2MCYA

Cr1 sushi domains 2 and 3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
132
structure length
132
Chain Sequence
KSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDTETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement receptor type 1
publication title Using Mutagenesis and Structural Biology to Map the Binding Site for the Plasmodium falciparum Merozoite Protein PfRh4 on the Human Immune Adherence Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mcyA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mcyA01
1U5MA 3TVJA 4AYIA 4LOSA 3KZJA 4WJG2 1H2PP 2W80A 1QO6A 1GPZA 1OJVA 1GHQB 2O39C 1FBRA 1O9AA 1OK9A 3KXVA 1HFHA 2CG7A 3GOVA 2V8EA 4B2SA 1E88A 3M7PA 4KKDA 1VVCA 1G4GA 3T5OA 1GKNA 2QY0A 1TPMA 2RKZA 2MCZA 2XQWC 3OXUD 1HCCA 3ZD1A 2B5ID 3IU3I 4A5WB 2EHFA 2KMSA 2XRBA 1H2QP 1SS2A 4AYDA 4IGDA 3ERBA 4B2RA 1OK1A 1MD7A 2JGXA 4K12A 1Q3XA 1ELVA 2ERJA 1OK2A 3MQLA 2IZ4A 1TPNA 2YBYA 4CSYA 3INBC 3SW0X 1UOTP 2RLPA 1VVDA 3RJ3D 4PZ5A 4DJZA 2RKYA 2YRAA 5HYUB 2A55A 2CG6A 2JGWA 4J38B 1OJYA 1Z92B 3R62A 1LY2A 3GXEA 4YNXA 1OK3A 3OP8A 2RL0A 1HFIA 3IX0A 4AYMA 4ONTD 1CKLA 2MCYA 1SRZA 2RLQA 5JPMG 1H03P 5HYPA 4JHSA 4F4OC 3L89M 3ZD2A 5HZPB 2CKUA 1H04P 4AYEA 1QGBA 1E8BA 3EJHA 4C16A 2KRIA 1TPGA 2XWJI 2BZMA 2XWBF 5FO8C 1G4FA 4MUCA 1QUBA 2EC3A 2WIIC 4FXGG 3NFPI 4ZH1D 3O8EB 1GKGA 1E5GA 2UWNA 5HYTB 5I0QB 1NWVA 1C1ZA 2IZ3A 3OEDC 2G7IA 1ZJKA 3ZRZA 1OJWA 1PPQA 2LOJA 2W81A 1MD8A 4LOTA 3CALA 2XRDA 2JRAA
chains in the Genus database with same CATH superfamily
1U5MA 3F6KA 3TVJA 4AYIA 4LOSA 3WSXA 3KZJA 4WJG2 1H2PP 2W80A 2Y8TA 1QO6A 1GPZA 4YIZA 1OJVA 1GHQB 2X2ZA 2O39C 1FBRA 1O9AA 1OK9A 3KXVA 1HFHA 5DN4A 2CG7A 3GOVA 2V8EA 4B2SA 1E88A 3M7PA 4KKDA 1VVCA 1G4GA 4APLA 3T5OA 1GKNA 2QY0A 1RLHA 3NJAA 1TPMA 2RKZA 2MCZA 3ZLEA 2Y8SA 2XQWC 3OXUD 1HCCA 3ZD1A 2B5ID 3FGTA 3IU3I 4A5WB 2EHFA 2KMSA 2XRBA 3FGRA 1H2QP 1SS2A 4AYDA 4IGDA 3ERBA 4B2RA 3CI0J 1OK1A 4MSLA 1MD7A 2JGXA 4K12A 1Q3XA 1ELVA 2ERJA 1OK2A 3MQLA 2IZ4A 1TPNA 2YBYA 4CSYA 4BWCA 3INBC 