2MDAA

The solution structure of the regulatory domain of tyrosine hydroxylase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the regulatory domain of tyrosine hydroxylase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Tyrosine 3-monooxygenase
total genus 12
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 1.14.16.2: Tyrosine 3-monooxygenase.
pdb deposition date 2013-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mdaA00
3LUYA 1ZPVA 3LOUA 2J0WA 1U8SA 2LVWA 3CEDA 2CDQA 2QMWA 5FIIA 3O1LA 2DT9A 2F1FA 3UW1A 1UJ5A 3S1TA 3HHEA 3KWMA 1Y7PA 1PSDA 2QMXA 4IO1A 4GO5X 2KO1A 3AB4B 2QSWA 2JOQA 3IBWA 2PC6A 3NRBA 2NYIA 3N0VA 1M0SA 3DDNA 3U7JA 5IT0A 1UJ6A 1YBAA 2JHEA 2QRRA 1O8BA 3AAWB 2H9ZA 3DHWC 2P9EA 2RQKA 3MWBA 1KS2A 3MTJA 5IS2A 4M8LA 1LK5A 1XTZA 1LK7A 3MAHA 2F8MA 4GO7X 3DC2A 4NMLA 3ENWA 3AB2B 2PA3A 3OBIA 3L7OA 4X84A 2RE1A 4LUBA 3TUIC 3TUZC 5JJBA 1UJ4A 3DHXA 2ZHOA 3TUJC 3ENVA 2RQMA 1LKZA 3W7BA 5IT4A 3OFFA 2LQJA 3IXQA 2FGCA 1SC6A 2I9SA 3P96A 2DTJA 5T41A 3ENQA 3K5PA 3OFHA 4PWUA 2P9CA 1RWUA 2P9GA 1YGYA 2MDAA 3OFGA 3OFEA 4GMKA 2J0XA
chains in the Genus database with same CATH superfamily
1X4BA 2R7WA 1KTQA 3WDOA 4UUWA 2CA9A 1RAFB 3NNHA 2GGPA 3R5DA 4ERDA 3VZIA 2HRTA 4DV0J 1HD0A 1SXLA 2KRBA 1UZDA 1EP4B 2WVDA 2LDIA 5C25B 2P5VA 2ZH6A 1VHFA 4P10A 4J9RA 3O6QA 1ZS6A 3OTCA 1UA1A 4V19X 3NGKA 4ECQA 2DGUA 2J9DA 2MQMA 4H54A 4KB7A 3G86A 2RF2B 5ETLA 5KG0A 4ZJQA 2ZH4A 1X31C 3LGNA 4PQAA 4AXJA 1NKEA 4LFAF 1JLAA 1XNQJ 3M9MB 1KVIA 1LXNA 5KFXA 1FTCA 1KDNA 2HVDA 4HI2A 4U8VA 3DOKA 4ELUA 2V69A 2ZZTA 4ILRA 4CRJA 3DXBA 3W2VA 1N5QA 3ETMA 1KKHA 4X4SA 3I0RB 4I7FB 2UUCJ 2VBWA 4IRDA 1FK9A 5IXUA 2IIHA 2WSFC 3QSIA 1T7PA 4OL8A 1GMUA 2QLXA 2QYGA 4J9LA 2YNIA 3KNAA 1FKPB 1XR5A 3FC9A 3SSSA 3WBZA 1HR0F 4F0HA 5HMZA 2RRBA 2RHQB 5HK4A 2OMLA 4J9MA 2GZOA 4ZLLA 3TANA 2A2DA 2BW2A 1N6QA 2LQ8A 3TVKA 2ZJRQ 1X4FA 3IP0A 2VPYB 1X5SA 1X8DA 3DOKB 1D09B 4MYTA 4KJIA 2UUAF 1GNKA 4Y6IA 5EX3A 4CIOA 3HHDA 1RTDB 3UD5A 1IBMJ 5JMNA 4Q43A 2C2OB 5HBMA 4B3TF 5GAEU 4JB8B 2MHNA 3AD9C 2DY9A 4RPFA 5G4DA 2UZAA 1T11A 1TR0A 5G0RB 1BLUA 1NPPA 4X4QA 2UUBJ 1O5JA 2KTQA 1RK8A 3HVRA 1RAIB 3AOCA 4DL5A 4DUZF 1V9OA 2VD3A 2Z4PA 2WONA 1FK9B 2I5JA 2E1MC 2CJBA 3CT9A 2MKJA 1MW7A 3D1HA 1FEHA 2NUUG 2Z30B 4GVBA 2GAHC 3NLCA 1CG2A 2OP5A 2J8SA 5HMYA 4Q5VA 2RU3A 4ECSA 4EBDA 1EX8A 3M2VA 3OL7A 3DHXA 2Y8YA 2OPRA 4DR7F 4Y0FA 1CJKB 3MM9A 4PEOA 3MM8B 2GIRA 1S6PB 5K8OA 2IC3A 4F4YA 4GKKJ 1Y4ZB 3TUJC 3NS7B 1U1QA 1FJGF 4YY3F 1R31A 4N47A 1SJ3P 3W7BA 2M8DB 2KRRA 4ETZA 3GR0A 2MQQA 3V5RA 1I3OB 2X1FA 3IXQA 2OPQA 3JSMB 3PYFA 1UWAA 2BQUA 1CC7A 2RDJA 3TAQA 5BR8F 5C5JA 2E9TA 4N8OA 5BYSA 2WK4A 2IAJA 3C15A 1R8CA 4CO3A 1RISA 1FWPA 3DXSX 2BMBA 2KVQE 4CLYA 5K20B 2DH8A 3PIOQ 2DD8S 2C28A 1AUDA 