  2ATL A;  2NVY A;  4AQY H;  3FMA A;  5F9N A;  2HVR A;  1XNR H;  3L2P A;  4JUZ A;  2GLT A;  5DLG A;  1E4G T;  2FLN A;  3HXL A;  5C4X G;  1IOV A;  2V58 A;  2WAQ A;  1RJP A;  4O2A F;  1T36 A;  1TWF A;  5IYD G;  4A3G G;  4U6P A;  4FBU A;  1WH2 A;  3Q1K A;  3N44 B;  3Q2O A;  2V4Q A;  3GIK A;  5CA1 F;  4ED1 A;  4X64 H;  1B6R A;  3RV3 A;  4HQ6 A;  1TA8 A;  4HNV A;  2AQ4 A;  3C0F B;  2UXD H;  2YRX A;  3HOX G;  1WSC A;  2JA6 A;  4YBZ B;  4B3S H;  1WCM A;  1AN7 A;  1KJJ A;  1OWT A;  2FK1 A;  3RBD A;  3BA9 A;  4MV8 A;  3V4S A;  5FLX W;  4M7E A;  3GIJ A;  5LMU H;  4Q8E A;  2JA7 G;  1DV1 A;  3OUU A;  5KG6 A;  2W8K A;  1HNW H;  4ECQ A;  1DGS A;  1Z2P X;  4EGQ A;  1ZHS A;  4OX9 H;  4FS2 A;  3HOV G;  3RB0 A;  2JEI A;  1CS0 A;  5IYZ F;  5DGA A;  3MWM A;  3V6J A;  3N6X A;  1I50 A;  2R92 G;  3HOZ G;  5EZY F;  2B63 A;  5H80 A;  4CC5 A;  3H4B A;  2VQF H;  4J9S A;  3VPD A;  1XDN A;  3Q8S B;  2WE6 A;  3RF2 A;  3UFX B;  2V5A A;  4ECV A;  3BQ1 A;  2YS7 A;  5F9L A;  1I6U A;  3GQC A;  4ECU A;  1I3Q A;  4DR6 H;  1XNQ H;  4FS1 A;  3H40 A;  5KFJ A;  1RYR A;  3DF7 A;  4JV5 H;  2XIG A;  2UVU A;  4YAK B;  4ZHQ F;  4EYH B;  2WDT A;  4YB8 B;  3GTG A;  5DQH A;  5FJ8 G;  5KFA A;  3J7A K;  4JI0 H;  5C1O A;  4YP3 A;  4LF9 H;  3GTM A;  3K5I A;  2PVP A;  2UVW A;  4MA5 A;  4RZQ A;  5KT7 A;  5BPF A;  5L1L A;  4YY3 H;  1Z2O X;  1B33 N;  4EGJ A;  4BY1 G;  2CKZ B;  2FP4 B;  4DR1 H;  4QJF A;  2R7M A;  2GPW A;  2MCT A;  4ED6 A;  3RFC A;  4DLK A;  4Q43 A;  2UUC H;  3ORQ A;  5JH7 F;  3OUZ A;  4EBD A;  4O3O A;  1GO3 E;  1GSH A;  1JLL B;  4UCV A;  3SE7 A;  5FD5 A;  4QW8 A;  4DL4 A;  4F4Y A;  4EG0 A;  4RU9 A;  1IBK H;  4ED8 A;  5DQI A;  2UVV A;  2Q2U A;  5IWA H;  5KFT A;  5DQG A;  5KFC A;  1SEI A;  2VUG A;  4TQR A;  1N34 H;  3TQ1 A;  3RBE A;  5HBR B;  2IP4 A;  5T14 A;  3ORR A;  4RB1 A;  4ECW A;  1M0W A;  4ECX A;  4U7C A;  1JKJ B;  1IOW A;  2J9G A;  1K1S A;  4RAY A;  5DLF A;  3M4I A;  3PW5 A;  1FKA H;  4I55 F;  2JA6 G;  2FK2 A;  2FKL A;  1WCM G;  3T5L A;  4IAJ A;  5L1K A;  5IP9 G;  2C28 A;  4BXX G;  2JA5 G;  1M7J A;  3GIL A;  4LF4 H;  1N33 H;  1PK8 A;  3QZ7 A;  4ZOL F;  4DV6 H;  2YZG A;  2AGP