3SW0X 1UOTP 2RLPA 1VVDA 3RJ3D 4PZ5A 4DJZA 2RKYA 2YRAA 5HYUB 2A55A 2CG6A 2JGWA 4J38B 1OJYA 1Z92B 5DN5A 3R62A 1LY2A 3GXEA 4YNXA 3VWOA 1OK3A 3OP8A 2RL0A 1HFIA 3IX0A 4AYMA 4ONTD 1CKLA 2MCYA 1SRZA 2RLQA 3ZLDA 5JPMG 1H03P 5HYPA 4JHSA 4F4OC 3L89M 4N7EA 3ZD2A 5HZPB 2CKUA 1H04P 4AYEA 1QGBA 1E8BA 3EJHA 4PO7A 4C16A 2KRIA 1TPGA 2XWJI 2BZMA 2XWBF 5FO8C 1G4FA 4MUCA 1QUBA 2EC3A 2WIIC 3WSYA 4FXGG 3NFPI 4ZH1D 3O8EB 2I2LA 1GKGA 1E5GA 2Y8RA 2UWNA 5HYTB 5I0QB 1NWVA 1C1ZA 2IZ3A 3OEDC 2G7IA 1ZJKA 3ZRZA 2ZYCA 1OJWA 1PPQA 2LOJA 2W81A 1MD8A 3K3TA 4LOTA 3CALA 2XRDA 2JRAA
chains in the Genus database with same CATH topology
1U5MA 3TVJA 4AYIA 4LOSA 3KZJA 4WJG2 1H2PP 2W80A 1QO6A 1GPZA 1OJVA 1GHQB 2O39C 1FBRA 1O9AA 1OK9A 3KXVA 1HFHA 2CG7A 3GOVA 2V8EA 4B2SA 1E88A 3M7PA 4KKDA 1VVCA 1G4GA 3T5OA 1GKNA 2QY0A 1TPMA 2RKZA 2MCZA 2XQWC 3OXUD 1HCCA 3ZD1A 2B5ID 3IU3I 4A5WB 2EHFA 2KMSA 2XRBA 1H2QP 1SS2A 4AYDA 4IGDA 3ERBA 4B2RA 1OK1A 1MD7A 2JGXA 4K12A 1Q3XA 1ELVA 2ERJA 1OK2A 3MQLA 2IZ4A 1TPNA 2YBYA 4CSYA 3INBC 3SW0X 1UOTP 2RLPA 1VVDA 3RJ3D 4PZ5A 4DJZA 2RKYA 2YRAA 5HYUB 2A55A 2CG6A 2JGWA 4J38B 1OJYA 1Z92B 3R62A 1LY2A 3GXEA 4YNXA 1OK3A 3OP8A 2RL0A 1HFIA 3IX0A 4AYMA 4ONTD 1CKLA 2MCYA 1SRZA 2RLQA 5JPMG 1H03P 5HYPA 4JHSA 4F4OC 3L89M 3ZD2A 5HZPB 2CKUA 1H04P 4AYEA 1QGBA 1E8BA 3EJHA 4C16A 2KRIA 1TPGA 2XWJI 2BZMA 2XWBF 5FO8C 1G4FA 4MUCA 1QUBA 2EC3A 2WIIC 4FXGG 3NFPI 4ZH1D 3O8EB 1GKGA 1E5GA 2UWNA 5HYTB 5I0QB 1NWVA 1C1ZA 2IZ3A 3OEDC 2G7IA 1ZJKA 3ZRZA 1OJWA 1PPQA 2LOJA 2W81A 1MD8A 4LOTA 3CALA 2XRDA 2JRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5M A;  3TVJ A;  4AYI A;  4LOS A;  3KZJ A;  4WJG 2;  1H2P P;  2W80 A;  1QO6 A;  1GPZ A;  1OJV A;  1GHQ B;  2O39 C;  1FBR A;  1O9A A;  1OK9 A;  3KXV A;  1HFH A;  2CG7 A;  3GOV A;  2V8E A;  4B2S A;  1E88 A;  3M7P A;  4KKD A;  1VVC A;  1G4G A;  3T5O A;  1GKN A;  2QY0 A;  1TPM A;  2RKZ A;  2MCZ A;  2XQW C;  3OXU D;  1HCC A;  3ZD1 A;  2B5I D;  3IU3 I;  4A5W B;  2EHF A;  2KMS A;  2XRB A;  1H2Q P;  1SS2 A;  4AYD A;  4IGD A;  