4F2SA 3CE8A 2OGUA 2B0GA 4C0BA 4OZ2A 4DQRA 4DL2A 1VBYA 1LWXA 2MKIA 2DNQA 2DRDA 4KHPF 6FDRA 3NAIA 1RTIA 3TX8A 2EK6A 3TAMA 1F3VA 2BE2B 4FF1A 2N82B 4A8OA 4PUOA 4ALZA 1YJNS 2HVIA 1YGYA 2Y1RI 5HROB 3NCQA 4DR6J 2XSJB 2Y8WA 3MM9B 3UNGC 1FFWB 5DGAA 1JXEA 1S72S 2DXEA 2AV5A 4EZ6A 1W25A 4N77A 2GX8A 1B0TA 1F9HA 3CUNA 1TK5A 3K5MA 2B5JA 3AQOA 3D1QA 1PIEA 2R7QA 3MM6B 3O2IA 4L76A 1TL1A 1TELA 5KG1A 4KO0B 2GHVC 2DNGA 4ICLA 4L74A 3W2WA 5L46A 2ZD1A 2ZBCA 1KFDA 2OPQB 3N6NA 2JLEA 3TP2A 3W62A 1S6QA 5KG2A 2DGWA 1TK0A 5CYMA 3R7SB 2DO0A 4A8XA 1NH7A 5KFOA 2DR7A 4BS2A 5EUHA 1YHQS 1WF0A 3IGVA 2PSZA 5GAGI 3RJMB 3DU6A 3QLHA 1CSJA 1KVJA 1YIJS 2V0NA 4TY9A 1VQ4S 1PSDA 1SL0A 3OHAA 2M5YA 2XSJA 2V4RA 2ZNZA 3C46A 1TTHB 4WK1A 3M1VB 2NREA 4DN0A 1ZAXA 1SJ1A 6AT1B 3I31A 2BQ3A 1XNRF 2ZM6J 1SJ4P 4XDDA 1TL3B 2FVPA 4M5JA 3TAMB 4O4RA 1KN6A 2FVSA 4TY8A 5K14A 1XMOF 3KHLA 4NZ0A 1BY9A 2X1GA 2ZEJA 3MECA 4KO0A 5KFRA 1U0HB 5LMNJ 5FJ4A 1AA1B 2QGFB 4JI8F 2FJWA 2GV1A 1YZ6A 4CO5A 4KPCA 3BS9A 3W9JA 4DR5J 8AT1B 3D7SB 2BOAA 4P72A 2BRKA 3I4PA 4BDPA 1IR2A 4M5GA 3MUTP 3TA0A 4WFBQ 2UUTA 2VBYA 1GXTA 1R8HA 1XR6A 2GIQA 3KLEB 4UY85 3J7Z5 3N4WA 4YDDB 3VZHA 2IY5B 3BPSP 4USKA 1KC8T 5IS2A 4GC7A 1S6PA 1SC4B 3ISZA 3D28A 1M1HA 1NPKA 1X5OA 1S4EA 1XTZA 1VR6A 2A1BA 2NSBA 2QL5B 2ZUAA 3HD1A 5DETA 4ED1A 2XY7A 2CJAA 3GV5B 4C8KA 3Q83A 3CO9A 5LJ5Y 2W8KA 5AXNA 2XO6A 2PE8A 1WHWA 2YNGB 1SCJB 3Q22A 4DSFA 4QCLA 3M8RA 4M1KA 2ZNYA 2NR0A 3OXFA 3U1NA 1ZTWA 2PI4A 4OI6A 2IJFA 3CJKA 3G6YA 4OZ5A 4F26A 3V81A 4LF8F 3EVOA 2CXEA 1EETB 3E01B 1MG7A 1CQMA 3P5BP 1F9FA 1S7HA 2DPJA 3US5A 1NDLA 1PAUB 1QUPA 2LYVA 3FZ2A 3ZZZA 2VIHA 4TKTA 4UOGA 1M1KT 1CJKA 1TQLA 2X3GA 2XY6A 2BJ7A 3EGWB 3MR6A 1J5OA 3FSXA 2AW0A 2FGOA 2PEBA 3IG1B 2R3VA 2UU9J 4C8NA 3SV3A 3SYZA 4N56A 1IWGA 3D6TB 1DTQA 1SH0A 4X4NA 2KB2A 2D41A 4FF4A 1N34J 4LSLB 2ZOMA 4NRTA 4YB6A 4CI0B 4ZKAA 3MM7B 1HBUA 1X5TA 3DLKB 1WEZA 1UEKA 4MH8A 5B7WA 2KXNB 3OTOF 4CH7A 3T1YJ 2QO3A 3JQJA 4DV6F 2V2KA 2KHCA 5LT5A 2CVEA 4ER8A 2M8HA 4F04B 4ANCA 1TL7A 2G2ZA 4JYAJ 3LWLA 3JYTA 1RT1A 3THTA 1R6YA 2YH1A 2WW8A 2DISA 4G1IA 1T9YA 5KG7A 3CMES 2ZKTA 4WYLA 1T8EA 2GNKA 2YKOA 1CULB 3NBPB 1HWJA 1HKAA 3PCOB 3MPYA 4L3KA 1O6XA 1G4CA 4OHYA 4KHRA 2ZM6F 3MGJA 1TL7B 2R7RA 1CVJA 2YPZA 4MK7A 4CCHA 4FVMA 2B9XA 2M7SA 4OI1A 2H4WB 1NCLA 1FRIA 1YJUA 1YRTA 2CPFA 3ISNC 4WJBA 3HMJG 4X62F 1H6KX 3NMRA 4HT7A 3FEXB 5DLFA 3M1VA 3ZTOA 4CLUA 2W01A 1JJHA 2JNJA 4NYPA 1TMJA 1PG5B 4B3SJ 4F4XA 3QRQA 1KHWA 2FHKA 3MCNA 5LOQA 1N4LA 1T05B 2ACMA 3QT7A 3H40A 2H48B 2AEMA 2AGPA 2BE9B 4A8KA 3TEGA 3TVZA 1J5OB 1GK8A 2R7SA 3PRDA 4QR1A 3RRHA 3MFHA 3AXKA 5M2PA 1WHXA 2O3DA 3LQVA 2DR8A 3EE3A 5M2RA 3Q8YA 4TVAB 2V4JA 3RAMA 1MWYA 2AKWB 4DI6A 4GKJF 4RNFA 3TOQA 3TRGA 4XO0A 1S1TB 3GYXB 3MR3A 4PXEA 4GO5X 3KKFA 