A;  2M05 A;  5IP7 G;  2UUA H;  3GII A;  4GLX A;  3H0G G;  4MTD A;  1VAJ A;  4BBR G;  2R84 A;  3OHA A;  2DWC A;  5KFG A;  5BMV F;  3RJ0 A;  2B63 G;  4A3C G;  4DUY H;  2UVR A;  1Y1V A;  4I4T F;  3WO0 A;  3RAQ A;  4LF7 H;  3OSN A;  3L4J A;  4Y8V B;  2W70 A;  4DL6 A;  2VUM A;  3WO1 A;  3M9N B;  1N48 A;  4ED7 A;  3GV7 B;  4ECZ A;  4GKK H;  4F50 A;  3FKI A;  1GGO A;  1K1Q A;  4DV7 H;  5C1P A;  3K5H A;  4J9R A;  4FU0 A;  2AU0 A;  1A0I A;  1BGW A;  4A2A A;  4DR4 H;  3RTX A;  3NGD A;  1V9P A;  4EBC A;  3RB4 A;  4GC6 A;  4QWE A;  1R9T A;  1V51 A;  2V9W A;  4UCS A;  1KJQ A;  2CQY A;  2FK3 A;  4X62 H;  5FPR A;  5IYC G;  2WTF A;  4MV7 A;  4EEY A;  5KFV A;  1L2Z A;  3G8C A;  3Q8R B;  2J6S A;  1UC9 A;  1M0T A;  5KFI A;  4ECT A;  4DL2 A;  1K83 A;  1Y14 B;  2DLN A;  5D8D A;  3RV4 A;  5KT4 A;  2R7N A;  1BXR A;  2C2D A;  1B04 A;  5LMN H;  4DV2 H;  2J6U A;  3GTO A;  2W7O A;  2XCP A;  3UQ8 A;  3KAJ A;  4HYK A;  4IZO A;  5DG8 A;  2AGO A;  2UXC H;  2DZD A;  1IBL H;  3HOY G;  3K3V A;  5LYJ F;  2C22 A;  2BR0 A;  3ETH A;  3MWE A;  5D1P A;  5CA0 F;  5KFS A;  3PR5 B;  2Y0S E;  1KEE A;  4UCR A;  3I4N G;  2R7Z A;  1RJR A;  4RZR A;  4LF6 H;  4LH7 A;  4RB2 C;  4LF5 H;  5C8Y F;  4YJ3 F;  4DV5 H;  5GON F;  5A2Q W;  2W9C A;  2E2I A;  5KG0 A;  5KKN B;  5KFP A;  4EEQ A;  3HOW G;  2HGS A;  1I7L A;  2NUA B;  2C00 A;  2I8C A;  3HKZ E;  3QFF A;  3IN5 A;  2JA8 G;  3GV8 B;  1MZB A;  3BG5 A;  4J9K A;  2VOB A;  5C44 G;  5IYB G;  4IRC A;  2R8J A;  4MV1 A;  2RGR A;  2YZM A;  2ZJT A;  2FLP A;  1GSO A;  5BPH A;  3G6X A;  2W9C B;  2ASJ A;  2PN1 A;  1HNX H;  4RAZ A;  2YL2 A;  2R93 A;  3KAL A;  1T3N A;  5LP6 F;  3JZI A;  3T5H A;  2UUB H;  3VPB A;  4C5C A;  1KJ9 A;  5C3E G;  1KJ8 A;  3PW2 A;  1C3O A;  4ZQI A;  1S10 A;  3LML A;  5KG7 A;  4ED0 A;  3RIZ A;  4RNM A;  3R5X A;  4YR0 A;  1VBG A;  4O2B F;  3FKI G;  4HR7 A;  4A3L G;  1EUD B;  1TWA A;  4JI3 H;  4XZ3 B;  3F8N A;  3N42 B;  5K2M A;  4RNO A;  2ASD A;  5CAE B;  4WBN F;  3GTK A;  4DR2 H;  2R82 A;  2NU6 B;  1RJQ A;  4ME6 A;  1A9X A;  5KFR A;  4DUZ H;  4JYA H;  5KT2 A;  2JEJ A;  4A93 G;  4RUA A;  4IRK A;  2C2E A;  2Q2T A;  4J9M A;  4DV3 H;  4O3N