2MCZA

Cr1 sushi domains 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
b'QCNAPEWLPFARPTQLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDQETPICDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement receptor type 1
publication title Using Mutagenesis and Structural Biology to Map the Binding Site for the Plasmodium falciparum Merozoite Protein PfRh4 on the Human Immune Adherence Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mczA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mczA01
1VVDA 2KMSA 2QY0A 1H2QP 3ZRZA 3O8EB 4MUCA 3TVJA 4IGDA 2LOJA 4J38B 2EHFA 1HFHA 1MD7A 4PZ5A 1OK1A 3R62A 2WIIC 4DJZA 2XQWC 4LOSA 3SW0X 1OJYA 1PPQA 1TPNA 2RLQA 1GPZA 4ONTD 4AYMA 1G4FA 2V8EA 2B5ID 1VVCA 2MCYA 3L89M 2A55A 2ERJA 1OK3A 2RKZA 1QUBA 3GOVA 2O39C 4F4OC 3ERBA 1ZJKA 2RKYA 3IX0A 4WJG2 5FO8C 1LY2A 2XWJI 1ELVA 2XWBF 1FBRA 1C1ZA 2CG6A 4KKDA 4LOTA 2KRIA 1QO6A 2XRBA 1Q3XA 1H04P 1UOTP 3OXUD 4CSYA 4B2RA 2JRAA 1TPGA 1OK2A 2BZMA 3EJHA 2YRAA 1SRZA 3MQLA 4FXGG 3RJ3D 1CKLA 1OJVA 2YBYA 4K12A 2XRDA 1OJWA 1TPMA 4A5WB 1O9AA 3IU3I 4AYEA 1MD8A 1H03P 4C16A 2IZ4A 3OEDC 3OP8A 2RLPA 2RL0A 2G7IA 4B2SA 4YNXA 1G4GA 2CKUA 3GXEA 1E88A 1GKNA 1GHQB 3KZJA 2W80A 5JPMG 3M7PA 3NFPI 1Z92B 2W81A 1NWVA 1H2PP 1HCCA 4AYDA 4JHSA 1HFIA 3ZD2A 1OK9A 3KXVA 2IZ3A 1GKGA 1U5MA 1QGBA 1E8BA 1E5GA 4ZH1D 4AYIA 2MCZA 2UWNA 1SS2A 2JGWA 5HYUB 3CALA 3T5OA 3ZD1A 5HYPA 3INBC 5I0QB 2CG7A 5HZPB 5HYTB 2EC3A 2JGXA
chains in the Genus database with same CATH superfamily
1VVDA 2KMSA 2QY0A 1H2QP 3ZRZA 3O8EB 4MUCA 3TVJA 4IGDA 4APLA 2LOJA 4J38B 2EHFA 3FGTA 1HFHA 1MD7A 4PZ5A 1OK1A 3R62A 3ZLDA 2WIIC 4DJZA 2XQWC 4LOSA 3SW0X 3VWOA 2ZYCA 1OJYA 1PPQA 1TPNA 2RLQA 1GPZA 4ONTD 4AYMA 1G4FA 2V8EA 2B5ID 1VVCA 2MCYA 3L89M 2A55A 2ERJA 1OK3A 3CI0J 2RKZA 1QUBA 3WSXA 3GOVA 5DN4A 2O39C 4F4OC 5DN5A 3ERBA 1ZJKA 2RKYA 3IX0A 4WJG2 5FO8C 1LY2A 3F6KA 2XWJI 1ELVA 2XWBF 1FBRA 1C1ZA 2CG6A 4KKDA 4LOTA 2KRIA 2X2ZA 1QO6A 2XRBA 1Q3XA 1H04P 1UOTP 3OXUD 4CSYA 4N7EA 4B2RA 2JRAA 1TPGA 1OK2A 2BZMA 