2MCZA

Cr1 sushi domains 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
QCNAPEWLPFARPTQLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDQETPICDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement receptor type 1
publication title Using Mutagenesis and Structural Biology to Map the Binding Site for the Plasmodium falciparum Merozoite Protein PfRh4 on the Human Immune Adherence Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mczA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2mczA01
3M7PA 1HFIA 2IZ4A 4MUCA 1G4GA 3GOVA 5HYUB 2RL0A 3L89M 3ZD2A 3RJ3D 2RLQA 3ZRZA 2XRBA 1HCCA 5FO8C 2V8EA 1MD8A 4B2RA 3NFPI 1TPGA 1OK9A 4AYEA 2O39C 2A55A 4A5WB 2CG6A 3TVJA 5HZPB 2QY0A 3R62A 1OJWA 1OK3A 3T5OA 1QUBA 3INBC 4LOSA 4FXGG 2EC3A 2RKZA 5JPMG 1Q3XA 1GKNA 4ZH1D 1MD7A 1SS2A 2JGXA 1VVDA 1E5GA 1ZJKA 2XWBF 2RKYA 4AYMA 3ERBA 1E8BA 1Z92B 3KXVA 1PPQA 4C16A 1TPMA 4K12A 3MQLA 4KKDA 2IZ3A 2MCZA 3ZD1A 3CALA 1GKGA 2KRIA 4WJG2 5HYPA 1U5MA 3SW0X 1OK2A 3IU3I 4F4OC 2LOJA 2XWJI 1H03P 2JRAA 4AYDA 1VVCA 2W80A 1ELVA 2YBYA 1CKLA 1H2PP 1SRZA 2KMSA 4LOTA 3GXEA 1NWVA 1QO6A 1HFHA 3EJHA 1O9AA 1G4FA 3OP8A 4DJZA 1OK1A 1TPNA 4AYIA 1FBRA 3IX0A 4IGDA 3OEDC 4CSYA 3OXUD 1UOTP 4J38B 1OJYA 4YNXA 1C1ZA 2CG7A 2W81A 5HYTB 2BZMA 1OJVA 2CKUA 2RLPA 2MCYA 3O8EB 1H04P 2G7IA 2XQWC 1LY2A 2JGWA 4B2SA 4ONTD 3KZJA 2XRDA 2UWNA 2ERJA 2WIIC 1H2QP 1GPZA 2EHFA 5I0QB 2YRAA 4PZ5A 4JHSA 1E88A 2B5ID 1GHQB 1QGBA
chains in the Genus database with same CATH superfamily
3M7PA 1HFIA 2IZ4A 4MUCA 1G4GA 3GOVA 5HYUB 2RL0A 4BWCA 3L89M 3ZD2A 3FGTA 3RJ3D 4MSLA 2RLQA 3ZRZA 2XRBA 1HCCA 5FO8C 2V8EA 1MD8A 4B2RA 3NFPI 1TPGA 2Y8TA 1OK9A 4AYEA 2O39C 2A55A 4A5WB 2CG6A 3TVJA 5HZPB 2QY0A 3R62A 1OJWA 1OK3A 3T5OA 2ZYCA 4PO7A 3ZLDA 1QUBA 3INBC 4LOSA 4FXGG 2EC3A 2RKZA 5JPMG 1Q3XA 1GKNA 4ZH1D 1MD7A 1SS2A 2JGXA 1VVDA 5DN4A 3WSXA 1E5GA 1ZJKA 2XWBF 2RKYA 4AYMA 3ERBA 1E8BA 1Z92B 3F6KA 3KXVA 1PPQA 4C16A 1TPMA 3WSYA 4K12A 4APLA 3MQLA 4KKDA 2IZ3A 2MCZA 3ZD1A 3CALA 1RLHA 1GKGA 2KRIA 4WJG2 