A;  2FPI B;  2ZDG A;  5LA6 F;  3N40 P;  3AYH B;  5KFY A;  2DPI A;  3BQ0 A;  4EYI B;  1E4F T;  1TWH A;  5KG1 A;  2W71 A;  3GV5 B;  2P0A A;  4J0M A;  4ED3 A;  2W7P A;  3BQ2 A;  2XCL A;  5D1O A;  4RB3 C;  1KC7 A;  1S97 A;  3I12 A;  1W93 A;  5KG2 A;  4Q44 A;  3G6V A;  1X9N A;  2R7L A;  1S68 A;  4JI5 H;  5JUM A;  4O4L F;  5KFM A;  5JVL A;  4O3P A;  3T1Y H;  2PMZ E;  3BA8 A;  1S03 G;  2R7Z G;  1TAE A;  4R8U A;  4MV3 A;  5D1O B;  1SYX B;  4A3I G;  1HNZ H;  5KFO A;  3BJY A;  2W6O A;  2VQD A;  3GTJ A;  5L9X A;  1N56 A;  4XX0 B;  2R8K A;  4NXN H;  2VQE H;  3H4D A;  2OWO A;  2R7K A;  1VBH A;  4O3Q A;  1VS0 A;  1AUX A;  2NVX A;  2Y0S A;  2WB1 A;  4ECR A;  2OLS A;  2CZG A;  2RGV A;  4R8U B;  4BY7 G;  1CQJ B;  4B3T H;  2E2H A;  2YS6 A;  3RGZ A;  4J9P A;  3LWB A;  4YJ2 F;  4A3B G;  3RB3 A;  2UXB H;  4YHH H;  4IHJ F;  2R8H A;  4EFB A;  4RNN A;  2VR1 A;  3ETJ A;  4L1K A;  3GIQ A;  5KFZ A;  1E4E A;  1SCU B;  2ZDH A;  3HKZ A;  5KG4 A;  5KFK A;  4LF8 H;  4WD3 A;  4TUY F;  5KX5 F;  4A3K G;  2XD4 A;  4IRD A;  2R92 A;  3BAA A;  2VPQ A;  3MR3 A;  4QWC A;  4DR7 H;  2WYO A;  3BAB A;  4I50 F;  3PW7 A;  4IR1 A;  4O4I F;  4YR3 A;  4LFA H;  2YZN A;  3MR5 A;  5KFF A;  5FLM G;  4A3E G;  4J9Q A;  5DG9 A;  3TIG A;  2FJZ A;  3HBL A;  5KG3 A;  3U9S A;  1UC8 A;  1TWC A;  5JVD F;  1P8L A;  1E4E B;  3KHR A;  1DIK A;  1T94 A;  3J80 W;  3KHG A;  5KFN A;  4Q8F A;  2QK4 A;  2R8G A;  2AGQ A;  5KFE A;  2HVQ A;  2RF4 A;  2NU9 B;  1EUC B;  1XMO H;  1S9F A;  5KFW A;  4A3J G;  3RB6 A;  4GC7 A;  3PZP A;  4K0K H;  4I7H A;  2XGP A;  2JEG A;  4MV4 A;  4F4X A;  1W96 A;  5EDW A;  4LSA A;  3I4M G;  4Q0Y A;  4IWY A;  2XC9 A;  3MR2 A;  4QWD A;  2BQ3 A;  1ZET A;  3HOU G;  2W9B A;  3PR4 A;  4J9O A;  1JXL A;  2OH2 A;  3T1H H;  3U9T A;  1I94 H;  2O03 A;  3VPC A;  3GTQ A;  4PDB A;  3GIM A;  1RYS A;  2WB1 E;  2YYA A;  1EYZ A;  3FDS A;  3PW0 A;  2IA6 A;  3OTO H;  4J9N A;  4DV4 H;  2YCH A;  1XMQ H;  3M9M B;  2F4V H;  3PO2 G;  4R7R A;  5KT3 A;  1JIH A;  4F4W A;  2V4R A;  4FM9 A;  1S0N A;  4HNT A;  4KHP H;  2W9B B;  3M9O B;  4JV2 A;  3PN1 A;  4JV1 A;  2YRW A;  3EYY A;  4LH6 A;  1VKZ A;  4O3R A;  5KFX A;  3G6Y