4HDGA 2XSFA 3TJ9A 2F4FA 2KYXA 3TO8A 4F4AA 2BANB 4Q7AA 4UT4A 4IR1A 2M0GB 2HQ3A 2C2DA 3CCVS 2BANA 3QSYB 3FCWA 3G6VA 5J2NB 3W61A 3FQKA 2GVZB 1CJTA 1CJVB 2JFDA 3U7JA 3DRPA 4LT6A 2EBGA 5J1EA 4EEYA 2W1BA 2VG6A 5K8PA 2XY5A 4RW6B 1HWKA 2ZUGA 3LW5C 3NGUA 3BSOA 2HSEB 1U25A 1CS4A 2P9EA 2ZOGA 3M9OB 2HZAA 2DNYA 4OHZA 3SDEA 1V6HA 3TR5A 5I3UB 1L3UA 3NCPA 4GKKF 5AXLA 4F67A 4YMEA 3V6HA 5J2NA 3DI6B 2DY1A 1X9MA 3I0SB 2L9WA 4WZMA 3R27A 4WP3A 1FTRA 1VOMA 2E44A 3TZZA 2KT5A 2AIRB 1BUXA 1HNVB 1NRKA 2HBQB 1E6VA 1SKUB 4GO7X 1LOUA 1RCOB 5HP1A 2BM0A 3D6MB 2R7XA 4YQWA 4I4BA 1ZYQA 2B3TB 2PA3A 3OBIA 3FEZA 5GAEI 4ZP8A 2J9CA 4OV6A 3R1LA 1RJJA 2XYGB 2DNKA 2MPUA 2OSRA 3HT0A 3S6EA 3W65A 1NK6A 4B3OA 1KNZA 4DV4J 1TAQA 2XGQA 3MD1A 2R7UA 1RWKB 3RB4A 1Q81T 3KMSA 1SB6A 3O8WA 1I94J 2ADCA 3MMBB 2HHUA 1IR1A 2GW8A 1JLFB 3Q23A 1U47A 1WG4A 3ZC4A 3FDSA 2ASJA 5FDLB 1OWXA 3GSDA 4B3OB 3B8HA 4QU6A 3ZZYA 1VRQC 2GMLA 2QN6B 4M5DB 4OYIA 2DK2A 3EM1A 3MOZA 2V6AA 4YUDA 1RT6B 4TN2A 3UD3P 3CD5A 1RHRB 1K44A 1TKDA 4C3LA 3H20A 3LGMA 3UNYA 3J81j 3P96A 2FJDB 2QG9B 1FE4A 2QFIA 4ZMMA 5EDWA 4DR6F 4EBEA 2F8EX 3OFHA 5KFIA 5GMEA 3RB0A 1U6BA 3M6XA 5J1PA 4WP8A 2GVDA 3OVSA 3I9V9 3BSCA 2P9CA 4OHXA 4K2JA 2VG7B 3T5KA 2IYGA 2W9CA 2GHWA 4KH0B 1LWEA 2UXBJ 2W4CA 3QBCA 3UDCA 3I55S 2CPHA 3GFYA 2CDRB 4CT8A 4P6QA 1RT5A 2CPDA 1NO8A 4QZVB 4K5RA 3OFEA 4D3HA 5IQQA 3DYAA 1GX5A 1RAEB 1RTJB 3RRKA 3ISND 5CCLA 1BQMA 4GC6A 1R0CB 3RBZA 5DGBA 2Q6BA 4UTGA 5D4LA 1DZ5A 1D9FA 1CLFA 3M4XA 2NCKL 3BBBA 4J9VA 4MTPA 5LSRA 1QSYA 1H2VZ 4OJ3A 4LREA 1XERA 3MAQA 2X51A 3GJTB 1ACMB 2W7OA 2HQIA 3UVJA 3V6DB 3P6YC 4F50A 4HACB 5K9FA 3GILA 3K7RA 3GV7B 4JI8J 2E5IA 2DT9A 1VQSA 1NB7A 5LXYA 5ADZA 4ID5B 1Q0NA 3UPFA 3K59A 3U1LA 4EWTA 1UP1A 2RB7A 5KFNA 2V4JB 2R2TA 5A2QU 1RWXB 3DRSB 1QE1B 3R6LB 1HNIB 1VRUB 4ID5A 1WELA 4ZPDA 3S1TA 2LP4A 4AYBD 4ZHRB 1XJWB 5KFHA 3NG8A 1BMQB 3R5JB 4FKYA 4NEZA 5GMKa 4BCAA 1L5UA 5A6WA 3CD0A 3J81Y 4DR3F 4LF4F 1R89A 5HJXA 4DL4A 1NBEB 3WC2A 1NSPA 4DR5F 3J81U 3A12A 1FXDA 4O3RA 2P2CB 5JVGQ 1BQXA 1RE1B 4KRWA 2EPIA 3VQSA 5HAOA 5D15A 1UVNA 1GEHA 5B0DA 5F3ZA 1XR7A 1CBKA 3IBWA 2QLFB 1VCTA 5E3QA 2AX1A 5L1KA 3UR0A 5ETOA 4NPOA 1IJEB 3ZFVA 3IN5A 2E5LJ 2UVWA 2G2OA 1S79A 2ALZA 1X4GA 1VRTA 1UVIA 2MJNA 2K06A 1RAAB 4NLTA 5C2CA 5LL6d 5KFCA 1JLQB 4IRCA 1KTVA 1KLMB 4LF8J 3L3CA 4O3SA 3KOAA 4P2FA 4IFVA 5KFTA 4ED7A 4LFBF 4QPXA 4A8MP 1FNMA 2GVDB 4KC5A 4IOAQ 3CCRS 4WKYA 2HW3A 1RT1B 1T0TV 2LXIA 3GFZA 3UDEA 2RF2A 3R2CJ 4NA1A 4AL5A 2EEYA 3IR7B 2UU9F 2W7PA 4M8LA 2YKQA 3KG1A 4RBUA 3K5LA 4JI7J 3MR5A 1MNEA 1KOHA 3Q2TC 4MK8A 1LFPA 1NJYA 4Q8EA 3TZYA 1WHYA 1HBOA 3ELHA 1RA7A 2YKNB 3AB2B 5KT7A 2BRLA 4JI4J 1S12A 3OHBA 3D0GE 3KLVA 2EFPA 3D66A 2RQCA 4UZCA 2RKIB 4MAKA 3ZNUA 5A8WB 4LR7A 5E2QA 4AD6A 1Y5IB 3MMBA 3Q8VA 