5HYPA 1U5MA 3SW0X 1OK2A 2Y8RA 3IU3I 4F4OC 2LOJA 3VWOA 2XWJI 1H03P 2JRAA 4AYDA 1VVCA 2W80A 1ELVA 2YBYA 1CKLA 1H2PP 1SRZA 2KMSA 4LOTA 3GXEA 1NWVA 1QO6A 1HFHA 3EJHA 1O9AA 1G4FA 3OP8A 4DJZA 5DN5A 1OK1A 1TPNA 4AYIA 1FBRA 3IX0A 4IGDA 3OEDC 4CSYA 3OXUD 3CI0J 1UOTP 4J38B 1OJYA 3NJAA 3K3TA 4YNXA 1C1ZA 2CG7A 2W81A 5HYTB 2BZMA 1OJVA 2CKUA 2RLPA 2MCYA 3O8EB 1H04P 2G7IA 2X2ZA 2XQWC 1LY2A 4N7EA 2Y8SA 2JGWA 4B2SA 4ONTD 3KZJA 2XRDA 2UWNA 2ERJA 2WIIC 1H2QP 4YIZA 3ZLEA 3FGRA 1GPZA 2EHFA 5I0QB 2I2LA 2YRAA 4PZ5A 4JHSA 1E88A 2B5ID 1GHQB 1QGBA
chains in the Genus database with same CATH topology
3M7PA 1HFIA 2IZ4A 4MUCA 1G4GA 3GOVA 5HYUB 2RL0A 3L89M 3ZD2A 3RJ3D 2RLQA 3ZRZA 2XRBA 1HCCA 5FO8C 2V8EA 1MD8A 4B2RA 3NFPI 1TPGA 1OK9A 4AYEA 2O39C 2A55A 4A5WB 2CG6A 3TVJA 5HZPB 2QY0A 3R62A 1OJWA 1OK3A 3T5OA 1QUBA 3INBC 4LOSA 4FXGG 2EC3A 2RKZA 5JPMG 1Q3XA 1GKNA 4ZH1D 1MD7A 1SS2A 2JGXA 1VVDA 1E5GA 1ZJKA 2XWBF 2RKYA 4AYMA 3ERBA 1E8BA 1Z92B 3KXVA 1PPQA 4C16A 1TPMA 4K12A 3MQLA 4KKDA 2IZ3A 2MCZA 3ZD1A 3CALA 1GKGA 2KRIA 4WJG2 5HYPA 1U5MA 3SW0X 1OK2A 3IU3I 4F4OC 2LOJA 2XWJI 1H03P 2JRAA 4AYDA 1VVCA 2W80A 1ELVA 2YBYA 1CKLA 1H2PP 1SRZA 2KMSA 4LOTA 3GXEA 1NWVA 1QO6A 1HFHA 3EJHA 1O9AA 1G4FA 3OP8A 4DJZA 1OK1A 1TPNA 4AYIA 1FBRA 3IX0A 4IGDA 3OEDC 4CSYA 3OXUD 1UOTP 4J38B 1OJYA 4YNXA 1C1ZA 2CG7A 2W81A 5HYTB 2BZMA 1OJVA 2CKUA 2RLPA 2MCYA 3O8EB 1H04P 2G7IA 2XQWC 1LY2A 2JGWA 4B2SA 4ONTD 3KZJA 2XRDA 2UWNA 2ERJA 2WIIC 1H2QP 1GPZA 2EHFA 5I0QB 2YRAA 4PZ5A 4JHSA 1E88A 2B5ID 1GHQB 1QGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7P A;  1HFI A;  2IZ4 A;  4MUC A;  1G4G A;  3GOV A;  5HYU B;  2RL0 A;  3L89 M;  3ZD2 A;  3RJ3 D;  2RLQ A;  3ZRZ A;  2XRB A;  1HCC A;  5FO8 C;  2V8E A;  1MD8 A;  4B2R A;  3NFP I;  1TPG A;  1OK9 A;  4AYE A;  2O39 C;  2A55 A;  4A5W B;  2CG6 A;  3TVJ A;  5HZP B;  2QY0 A;  3R62 A;  1OJW A;  1OK3 A;  3T5O A;  1QUB A;  3INB C;  4LOS A;  4FXG G;  2EC3 A;  2RKZ A;  5JPM G;  1Q3X A;  1GKN A;  4ZH1 D;  1MD7 A;  1SS2 A;  2JGX A;  1VVD A;  1E5G