A;  1EHI A;  5DG7 A;  3R5H A;  5KFB A;  3Q8Q B;  1SFO A;  4QWB A;  2NU8 B;  1S0M A;  3OHB A;  4DL7 A;  4EFE A;  3GID A;  2PMZ A;  2VA3 A;  2E5L H;  4FBT A;  3GIP A;  3N43 B;  4IWX A;  2UU9 H;  2CW8 A;  3KTM A;  5LXT F;  4A3D G;  4IR9 A;  4QIW A;  1J5E H;  2IBK A;  2VA2 A;  2JA5 A;  2R6F A;  4XYL B;  1FVI A;  1Y1V G;  2FB9 A;  4JV0 A;  3E5N A;  1KBL A;  5KG5 A;  5KFU A;  4YQW A;  3MFI A;  1Y1W A;  1HR0 H;  4AYB A;  4NXM H;  2W6N A;  4O3S A;  4DV0 H;  2I87 A;  2IMW P;  1IBM H;  5CB4 F;  3H0G A;  2W57 A;  5KFL A;  3V4Z A;  2VUM G;  5IT9 W;  3KAK A;  4X66 H;  3H20 A;  2FPP B;  3N41 B;  4MAM A;  3MWD A;  2W8L A;  1ZHQ A;  4ECY A;  3V6K A;  2YU9 A;  4APM A;  1S0O A;  4DV1 H;  1WR2 A;  2KSW A;  5EWF A;  2ASL A;  4LFC H;  4C5B A;  4DR5 H;  1DV2 A;  2RDI A;  2SCU B;  2R85 A;  5FPO A;  2R86 A;  3HB9 A;  4UCT A;  2DPJ A;  3MJF A;  2FE3 A;  2XGQ A;  4EBE A;  4BBS G;  4QWA A;  3CVZ A;  2HVS A;  3RUP A;  2W9A A;  3JAM W;  1M6V A;  3CQZ A;  3R23 A;  1AUV A;  5J2U F;  2JEF A;  2WAQ E;  5KFQ A;  1JX4 A;  4MA0 A;  1O75 A;  5LL6 b;  3QZ8 A;  5KT6 A;  5L1J A;  3MFH A;  2DIK A;  2YW2 A;  3KXY T;  4LMY A;  4MTE A;  5C5J A;  5KT5 A;  4Q45 A;  2X0S A;  4ETS A;  4B3R H;  1C30 A;  4YR2 A;  1V4Y A;  4YAJ B;  4CC6 A;  1BNC A;  4MV9 A;  3MR6 A;  2HJW A;  4UCU A;  2R87 A;  5J2T F;  3GLK A;  5LOV F;  4G3I A;  5KFD A;  1RK6 A;  1Z2N X;  1JDB B;  5EWE A;  4JI4 H;  4QIW E;  5FD6 A;  3EPI A;  1N36 H;  1FJG H;  3JRW A;  2V59 A;  4JI6 H;  1UNN C;  3OSP A;  4C5A A;  1JDE A;  1KJI A;  3R5F A;  4AYB E;  2ZDQ A;  2I80 A;  1GLV A;  4UCO A;  3T5K A;  4A3M G;  1CE8 A;  5HV6 A;  2W6M A;  4RB0 A;  3PW4 A;  3EPG A;  5EOY A;  2C2R A;  1TWG A;  4B3M H;  3SI8 A;  4A2B A;  4J9L A;  1GYF A;  4ZI7 F;  2JA7 A;  2XCA A;  3VMM A;  4PWQ A;  2FPG B;  4GKJ H;  4JI7 H;  3N8D A;  2FLL A;  3K3P A;  2W6P A;  5EWG A;  5JQW A;  2R93 G; 
#chains in the Genus database with same CATH homology