3TUZC 1S99A 4WXWA 1SJRA 4ZK7M 3MCMA 3CDEA 5D0HA 4URGA 4RNNA 2HLUA 5B0EA 1H98A 2PIIA 4JI1J 2FQQB 1UVKA 1EIYB 4OZ0A 1ZBTA 2CPXA 5AJ3J 1KOOA 4YHHJ 2C2KB 2GO9A 1EETA 2VPXB 3E01A 3PW7A 1Q5VA 5IT4A 2IVYA 2VG6B 3T1HF 2HGLA 1M5HA 5HANA 2E9ZA 2Q66A 1EB0A 5IC4B 2I1RA 3OR2A 5KT6A 2HRUA 3N28A 1RT3B 2H5EA 1IUJA 4G1QA 3OLAA 2HAFA 5CCMA 1A7GE 4X62J 3MPWA 4FPIA 2MGZA 2MLXA 1TZ0A 5KTQA 3A8EA 2KJVA 2QL9B 2VJUA 5C42B 2C2MB 5ETKA 1FRMA 1Y5NB 3HDSA 5KT5A 2VFVA 3BDEA 1LFWA 3FFIA 1F3FA 4OZ1A 4WYWA 3SXLA 4EO8A 1UEUA 3J80Y 1NM2A 2XYPB 4AFFA 2C22A 1P1TA 3PR5B 5SUHA 2DGXA 1FKAF 3C3LA 3HVTA 4DR3J 3HXMA 2VZ9A 1REGX 2RH3A 2MQLA 3DRPB 4ZPVR 1O0PA 1OO0B 4V1Ak 2R9LA 1PGZA 3LO3A 2HWHA 2YQ3A 4PG4A 5AT1B 3DRRA 4E8UA 4XIUA 2LXFA 4FN5A 1NK5A 2AX0A 1Q4RA 2YX4A 4DX5A 2ZJQQ 3DRXA 4Z7CA 3QYYA 4Z2XA 1NK0A 1UVMA 3MXHP 4L3NA 3AXMA 3FNNA 1B3TA 4R0JA 2DH9A 4GVLA 8RUCA 3OJUA 3W8GA 2CJKA 3IR5B 1Y11A 2D7SA 1JLCA 2ZFHA 3CF5Q 1REVB 4AL6A 4DPOA 2OFGX 2I2YA 2KFNA 2HHXA 2SXLA 3WZ0A 1WG5A 2CQ2A 2HAIA 3SV4A 3I4HX 1XN9A 3KUGA 3W5YA 1SIWB 4PZVA 5C7PA 4IH7A 3S7RA 1QAIA 3R9LA 4OLPA 2DHHA 1JXVA 2RIJA 5HBMB 1NKBA 3CDBA 2B9EA 1UJ5A 4IG3A 2ZZMA 2AGOA 1YSJA 2YXLA 1P27B 1WHVA 3FMWA 3M8PA 2UXCF 3HHEA 3IC1A 3GWCA 4IG3B 2HNYA 4C6AA 2B7BB 3OXGA 1EARA 2YWGA 4WTOB 1C4AA 2N4DA 1U49A 1IWAA 4USVA 1K73T 4RBTA 2EVZA 2I5JB 5BYQA 3CXCR 2ATLA 1J5EJ 1RZMA 4MKYA 4I64A 4KAIA 4DFMA 1JJ2R 2WSEC 4DX7A 4XK8C 4DFJA 4ECZA 2W9AA 4JV1A 5CZXA 1PAEX 1S59A 3G82A 3MTKA 1FRHA 2H4YB 3RU0A 1HI8A 3QJJA 4F0KA 4K0KJ 2HVZA 1VMBA 2L41A 4RR5A 2XCAA 3VVTA 1JLBB 3B4MA 2HHHF 4KH1B 5IZHA 4TU7A 3DDNA 4FXDA 3NBPA 4QOTA 2K2PA 2DRBA 2LEAA 1VC0A 2DVIA 4RJVA 2QRRA 3DI6A 5LM7E 3E51A 1JLAB 3CO0P 3VAMA 3T1HJ 5DG7A 1JLQA 3M8ZA 5CYJA 3RZAA 1TKZA 5F0WA 3I5BA 3ZZRA 3EPGA 1WORA 1FF2A 1FKPA 2QIFA 3HULA 1ZM9A 4CYUA 1TL5A 1IBKJ 3EX7B 1TUGB 2BE2A 3IWLA 4MFBA 5T7LB 1OPZA 3HFZB 3VGVA 1N5YA 2B4PA 1VIOA 3PX4A 1VBKA 3FBEA 2JFKA 1U6FA 2J9DE 3BGFA 1RLCL 2IA6A 1RCXB 2NLWA 3M30A 5EGYA 2ZHBA 4DMZA 1URRA 2XYHB 3H5SA 4CLWA 3PDNA 4XPCA 1JLEA 2VQEF 4WE1B 2HFUA 2DO4A 2DHAA 1YTYA 2NXCA 1RXOB 4ECVA 2E1CA 5AE2A 1GQEA 1AYEA 1JLEB 1MMNA 3CJ8A 3P49B 5CA5A 1NHUA 5KFFA 2AEFA 1UJ4A 1WI6A 5ETRA 2RDIA 4EO6A 3TZXA 5CYQA 4ETXA 1HQUA 3PW2A 2FLLA 2N7CA 3GIKA 5L9XA 3V81B 3JAMU 3LF0A 3NGSA 4FF3A 3AY0A 3KJNB 3KXDA 1GMVA 1ZAWA 3BEGB 1NXIA 1RGVA 3K2YA 4NA3A 2H5JB 5J2PA 2XLJA 2XMKA 2BXJA 1SUQB 2G9OA 3NAHA 3OD2A 5KFUA 1QAJA 2MQPA 4P52A 1VISA 2IMOA 4G1PA 1IBMF 1SC6A 2GS8A 1JKHA 2M88A 1OY8A 2VG5A 5CH7B 2KZMA 4E98A 4DUYF 4ZVEA 3K5PA 5AE3A 1VFJA 2RS8A 5J2MB 1TMMA 3PXGa 5KFQA 3J7YI 3X1LB 4IFYB 1S9EB 5DM7Q 1S4FA 2MZTA 1VQ6S 3HT3A 4MIBA 4B9MA 1AZSB 4E0DA 2RDDA 4ZJLA 4ECRA 2HHTA 1T03B 1U7LA 3KG4A 1YLXA 3ONQA 2CKWA 1ZZFA 5B0GA 4ZN3A 2MY7A 5F8LA 5CD4H 4JV2A 1FJEB 1M1GA 1U1MA 1L3TA 2XB2D 4M5KA 4C0HA 3AFGA 2OPSB 3F0NA 3UN2A 4X66F 4DSJA 3HZEA 3MECB 3TAPA 4JI3F 3SCIE 3AD8C 4TU9A 1RI7A 1U45A 2YWKA 1S0OA 1M90T 3R5BA 1AUSL 3R7NB 4HDHA 3ZZUA 4OI2A 4ZVOB 2E5GA 2P8IA 4UQTA 5HI7A 4ED8A 3DFEA 3L95X 1FT8A 4RUCA 2GMJA 1NAQA 2K1RB 4QIGA 2ZZNA 4KQZA 5D4OA 4C2MA 4NXNF 1O51A 3PJ9A 3AA9A 2NYHA 2E5LF 2QLBB 5L1LA 3PJWA 1FI4A 4K2XA 3PJXA 1XWLA 3LPYA 4JP8A 1IBCB 4LSNA 3FQLA 2BJDA 4PPDA 2KHDA 2VHGA 2RRAA 1T9WA 1XIQA 5BJRA 2VASA 4PUOB 3KHGA 2G2YA 1JB0C 5D78A 3J7ZT 3UFCX 4ECUA 1Q7YT 1QD1A 1VLYA 4CLFA 3Q24A 3C2PA 2KU7A 4C11A 1K9MT 1UPMB 4CM2A 2X7IA 5KFYA 3DLEB 4G65A 2VA3A 3A8JA 4DV2F 4HTJA 2YNGA 4KSEB 1N5VA 3MM6A 4NYOA 4I6YA 4IH5A 4Y00A 5A0YB 3CCMS 3BO2A 1EZZB 1EQMA 4DPYA 5E3RA 3Q8RB 3CIMA 4PYAA 4IDKB 1S76D 2DXDA 3CWJA 3SZ2A 2DGOA 3KLFB 1LWFB 5HN0A 3M8SA 4DV1J 4URQU 5CABA 4FYYB 2OKQA 2DRAA 2EXUA 4C0OC 3V6JA 1ZA1B 3KLEA 2WZ1A 3DLGB 3IM8A 4EMDA 2XMTA 1DARA 4Q2LA 1N32J 4NMXA 1LWCB 4RWXA 4YHHF 2JVRA 2K7JA 3U27A 3KLFA 3BGRB 3QPIA 2OPRB 4ZLJA 2Y0SD 2BA9A 3TUPA 4ZN1A 2CJXB 1HYSB 2BJ3A 2DKOB 1NLKL 3QWUA 3Q8SB 1FD8A 3AHPA 1U0HA 3PTWA 3OVBA 2HBYB 3DMJA 1M5OC 5DG9A 5AJ3F 2CNOB 4DZDA 3ENWA 1VQKS 1JX4A 4ZVTB 3VAIA 1XNRJ 3D3BJ 3PACA 4NLQA 1IJFB 4QIVA 3P5TL 3M8YA 3U1MA 2OMOA 4X65J 4ANDA 4TYBA 4TU8A 4FS2A 3CB4A 2H51B 2W24A 2KL8A 3BR8A 4HI1A 1VQ8S 1B99A 2ZBPA 4PG5A 3OW2R 3A3NB 4U8YA 1UCNA 2K7KA 1KQKA 3TEHB 5IM0A 1VC5A 2NZCA 3MR2A 1T05A 4ES2A 3I5AA 3CJ4A 1LKZA 4PKDB 2HFNA 3NY0A 3JAMY 1V5VA 3H42A 5A8KA 1UFLA 2M70A 2WONB 3NP5A 1WOPA 3I9ZA 4P9SA 3A3PB 5MLCV 4DV5F 4QU7A 1BGXT 2OPPB 3P4UB 4NOHA 4OLOA 4WIQA 3ZTRA 1WKLA 3MAAB 3MPDA 4OV1A 1VJQA 4HTIA 4RBVA 5FLXY 4F4KA 2N3LA 2IM3A 2NS1B 4ECXA 3CULA 2KFZA 1BQNA 4USMA 1FESA 4R5PA 3OSNA 4FBTA 1YZ7A 2ZBIA 2AGQA 5KFMA 4HLBA 1H74A 1YG0A 2F5GA 4RUAA 3KJVA 1RBAA 3MOJB 1H73A 3EVMA 4U7UK 4RUHA 2IM0A 3DGPB 3DM2B 1U8WA 1UPPA 4R8UA 4O0IA 2AQ4A 4WWSA 2A6MA 2VBXA 4DR4J 2HMIB 4NCGA 2W2PP 3QWPA 2WVBA 2UXCJ 1S6OA 2APOA 3ENAA 3ADAC 4KGXB 3KK2B 2HGMA 4HR2A 3QFWA 4PG6A 4YDXA 1R8PA 3BDPA 3KDNA 1GMWA 1R6VA 2PN6A 3BR9A 3OXLA 3T19A 1ZH5A 1HBUB 3DLKA 3IR6B 4DQSA 1HIYA 2V8PA 1Q79A 4YP3A 1B70B 2MEWA 2J0XA 4CWBA 4QBUA 1N33F 4RZRA 3M6WA 4NI2A 3UD4P 3ZZTA 2RT3A 4Y2MA 3W63A 2QT7A 4PAAA 1C4CA 4HVZA 4J9KA 2GA7A 1C0TA 2ILYA 3CVKA 4RWWA 3CCJS 3M2UA 4NLDA 1D8YA 2XMJA 4ITSA 3RW7A 2XGPA 2ZH2A 4K0KF 1V3SA 5FIIA 1J5EF 8ATCB 3BKUA 3AOBA 2VKZG 3UCZP 1TVRB 1FFSB 2F7VA 4P74A 5FD1A 1U2CA 3CCTA 3EUNA 1Q16B 2CQDA 3PNIA 4I6WA 4TXSA 4ZVRB 5B0FA 4DL0C 5EHHA 2HURA 2DHGA 4OX6A 3H2LA 2N3OA 1SPBP 1BQMB 1FJGJ 1ICEB 2CQBA 2C3PA 2YX7A 5L1IA 3O44A 2VJVA 1FJCA 2AJQA 4MIAA 3SSRA 4RW4A 3QIDA 3KK2A 4DR2F 3BKFA 3QGIA 2R2SA 4TLRA 4KFBB 3QQCD 4B3MF 3RAQA 5BR8J 3CD6S 4ZP9A 3BN4A 3AB4B 1R3NA 