3EJHA 2YRAA 1SRZA 3K3TA 3MQLA 4FXGG 1CKLA 1OJVA 3RJ3D 2YBYA 4K12A 2XRDA 1OJWA 3NJAA 1TPMA 4A5WB 3ZLEA 1O9AA 3IU3I 4YIZA 4AYEA 1MD8A 1H03P 4C16A 2IZ4A 3OEDC 3OP8A 3WSYA 2RLPA 2RL0A 2G7IA 4B2SA 4YNXA 1G4GA 1RLHA 2CKUA 3GXEA 1E88A 1GKNA 1GHQB 3KZJA 2W80A 2I2LA 5JPMG 3M7PA 4MSLA 3NFPI 1Z92B 2W81A 1NWVA 1H2PP 1HCCA 2Y8SA 4AYDA 4JHSA 1HFIA 3ZD2A 1OK9A 3KXVA 2IZ3A 1GKGA 2Y8RA 4PO7A 1U5MA 3FGRA 1QGBA 1E8BA 1E5GA 4ZH1D 4AYIA 2MCZA 2Y8TA 2UWNA 1SS2A 2JGWA 5HYUB 4BWCA 3CALA 3T5OA 3ZD1A 5HYPA 3INBC 5I0QB 2CG7A 5HZPB 5HYTB 2EC3A 2JGXA
chains in the Genus database with same CATH topology
1VVDA 2KMSA 2QY0A 1H2QP 3ZRZA 3O8EB 4MUCA 3TVJA 4IGDA 2LOJA 4J38B 2EHFA 1HFHA 1MD7A 4PZ5A 1OK1A 3R62A 2WIIC 4DJZA 2XQWC 4LOSA 3SW0X 1OJYA 1PPQA 1TPNA 2RLQA 1GPZA 4ONTD 4AYMA 1G4FA 2V8EA 2B5ID 1VVCA 2MCYA 3L89M 2A55A 2ERJA 1OK3A 2RKZA 1QUBA 3GOVA 2O39C 4F4OC 3ERBA 1ZJKA 2RKYA 3IX0A 4WJG2 5FO8C 1LY2A 2XWJI 1ELVA 2XWBF 1FBRA 1C1ZA 2CG6A 4KKDA 4LOTA 2KRIA 1QO6A 2XRBA 1Q3XA 1H04P 1UOTP 3OXUD 4CSYA 4B2RA 2JRAA 1TPGA 1OK2A 2BZMA 3EJHA 2YRAA 1SRZA 3MQLA 4FXGG 3RJ3D 1CKLA 1OJVA 2YBYA 4K12A 2XRDA 1OJWA 1TPMA 4A5WB 1O9AA 3IU3I 4AYEA 1MD8A 1H03P 4C16A 2IZ4A 3OEDC 3OP8A 2RLPA 2RL0A 2G7IA 4B2SA 4YNXA 1G4GA 2CKUA 3GXEA 1E88A 1GKNA 1GHQB 3KZJA 2W80A 5JPMG 3M7PA 3NFPI 1Z92B 2W81A 1NWVA 1H2PP 1HCCA 4AYDA 4JHSA 1HFIA 3ZD2A 1OK9A 3KXVA 2IZ3A 1GKGA 1U5MA 1QGBA 1E8BA 1E5GA 4ZH1D 4AYIA 2MCZA 2UWNA 1SS2A 2JGWA 5HYUB 3CALA 3T5OA 3ZD1A 5HYPA 3INBC 5I0QB 2CG7A 5HZPB 5HYTB 2EC3A 2JGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VVD A;  2KMS A;  2QY0 A;  1H2Q P;  3ZRZ A;  3O8E B;  4MUC A;  3TVJ A;  4IGD A;  2LOJ A;  4J38 B;  2EHF A;  1HFH A;  1MD7 A;  4PZ5 A;  1OK1 A;  3R62 A;  2WII C;  4DJZ A;  2XQW C;  4LOS A;  3SW0 X;  1OJY A;  1PPQ A;  1TPN A;  2RLQ A;  1GPZ A;  4ONT D;  4AYM A;  1G4F A;  2V8E A;  2B5I D;  1VVC A;  2MCY A;  3L89 M;  2A55 A;  2ERJ A;  1OK3 A;  2RKZ A;  1QUB A;  3GOV A;  2O39 C;  4F4O C;  3ERB A;  1ZJK A;  2RKY A;  3IX0 A;  4WJG 2;  