3ERB A;  4B2R A;  1OK1 A;  1MD7 A;  2JGX A;  4K12 A;  1Q3X A;  1ELV A;  2ERJ A;  1OK2 A;  3MQL A;  2IZ4 A;  1TPN A;  2YBY A;  4CSY A;  3INB C;  3SW0 X;  1UOT P;  2RLP A;  1VVD A;  3RJ3 D;  4PZ5 A;  4DJZ A;  2RKY A;  2YRA A;  5HYU B;  2A55 A;  2CG6 A;  2JGW A;  4J38 B;  1OJY A;  1Z92 B;  3R62 A;  1LY2 A;  3GXE A;  4YNX A;  1OK3 A;  3OP8 A;  2RL0 A;  1HFI A;  3IX0 A;  4AYM A;  4ONT D;  1CKL A;  2MCY A;  1SRZ A;  2RLQ A;  5JPM G;  1H03 P;  5HYP A;  4JHS A;  4F4O C;  3L89 M;  3ZD2 A;  5HZP B;  2CKU A;  1H04 P;  4AYE A;  1QGB A;  1E8B A;  3EJH A;  4C16 A;  2KRI A;  1TPG A;  2XWJ I;  2BZM A;  2XWB F;  5FO8 C;  1G4F A;  4MUC A;  1QUB A;  2EC3 A;  2WII C;  4FXG G;  3NFP I;  4ZH1 D;  3O8E B;  1GKG A;  1E5G A;  2UWN A;  5HYT B;  5I0Q B;  1NWV A;  1C1Z A;  2IZ3 A;  3OED C;  2G7I A;  1ZJK A;  3ZRZ A;  1OJW A;  1PPQ A;  2LOJ A;  2W81 A;  1MD8 A;  4LOT A;  3CAL A;  2XRD A;  2JRA A; 
#chains in the Genus database with same CATH topology
 1U5M A;  3F6K A;  3TVJ A;  4AYI A;  4LOS A;  3WSX A;  3KZJ A;  4WJG 2;  1H2P P;  2W80 A;  2Y8T A;  1QO6 A;  1GPZ A;  4YIZ A;  1OJV A;  1GHQ B;  2X2Z A;  2O39 C;  1FBR A;  1O9A A;  1OK9 A;  3KXV A;  1HFH A;  5DN4 A;  2CG7 A;  3GOV A;  2V8E A;  4B2S A;  1E88 A;  3M7P A;  4KKD A;  1VVC A;  1G4G A;  4APL A;  3T5O A;  1GKN A;  2QY0 A;  1RLH A;  3NJA A;  1TPM A;  2RKZ A;  2MCZ A;  3ZLE A;  2Y8S A;  2XQW C;  3OXU D;  1HCC A;  3ZD1 A;  2B5I D;  3FGT A;  3IU3 I;  4A5W B;  2EHF A;  2KMS A;  2XRB A;  3FGR A;  1H2Q P;  1SS2 A;  4AYD A;  4IGD A;  3ERB A;  4B2R A;  3CI0 J;  1OK1 A;  4MSL A;  1MD7 A;  2JGX A;  4K12 A;  1Q3X A;  1ELV A;  2ERJ A;  1OK2 A;  3MQL A;  2IZ4 A;  1TPN A;  2YBY A;  4CSY A;  4BWC A;  3INB C;  3SW0 X;  1UOT P;  2RLP A;  1VVD A;  3RJ3 D;  4PZ5 A;  4DJZ A;  2RKY A;  2YRA A;  5HYU B;  2A55 A;  2CG6 A;  2JGW A;  4J38 B;  1OJY A;  1Z92 B;  5DN5 A;  3R62 A;  1LY2 A;  3GXE A;  4YNX A;  3VWO A;  1OK3 A;  3OP8 A;  2RL0 A;  1HFI A;  3IX0 A;  4AYM A;  4ONT D;  1CKL A;  2MCY A;  1SRZ A;  2RLQ A;  3ZLD A;  5JPM G;  1H03 P;  5HYP A;  4JHS A;  4F4O C;  3L89 M;  4N7E A;  3ZD2 A;  5HZP B;  2CKU A;  1H04 P;  4AYE A;  1QGB A;  1E8B A;  3EJH A;  4PO7 A;  4C16 A;  2KRI A;  1TPG A;  2XWJ I;  2BZM A;  2XWB F;  5FO8 C;  1G4F A;  4MUC A;  1QUB A;  2EC3 A;  2WII C;  3WSY A;  4FXG G;  3NFP I;  4ZH1 D;  3O8E B;  2I2L A;  1GKG A;  1E5G A;  2Y8R A;  2UWN A;  5HYT B;  5I0Q B;  1NWV A;  1C1Z A;  2IZ3 A;  3OED C;  2G7I A;  1ZJK A;  3ZRZ A;  2ZYC A;  1OJW A;  1PPQ A;  2LOJ A;  2W81 A;  1MD8 A;  3K3T A;  4LOT A;  3CAL A;  2XRD A;  2JRA A; 
#chains in the Genus database with same CATH homology
 1U5M A;  3TVJ A;  4AYI A;  4LOS A;  3KZJ A;  4WJG 2;  1H2P P;  2W80 A;  1QO6 A;  1GPZ A;  1OJV A;  1GHQ B;  2O39 C;  1FBR A;  1O9A A;  1OK9 A;  3KXV A;  1HFH A;  2CG7 A;  3GOV A;  2V8E A;  4B2S A;  1E88 A;  3M7P A;  4KKD A;  1VVC A;  1G4G A;  3T5O A;  1GKN A;  2QY0 A;  1TPM A;  2RKZ A;  2MCZ A;  2XQW C;  3OXU D;  1HCC A;  3ZD1 A;  2B5I D;  3IU3 I;  4A5W B;  2EHF A;  2KMS A;  2XRB A;  1H2Q P;  1SS2 A;  4AYD A;  4IGD A;  3ERB A;  4B2R A;  1OK1 A;  1MD7 A;  2JGX A;  4K12 A;  1Q3X A;  1ELV A;  2ERJ A;  1OK2 A;  3MQL A;  2IZ4 A;  1TPN A;  2YBY A;  4CSY A;  3INB C;  3SW0 X;  1UOT P;  2RLP A;  1VVD A;  3RJ3 D;  4PZ5 A;  4DJZ A;  2RKY A;  2YRA A;  5HYU B;  2A55 A;  2CG6 A;  2JGW A;  4J38 B;  1OJY A;  1Z92 B;  3R62 A;  1LY2 A;  3GXE A;  4YNX A;  1OK3 A;  3OP8 A;  2RL0 A;  1HFI A;  3IX0 A;  4AYM A;  4ONT D;  1CKL A;  2MCY A;  1SRZ A;  2RLQ A;  5JPM G;  1H03 P;  5HYP A;  4JHS A;  4F4O C;  3L89 M;  3ZD2 A;  5HZP B;  2CKU A;  1H04 P;  4AYE A;  1QGB A;  1E8B A;  3EJH A;  4C16 A;  2KRI A;  1TPG A;  2XWJ I;  2BZM A;  2XWB F;  5FO8 C;  1G4F A;  4MUC A;  1QUB A;  2EC3 A;  2WII C;  4FXG G;  3NFP I;  4ZH1 D;  3O8E B;  1GKG A;  1E5G A;  2UWN A;  5HYT B;  5I0Q B;  1NWV A;  1C1Z A;  2IZ3 A;  3OED C;  2G7I A;  1ZJK A;  3ZRZ A;  1OJW A;  1PPQ A;  2LOJ A;  2W81 A;  1MD8 A;  4LOT A;  3CAL A;  2XRD A;  2JRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...