3LWMA 4AL7A 4C8LA 2QMUB 3D9BA 4DG1B 5HLFB 1Q8KA 5MAOA 4I1TA 4NLUA 5EWFA 1JMTA 1OYEA 3ZZ0A 4ZLPA 2VQFJ 3CNQP 4B9SA 3CJQA 4DSKA 3DN9A 2UUWA 1D9AA 4M5IA 4ZOSA 2YWEA 1VC6A 2IDLA 4W90B 3G82B 2AHOB 2RMLA 5KAKA 3AH6A 3GCWP 4I69A 4OX7A 1RTZA 1UW9A 2QLJB 2YY3A 1UL3A 3FVYA 3F73A 1FWKA 1FO1A 1TU0B 4WPAA 5THWA 4LFCF 4F8RA 2HRYA 4QWCA 2AYEA 4Z37A 1RHQB 5KFEA 3JYTB 3MTJA 1HBNA 2ZH1A 3MEGA 2OFHX 2EFQA 4ECWA 1NHVA 4DL3A 3PFEA 2HGNA 3V4IA 2ALYB 4OMFG 3TI0A 3MAHA 3SMZA 4ZVGA 5E33A 4B3SF 2HIYA 4X4VA 4GKJJ 4EK2A 4B3RF 3K8VA 3MEKA 1YJ7A 1Q86T 5A76A 2JJ4D 3C16B 3ET6B 2X1BA 4TQSA 5KFSA 3LAMA 2KG1A 4MYUA 2IM1A 3PHEA 3Q2SC 3JQMA 2WCXA 4WBFA 4RW9B 4CLKA 2DCLA 3S01A 3RAXA 1VQ9S 1C2PA 1HNVA 4J9QA 4YFUA 3HSDA 5JXSA 3SBMA 4FYVB 1NK7A 4ZS6A 4C9DA 1S1WB 4TQRA 3ETOA 1KBRA 4NLPA 4WCEQ 1VQOS 3NWRA 3UQSA 4KV8B 1P8GA 3H5YA 5L39A 2ZKUA 1Q78A 1RU1A 2VFTA 2NPIA 3IBCB 2R8IA 4DF4A 4USIA 4BHQA 2FUG9 3PM9A 2E66A 3IAS9 2WHOA 3MZIA 4I0WA 1T9TA 2AJ4A 2BV3A 1K47A 2XMUA 5J2MA 1HHTP 2C3MA 3QMQA 3G9CA 1RHUB 1T9XA 2ASYA 4I68A 1RAJA 5H9EK 2LLZA 4USTA 5BXIA 1HYSA 1N0UA 5HO4A 4B17A 1ZM4A 3R1HA 2E7WA 2WW4A 4ZIVA 3DRYA 1H72C 3H25A 2FJVA 4JI3J 2EWHA 4OFZA 4UZBA 1G3OA 3I6PA 1Y9OA 4Y2CA 2P9GA 4WIIA 1HNZJ 3MD3A 2BVZA 1NSQA 1LXJA 2X1AA 1OSCA 3H0PA 3B6BA 2MDAA 1PBAA 5IV4A 5IQ6A 4LRBA 4YB7A 4C4WA 2R7VA 1JQGA 2DITA 5L38A 1TV6B 4KV8A 3M6UA 4FYDA 3HCXA 1I1GA 2J7UA 2MGZB 4LR9A 4QPTA 3D3CJ 2K3KA 4R0EA 3OTBA 2ASDA 2MKSA 3LH2S 1FCAA 1JLGA 3BH7B 2HBZB 4ATNA 1F6TA 1JJCB 3LOUA 2J0WA 5DLGA 1R0AA 4LBIA 3RW6A 2DYAA 3P45B 3CEDA 4USHA 1CC8A 2IVMA 1FD2A 5F0UA 2MXYA 4A48A 2QMWA 1HPZB 2MLYA 1FRXA 3BM7A 1UA0A 3O5TB 4K7QA 2OJ3A 3FZBA 1YJTA 5E3AA 5FDLA 3AA8A 1IVZA 1N88A 2OEMA 3OTEA 4DZ6A 5DM6Q 1WUUA 1YJVA 4KKOA 2RQ4A 3HVWA 5J2QA 2WOMB 1RUSA 2G1HA 1DLOB 1I5OB 1LW2A 4ELTA 4QW8A 5A8WA 3A8KA 3TVYA 2AJ0A 3KWMA 5ETSA 2CQ3A 4FNIA 2YKAA 4C3MA 4EU0A 4OHWA 3FRYA 4H4OA 1W7WA 4HT5A 1TKTA 1V3ZA 2LXUA 3CCWA 5A2QY 3BYPA 2IYIA 5B0AA 2V2QA 1VQ7S 2EG1A 3V2UC 4ILMA 5HVGA 5KFWA 1J2VA 4DV3F 1AB8A 1FVQA 4DR1J 2VUGA 1FERA 3JSYA 5KT3A 3OTOJ 3BJYA 1HA1A 2JEFA 1HQ2A 1LW0B 2OEJA 2FC9A 2OD6A 1X4CA 3MAAA 4P71A 2QA4G 4IRKA 4BLGA 2DNHA 3IRWP 4ED5A 3MM7A 4F7VA 3EZOA 3HD2A 1IKWB 3PYDA 3D67A 3RBEA 4WFNQ 4F0MA 4DUTA 4J5OA 3GU0A 3GIRA 1QVGR 3JTPA 3HPOA 3P3DA 2WOMA 2E1PA 2GJIA 5L9NA 1SQGA 3WHIA 5F3TA 2BEFA 3HX9A 4C8MA 1QE1A 3GV8B 1LV5A 4N5SA 4QR0A 4DL6A 3UCGA 1K0VA 3BBCA 5A8RB 4OZJA 4C7QA 2LKZA 2CG4A 2CWKA 2E7XA 2M52A 2AF6A 3I96A 4ZPTR 3SSQA 3CPWR 4A8WA 4K59A 1RLDA 3HHLB 2XM3A 1FDBA 1SJFA 5DDRC 2LU2A 2RE1A 9RUBA 4OI0A 1YBUA 1RKIA 3D0IE 2XMAA 4NLYA 5DZ6A 4PPZA 4RNHA 4DV5J 2CNKB 4M63A 4HHJA 1HQUB 1Q8IA 3VWSA 3FJ2A 4LRCA 2BR0A 1FA0A 1OS5A 4XAKA 4CP5A 3QATA 3UI3A 4DX6A 1Y0HA 4YEAA 3SCJE 1PYSB 4DV7J 