5FO8 C;  1LY2 A;  2XWJ I;  1ELV A;  2XWB F;  1FBR A;  1C1Z A;  2CG6 A;  4KKD A;  4LOT A;  2KRI A;  1QO6 A;  2XRB A;  1Q3X A;  1H04 P;  1UOT P;  3OXU D;  4CSY A;  4B2R A;  2JRA A;  1TPG A;  1OK2 A;  2BZM A;  3EJH A;  2YRA A;  1SRZ A;  3MQL A;  4FXG G;  3RJ3 D;  1CKL A;  1OJV A;  2YBY A;  4K12 A;  2XRD A;  1OJW A;  1TPM A;  4A5W B;  1O9A A;  3IU3 I;  4AYE A;  1MD8 A;  1H03 P;  4C16 A;  2IZ4 A;  3OED C;  3OP8 A;  2RLP A;  2RL0 A;  2G7I A;  4B2S A;  4YNX A;  1G4G A;  2CKU A;  3GXE A;  1E88 A;  1GKN A;  1GHQ B;  3KZJ A;  2W80 A;  5JPM G;  3M7P A;  3NFP I;  1Z92 B;  2W81 A;  1NWV A;  1H2P P;  1HCC A;  4AYD A;  4JHS A;  1HFI A;  3ZD2 A;  1OK9 A;  3KXV A;  2IZ3 A;  1GKG A;  1U5M A;  1QGB A;  1E8B A;  1E5G A;  4ZH1 D;  4AYI A;  2MCZ A;  2UWN A;  1SS2 A;  2JGW A;  5HYU B;  3CAL A;  3T5O A;  3ZD1 A;  5HYP A;  3INB C;  5I0Q B;  2CG7 A;  5HZP B;  5HYT B;  2EC3 A;  2JGX A; 
#chains in the Genus database with same CATH topology
 1VVD A;  2KMS A;  2QY0 A;  1H2Q P;  3ZRZ A;  3O8E B;  4MUC A;  3TVJ A;  4IGD A;  4APL A;  2LOJ A;  4J38 B;  2EHF A;  3FGT A;  1HFH A;  1MD7 A;  4PZ5 A;  1OK1 A;  3R62 A;  3ZLD A;  2WII C;  4DJZ A;  2XQW C;  4LOS A;  3SW0 X;  3VWO A;  2ZYC A;  1OJY A;  1PPQ A;  1TPN A;  2RLQ A;  1GPZ A;  4ONT D;  4AYM A;  1G4F A;  2V8E A;  2B5I D;  1VVC A;  2MCY A;  3L89 M;  2A55 A;  2ERJ A;  1OK3 A;  3CI0 J;  2RKZ A;  1QUB A;  3WSX A;  3GOV A;  5DN4 A;  2O39 C;  4F4O C;  5DN5 A;  3ERB A;  1ZJK A;  2RKY A;  3IX0 A;  4WJG 2;  5FO8 C;  1LY2 A;  3F6K A;  2XWJ I;  1ELV A;  2XWB F;  1FBR A;  1C1Z A;  2CG6 A;  4KKD A;  4LOT A;  2KRI A;  2X2Z A;  1QO6 A;  2XRB A;  1Q3X A;  1H04 P;  1UOT P;  3OXU D;  4CSY A;  4N7E A;  4B2R A;  2JRA A;  1TPG A;  1OK2 A;  2BZM A;  3EJH A;  2YRA A;  1SRZ A;  3K3T A;  3MQL A;  4FXG G;  1CKL A;  1OJV A;  3RJ3 D;  2YBY A;  4K12 A;  2XRD A;  1OJW A;  3NJA A;  1TPM A;  4A5W B;  3ZLE A;  1O9A A;  3IU3 I;  4YIZ A;  4AYE A;  1MD8 A;  1H03 P;  4C16 A;  2IZ4 A;  3OED C;  3OP8 A;  3WSY A;  2RLP A;  2RL0 