 3JSN A;  3RGX A;  2VPS A;  2UUC H;  4DR7 H;  1HNX H;  4RAZ A;  1I94 H;  4JI8 H;  2O03 A;  3IG0 A;  3KAL A;  4PDB A;  2UUB H;  4JI3 H;  4BWS C;  3OTO H;  4UCV A;  4DV4 H;  2YCH A;  5FD5 A;  1XMQ H;  2F4V H;  5BR8 H;  1IBK H;  4JI1 H;  4X65 H;  4R7R A;  2Q2U A;  2ZM6 H;  5IWA H;  3LML A;  4LFB H;  3J81 W;  3RIZ A;  4FM9 A;  4KHP H;  4LSX A;  1SEI A;  2VUG A;  1N34 H;  3PN1 A;  4RB1 A;  1M0W A;  1BJT A;  3EYY A;  4UFZ A;  4LH6 A;  4JI2 H;  3F8N A;  3N42 B;  4RAY A;  3M4I A;  1FKA H;  4DR2 H;  4JYA H;  4DUZ H;  2HHH H;  4IAJ A;  3L4K A;  2Q2T A;  4DV3 H;  4EFE A;  4LF4 H;  2E5L H;  3N40 P;  1N33 H;  3N43 B;  1E4F T;  4DV6 H;  4DR3 H;  2UU9 H;  2CW8 A;  4J0M A;  2UUA H;  3JSL A;  1N32 H;  1J5E H;  2CW7 A;  4GLX A;  1FVI A;  4MTD A;  4AQY H;  3T1H H;  5D1O A;  3FMA A;  4RB3 C;  2HVR A;  1XNR H;  3L2P A;  1HR0 H;  4NXM H;  3RJ0 A;  4DV0 H;  4DUY H;  1E4G T;  1IBM H;  2W57 A;  3HXL A;  1X9N A;  4LF7 H;  5IT9 W;  3KAK A;  4X66 H;  3H20 A;  3N41 B;  1S68 A;  3L4J A;  4JI5 H;  1ZHQ A;  4APM A;  1WH2 A;  4DV1 H;  3N44 B;  3T1Y H;  2KSW A;  3BA8 A;  4LFC H;  1S03 G;  4GKK H;  4X64 H;  4DR5 H;  1TAE A;  4DV7 H;  5D1O B;  1SYX B;  5FPO A;  4UCT A;  1HNZ H;  2RGR A;  1TA8 A;  3C0F B;  2UXD H;  2FE3 A;  1A0I A;  1BGW A;  4A2A A;  4DR4 H;  4B3S H;  3CVZ A;  2HVS A;  3RTX A;  4NXN H;  1AN7 A;  2VQE H;  1V9P A;  3JAM W;  2OWO A;  3BA9 A;  5FLX W;  1VS0 A;  4M7E A;  5LMU H;  4UCS A;  1O75 A;  2RGV A;  5LL6 b;  4X62 H;  5FPR A;  4B3T H;  1HNW H;  3KXY T;  4MV7 A;  4LMY A;  1DGS A;  4MTE A;  3RGZ A;  1L2Z A;  1Z2P X;  4OX9 H;  1ZHS A;  4ETS A;  4B3R H;  2UXB H;  4YHH H;  1M0T A;  3MWM A;  3N6X A;  4EFB A;  4CC6 A;  4CC5 A;  4MV9 A;  1B04 A;  2VQF H;  5LMN H;  4DV2 H;  1XDN A;  4UCU A;  4LF8 H;  2WE6 A;  3RF2 A;  3UQ8 A;  3KAJ A;  3BAA A;  2UXC H;  1I6U A;  1IBL H;  4DR6 H;  1Z2N X;  2WYO A;  3BAB A;  3K3V A;  4JI4 H;  5D1P A;  5FD6 A;  1N36 H;  1FJG H;  4LFA H;  3DF7 A;  4UCR A;  4JV5 H;  2XIG A;  4JI6 H;  2WDT A;  4LF6 H;  4LH7 A;  4RB2 C;  4LF5 H;  4UCO A;  1P8L A;  3J80 W;  4DV5 H;  4RB0 A;  5A2Q W;  4JI0 H;  3J7A K;  5EOY A;  4B3M H;  4EEQ A;  2HGS A;  4LF9 H;  4A2B A;  2HVQ A;  1GYF A;  2ZJT A;  1XMO H;  4RZQ A;  1MZB A;  4K0K H;  4GKJ H;  4I7H A;  4YY3 H;  1Z2O X;  4JI7 H;  2VOB A;  1XNQ H;  4LSA A;  4DR1 H;  4Q0Y A;  2MCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...