1RTJA 3PO5A 1YVFA 5C25A 3ZO7A 1KLNA 4UOFA 2D9OA 2WAQD 2KI2A 3TZWA 3VAKA 2UV8G 4C48A 1TKZB 3GQCA 2D3OR 5FLXU 3HSJA 2DR9A 2MY8A 4DU8A 3EMTA 2EBEA 1LQ9A 1TAUA 2I9SA 2LDYA 1SL1A 2UP1A 2XI2A 4CH0S 3W1YC 3ENQA 3RR7A 4YS2A 5T7LA 4KBIA 4E2FB 4XPEA 3K58A 3TJ8A 5G0RA 3Q86A 5F8MA 3WC0A 3JSBA 4ED3A 2PD1A 2H54B 2DGSA 3HHNB 1GH8A 2EFOA 1S7IA 3NNCA 2CIMA 4RKUC 2OLWA 3GLJA 3BGOP 3EVWA 3W9HA 4ELVA 5LMUJ 4JI7F 1HHQA 1EQ0A 1BHNA 2BKOA 3JS9A 3SFGA 3PEHA 4DXLA 4J9SA 4JI1F 2E1RA 2FTRA 3UCUP 3FBCA 2H3EB 4O3QA 4L73A 2E29A 2LEBA 3M32A 4KE5A 2H1YA 2JEJA 1M5PC 1NMEB 2BYCA 5B08A 1P9YA 2V63A 4NA2A 1RU2A 4ZPAA 1IKXA 4NCAA 2ZD1B 3A3OB 5HP1B 4ZPBA 1XK8A 1N8RT 2C2RA 3M8PB 3T3FA 4WFXA 4CO4A 1X7VA 2W4DA 2UVVA 2ZH9A 1F5AA 4LFCJ 1HFEL 4U67Q 5LMNF 2HPUA 3GIIA 4J9NA 3I56S 4AQYJ 1VGYA 2QMXA 4ZCIA 3CC7S 2C3UA 4DX8H 3R5CA 1UMJA 1PJ5A 2FYXA 4Z7YA 2O67A 3WX4A 3MI7X 5HQMA 1XNQF 5ETVA 1X0PA 3HO1A 1C0UA 2NXUA 2QX0A 2W2NP 1MROB 4KGZB 4LIRA 4LF7J 1RTIB 2IJNA 3NKYA 3IRXA 4U96A 1VQNS 5IOLA 4USJC 4K4SA 4QYZJ 4X64J 2DGVA 4C8YA 2NYIA 1X4DA 4DOZA 3M2RB 4DQQA 2D3ZA 2OTLS 1QAXA 3N0VA 2Y9HA 1A6LA 1DBDA 1UW4A 2V67A 5IT0A 5I3UA 3QZ7A 3OSPA 2V9WA 1RAHB 4U6PA 3MUVP 3O3LA 3MMAB 2K8GA 3IA0A 3AAWB 1RYSA 4KPYA 4B3RJ 1FNOA 2VL1A 1VYAA 2DBBA 2EI5A 3DHWC 4C11B 4ES1A 3KLHA 4OYWA 4I6AA 2HS3A 1TUWA 2F8HA 4BC9A 2J76E 5J1EB 1S9GB 2VODA 2HKEA 3CD7A 2LQ5A 2VV5A 3OL9A 2A10A 3GP9A 1KSPA 1C1CA 1JWWA 4FPRA 2AU0A 3FRZA 4IG0B 2IC3B 3H98A 3FK4A 1CJUA 1URNA 2CQ1A 2UXDJ 3C15B 1WTFA 5KT4A 2DR5A 3CMAS 3M2VB 1H2TZ 5DQIA 4B3TJ 2Y1JA 1VJWA 2DGTA 2RKIA 3KUEA 4L6V3 1L3SA 2W2MP 1H7XA 3VGUA 1AW0A 3CJ3A 2NXEA 3A8IA 3PG9A 4NLSA 3GCXP 1B7YB 3LP1B 2BDPA 5ITHA 2FHJA 2ZWOA 3MM8A 5JJBA 1EHWA 2JSXA 2D3O1 1RA6A 3ZNJ1 3HM9A 3UDVA 1MWZA 1S6UA 1UWBB 1S5ZA 1NZAA 1VK3A 2XMVA 2YKMA 2OPSA 3AOAA 2QL7B 5ETTA 3J80U 4LRDA 4FYWB 2XWXA 1ZAVA 3R2DJ 1VQMS 2IHR1 5C24B 3VAFA 2B9YA 2Z58B 3G2XA 2V8GA 4YY3J 4CTAA 4A47A 1RT4A 1WEYA 4RU2A 2B7CB 3CCUS 1K1QA 2GQ2A 2M3DA 1FRJA 2C1EB 2MLZA 4AUKA 5GADI 1EJ7L 5GMDA 2FJAB 4FVCA 2RU9A 2FIUA 2CQ0A 5K8MA 1SJQA 4ID8A 3NGRA 4JI6F 1GAOA 1YBTA 2IRUA 2ZH7A 1RWUA 3MEDA 1MMLA 1FWLA 4LF6F 5U47A 3W2VB 3IS9A 4HH1A 4KFBA 3W9IA 1F1BB 5E3PA 2CQHA 2P6TA 1Y00A 3ZTPA 1JNRB 2L9NA 3PYEA 5IFMA 2ZDOA 1QY7A 2L9DA 4PG7A 5ETNA 4A8FA 3D68A 3KMQA 2YNFA 3KJQB 3EICA 1VS3A 2QZ8A 2F9JA 2PGCA 3IFEA 4D3GA 5I42B 4X64F 1PCAA 3W8PA 1RHJB 4Q44A 3LUYA 1RT4B 4WK3A 1DTQB 2ZWPA 3VQTA 2IAJB 2JZ5A 5JVHQ 3GG1A 2CQPA 2HQCA 2BQRA 4A8YA 2CQCA 3V6KA 3SEOA 1MSWD 2XTJP 4F3OA 5C2GA 3O1LA 4DQIA 2XULA 1QUVA 4RLEA 3J7YU 2HBRB 1X9WA 4IG0A 3WQPA 3SI8A 2I38A 3UWTA 5D3GB 2YNHB 2FJEB 1S97A 2YNFB 1RTHB 3LP1A 1Q8LA 1S1UB 3KDOA 1YRXA 3CJKB 3RB3A 2FZKB 1FDAA 1HQEB 2GCFA 1G2EA 7AT1B 1NK9A 5AXKA 3GJQB 3CCZA 1SC1B 2FDNA 