A;  2G7I A;  4B2S A;  4YNX A;  1G4G A;  1RLH A;  2CKU A;  3GXE A;  1E88 A;  1GKN A;  1GHQ B;  3KZJ A;  2W80 A;  2I2L A;  5JPM G;  3M7P A;  4MSL A;  3NFP I;  1Z92 B;  2W81 A;  1NWV A;  1H2P P;  1HCC A;  2Y8S A;  4AYD A;  4JHS A;  1HFI A;  3ZD2 A;  1OK9 A;  3KXV A;  2IZ3 A;  1GKG A;  2Y8R A;  4PO7 A;  1U5M A;  3FGR A;  1QGB A;  1E8B A;  1E5G A;  4ZH1 D;  4AYI A;  2MCZ A;  2Y8T A;  2UWN A;  1SS2 A;  2JGW A;  5HYU B;  4BWC A;  3CAL A;  3T5O A;  3ZD1 A;  5HYP A;  3INB C;  5I0Q B;  2CG7 A;  5HZP B;  5HYT B;  2EC3 A;  2JGX A; 
#chains in the Genus database with same CATH homology
 1VVD A;  2KMS A;  2QY0 A;  1H2Q P;  3ZRZ A;  3O8E B;  4MUC A;  3TVJ A;  4IGD A;  2LOJ A;  4J38 B;  2EHF A;  1HFH A;  1MD7 A;  4PZ5 A;  1OK1 A;  3R62 A;  2WII C;  4DJZ A;  2XQW C;  4LOS A;  3SW0 X;  1OJY A;  1PPQ A;  1TPN A;  2RLQ A;  1GPZ A;  4ONT D;  4AYM A;  1G4F A;  2V8E A;  2B5I D;  1VVC A;  2MCY A;  3L89 M;  2A55 A;  2ERJ A;  1OK3 A;  2RKZ A;  1QUB A;  3GOV A;  2O39 C;  4F4O C;  3ERB A;  1ZJK A;  2RKY A;  3IX0 A;  4WJG 2;  5FO8 C;  1LY2 A;  2XWJ I;  1ELV A;  2XWB F;  1FBR A;  1C1Z A;  2CG6 A;  4KKD A;  4LOT A;  2KRI A;  1QO6 A;  2XRB A;  1Q3X A;  1H04 P;  1UOT P;  3OXU D;  4CSY A;  4B2R A;  2JRA A;  1TPG A;  1OK2 A;  2BZM A;  3EJH A;  2YRA A;  1SRZ A;  3MQL A;  4FXG G;  3RJ3 D;  1CKL A;  1OJV A;  2YBY A;  4K12 A;  2XRD A;  1OJW A;  1TPM A;  4A5W B;  1O9A A;  3IU3 I;  4AYE A;  1MD8 A;  1H03 P;  4C16 A;  2IZ4 A;  3OED C;  3OP8 A;  2RLP A;  2RL0 A;  2G7I A;  4B2S A;  4YNX A;  1G4G A;  2CKU A;  3GXE A;  1E88 A;  1GKN A;  1GHQ B;  3KZJ A;  2W80 A;  5JPM G;  3M7P A;  3NFP I;  1Z92 B;  2W81 A;  1NWV A;  1H2P P;  1HCC A;  4AYD A;  4JHS A;  1HFI A;  3ZD2 A;  1OK9 A;  3KXV A;  2IZ3 A;  1GKG A;  1U5M A;  1QGB A;  1E8B A;  1E5G A;  4ZH1 D;  4AYI A;  2MCZ A;  2UWN A;  1SS2 A;  2JGW A;  5HYU B;  3CAL A;  3T5O A;  3ZD1 A;  5HYP A;  3INB C;  5I0Q B;  2CG7 A;  5HZP B;  5HYT B;  2EC3 A;  2JGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...