A;  1ZJK A;  2XWB F;  2RKY A;  4AYM A;  3ERB A;  1E8B A;  1Z92 B;  3KXV A;  1PPQ A;  4C16 A;  1TPM A;  4K12 A;  3MQL A;  4KKD A;  2IZ3 A;  2MCZ A;  3ZD1 A;  3CAL A;  1GKG A;  2KRI A;  4WJG 2;  5HYP A;  1U5M A;  3SW0 X;  1OK2 A;  3IU3 I;  4F4O C;  2LOJ A;  2XWJ I;  1H03 P;  2JRA A;  4AYD A;  1VVC A;  2W80 A;  1ELV A;  2YBY A;  1CKL A;  1H2P P;  1SRZ A;  2KMS A;  4LOT A;  3GXE A;  1NWV A;  1QO6 A;  1HFH A;  3EJH A;  1O9A A;  1G4F A;  3OP8 A;  4DJZ A;  1OK1 A;  1TPN A;  4AYI A;  1FBR A;  3IX0 A;  4IGD A;  3OED C;  4CSY A;  3OXU D;  1UOT P;  4J38 B;  1OJY A;  4YNX A;  1C1Z A;  2CG7 A;  2W81 A;  5HYT B;  2BZM A;  1OJV A;  2CKU A;  2RLP A;  2MCY A;  3O8E B;  1H04 P;  2G7I A;  2XQW C;  1LY2 A;  2JGW A;  4B2S A;  4ONT D;  3KZJ A;  2XRD A;  2UWN A;  2ERJ A;  2WII C;  1H2Q P;  1GPZ A;  2EHF A;  5I0Q B;  2YRA A;  4PZ5 A;  4JHS A;  1E88 A;  2B5I D;  1GHQ B;  1QGB A; 
#chains in the Genus database with same CATH topology
 3M7P A;  1HFI A;  2IZ4 A;  4MUC A;  1G4G A;  3GOV A;  5HYU B;  2RL0 A;  4BWC A;  3L89 M;  3ZD2 A;  3FGT A;  3RJ3 D;  4MSL A;  2RLQ A;  3ZRZ A;  2XRB A;  1HCC A;  5FO8 C;  2V8E A;  1MD8 A;  4B2R A;  3NFP I;  1TPG A;  2Y8T A;  1OK9 A;  4AYE A;  2O39 C;  2A55 A;  4A5W B;  2CG6 A;  3TVJ A;  5HZP B;  2QY0 A;  3R62 A;  1OJW A;  1OK3 A;  3T5O A;  2ZYC A;  4PO7 A;  3ZLD A;  1QUB A;  3INB C;  4LOS A;  4FXG G;  2EC3 A;  2RKZ A;  5JPM G;  1Q3X A;  1GKN A;  4ZH1 D;  1MD7 A;  1SS2 A;  2JGX A;  1VVD A;  5DN4 A;  3WSX A;  1E5G A;  1ZJK A;  2XWB F;  2RKY A;  4AYM A;  3ERB A;  1E8B A;  1Z92 B;  3F6K A;  3KXV A;  1PPQ A;  4C16 A;  1TPM A;  3WSY A;  4K12 A;  4APL A;  3MQL A;  4KKD A;  2IZ3 A;  2MCZ A;  3ZD1 A;  3CAL A;  1RLH A;  1GKG A;  2KRI A;  4WJG 2;  5HYP A;  1U5M A;  3SW0 X;  1OK2 A;  2Y8R A;  3IU3 I;  4F4O C;  2LOJ A;  3VWO A;  2XWJ I;  1H03 P;  2JRA A;  4AYD A;  1VVC A;  2W80 A;  1ELV A;  2YBY A;  1CKL A;  1H2P P;  1SRZ A;  2KMS A;  4LOT A;  3GXE A;  1NWV A;  1QO6 A;  1HFH A;  3EJH A;  1O9A A;  1G4F A;  3OP8 A;  4DJZ A;  5DN5 A;  1OK1 A;  1TPN A;  4AYI A;  1FBR A;  3IX0 A;  4IGD A;  3OED C;  4CSY A;  3OXU D;  3CI0 J;  1UOT P;  4J38 B;  1OJY A;  3NJA A;  3K3T A;  4YNX A;  1C1Z A;  2CG7 A;  2W81 A;  5HYT B;  2BZM A;  1OJV A;  2CKU A;  2RLP A;  2MCY A;  3O8E B;  1H04 P;  2G7I A;  2X2Z A;  2XQW C;  1LY2 A;  4N7E A;  2Y8S A;  2JGW A;  4B2S A;  4ONT D;  3KZJ A;  2XRD A;  2UWN A;  2ERJ A;  2WII C;  1H2Q P;  4YIZ A;  3ZLE A;  3FGR A;  1GPZ A;  2EHF A;  5I0Q B;  2I2L A;  2YRA A;  4PZ5 A;  4JHS A;  1E88 A;  2B5I D;  1GHQ B;  1QGB A; 
#chains in the Genus database with same CATH homology
 3M7P A;  1HFI A;  2IZ4 A;  4MUC A;  1G4G A;  3GOV A;  5HYU B;  2RL0 A;  3L89 M;  3ZD2 A;  3RJ3 D;  2RLQ A;  3ZRZ A;  2XRB A;  1HCC A;  5FO8 C;  2V8E A;  1MD8 A;  4B2R A;  3NFP I;  1TPG A;  1OK9 A;  4AYE A;  2O39 C;  2A55 A;  4A5W B;  2CG6 A;  3TVJ A;  5HZP B;  2QY0 A;  3R62 A;  1OJW A;  1OK3 A;  3T5O A;  1QUB A;  3INB C;  4LOS A;  4FXG G;  2EC3 A;  2RKZ A;  5JPM G;  1Q3X A;  1GKN A;  4ZH1 D;  1MD7 A;  1SS2 A;  2JGX A;  1VVD A;  1E5G A;  1ZJK A;  2XWB F;  2RKY A;  4AYM A;  3ERB A;  1E8B A;  1Z92 B;  3KXV A;  1PPQ A;  4C16 A;  1TPM A;  4K12 A;  3MQL A;  4KKD A;  2IZ3 A;  2MCZ A;  3ZD1 A;  3CAL A;  1GKG A;  2KRI A;  4WJG 2;  5HYP A;  1U5M A;  3SW0 X;  1OK2 A;  3IU3 I;  4F4O C;  2LOJ A;  2XWJ I;  1H03 P;  2JRA A;  4AYD A;  1VVC A;  2W80 A;  1ELV A;  2YBY A;  1CKL A;  1H2P P;  1SRZ A;  2KMS A;  4LOT A;  3GXE A;  1NWV A;  1QO6 A;  1HFH A;  3EJH A;  1O9A A;  1G4F A;  3OP8 A;  4DJZ A;  1OK1 A;  1TPN A;  4AYI A;  1FBR A;  3IX0 A;  4IGD A;  3OED C;  4CSY A;  3OXU D;  1UOT P;  4J38 B;  1OJY A;  4YNX A;  1C1Z A;  2CG7 A;  2W81 A;  5HYT B;  2BZM A;  1OJV A;  2CKU A;  2RLP A;  2MCY A;  3O8E B;  1H04 P;  2G7I A;  2XQW C;  1LY2 A;  2JGW A;  4B2S A;  4ONT D;  3KZJ A;  2XRD A;  2UWN A;  2ERJ A;  2WII C;  1H2Q P;  1GPZ A;  2EHF A;  5I0Q B;  2YRA A;  4PZ5 A;  4JHS A;  1E88 A;  2B5I D;  1GHQ B;  1QGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...