3DOLB 5DO2A 5GAGU 4IO1A 2W7AA 4LF9J 4O44B 1NK8A 4UF4A 1R0BG 2ROGA 2QSWA 3G8TA 4ZP6A 5KOXA 2DNPA 1APSA 1UETA 2Z2LA 2VKRA 3VAGA 2JLFA 3K5OA 2IVFB 1MMDA 5CD4A 5EWGA 5IT9U 4NE9C 5I42A 1U6ZA 2M9KA 2ZDPA 1S57A 1I51B 2EC2A 2EKNA 2B56A 3DLEA 3P8BB 3KLHB 2UUCF 1TL3A 4NCBA 3J7A1 1R43A 2QYCA 4ZP7A 1SKWA 4N7TA 1O8BA 2XZDB 1KQFB 1NH8A 2UV8A 4NYZA 2PFFB 4K4XA 1RABB 1NSAA 2MSTA 1Z4UA 4ZVPB 5C24A 4B08A 2PI5A 2HNZA 4B9LA 5E5NA 2BOPA 2OTJS 1D8ZA 1LEOA 2V34A 4ECTA 4FDFA 3DM2A 1D0EA 4W92B 4I56A 4LSNB 5BYRA 5IM0B 4KIAA 2KYZA 2ZC4A 3MCSA 1IKVB 3OPKA 2CRLA 4TY8B 5K14B 4M95A 1MU2B 5HATA 2FJBB 2MMYA 1F9EB 3QAUA 3QNWB 1VBZA 3DC2A 4NX9A 4DV7F 4QWBA 4NMLA 1L3VA 1I94F 2OEKA 2DNOA 4LF1A 3SCLE 4USWA 2R8HA 3QIPA 4A4JA 1ZTTA 4JI6J 1TUVA 2BJ8A 2O66A 2XLIA 2CWXA 3EGVA 1HI0P 3MMCA 4ICLB 1UFKA 1X4HA 2KM8B 1OQ3A 3DMJB 2BKPA 4K4ZA 3T6JA 4DBQA 2KT3A 2DPIA 2CPYA 3NOCA 1H38A 4NLRA 2V8HA 3I0SA 1HNWJ 2ZHOA 1VHIA 5CYMB 2D69A 2GMHA 2KDOA 2LEPA 4YB5A 1S0MA 2RAQA 2EW9A 1N52B 3EGZA 4MKVA 1FFGB 1NDPA 2CPIA 3BGLA 3CJTA 3AODA 3N6LA 3OFFA 4IO9Q 2KZZA 1SI9A 4IOCQ 2FLNA 3AJ1A 2AWZA 4RNOA 3W2WB 3ZZPA 1X60A 4DV6J 2V8VA 2ZC3A 4ES3A 1RT7A 2VDIA 3PW0A 2DB1A 4XTTA 2IMWP 1RWWB 3FFIB 2XZTB 2VB6A 3IWXA 3R7BB 1JKHB 2IM2A 3FKBA 2KKHA 2KT2A 1UKUA 2MZ1A 4O44A 5D8HB 2HNZB 3IRXB 3K17A 3MHYA 2A0FB 1YJWS 1U1RA 2V5HG 2CNLB 2DJWA 4NLOA 5KG5A 2RS2A 3LAKA 2ZE2B 4OX9J 1TP7A 3HFVA 1HQEA 4M5MA 3JTOA 3L4BC 3JSMA 1U2RA 1U1LA 1Y3JA 4CT9A 4PWDA 2PA8D 3E2EA 4MKBA 2QC3A 2YNHA 3FSYA 4F25A 3VAJA 2DHXA 1KWMA 3FSIA 3MFIA 3DDIA 3BYRA 1YITS 3QRRA 5AXMA 1PO6A 3KLIA 2V68A 2XHWA 3TQ1A 4CLTA 4DCPB 4LR8A 4NZ6A 4EZ9A 4LF7F 4WKRA 3HI9A 3DOLA 2CPEA 3RRGA 1RT7B 2A3JA 3QJPA 1WJ9A 4HEA9 3IBFB 2HYIB 4NI2B 2QSFA 4FP9A 4M5NA 2VC0A 4L72B 3BBFA 3K89A 5HQLA 1PBUA 1V5IB 4OI3A 3H4BA 4DL7A 1F2GA 3HKWA 4HHUA 2HFSA 1Z2LA 1SBRA 2R8GA 4LF5J 2C2ZB 5DJBA 4R25A 1PYOB 4X4RA 4DV2J 3MEGB 4B02A 4NCGB 4IR9A 1LWEB 4JI2J 2YWHA 2LA4A 1HNXF 3MEDB 3RYLA 4WZQA 2LCWA 1GXUA 2Q43A 1T03A 1OY9A 5CHCB 4NLXA 1HBMB 3WX8A 4AE5A 2KO1A 2HVHA 3PRBA 1GT8A 4IQXA 1R8AA 3OQ2A 4KY3A 4OYMA 1H3DA 3N5FA 3Q89A 3NRBA 3NOGA 1S77D 5EN1A 1NNDA 4DR4F 1WSVA 1RT6A 3T41A 4PRFA 2VG5B 1BXNA 3M7VA 1M0SA 4Q8FA 1M5SA 3QT5A 5D77A 5A8KB 1IN0A 2JHEA 1GTHA 3NL0A 2I0XA 1ZETA 2RUGA 3W3SA 5F8IA 1VBXA 3N5BA 4ZA1A 4F3MA 3QJLA 3TA2A 2AJ1A 2D9PA 1YQHA 4JI4F 4CO2A 1DTTB 4IUFA 2Q6CA 1EKRA 4G6VB 1KQGB 2OI2A 4PWWA 3C6TB 6FD1A 5CXTA 3VF0B 4H4KC 2FVQA 2FZGB 3HKZD 5HMWA 3GIJA 1S1VA 2F8MA 1N5TA 2HIQA 1HBMA 5D0EA 4J9PA 2JVOA 2OSQA 7FD1A 1ULRA 4WFAQ 3GIMA 3DDKA 1F2HA 2U2FA 3UN3A 2ZH3A 3A1YG 3N6MA 2QE5A 3BKTA 3KLIB 2UVUA 4ILLA 4RW8A 2HHVA 3TUIC 4CH1A 1GTEA 2VICA 2MZSA 4IOBA 1P1LA 4RW4B 3KUHA 4OYOA 1U1KA 3ILOA 3OR1B 4X2BA 5EX0A 3TWZA 4NEYA 2O5DA 2AYMA 4IH6A 4B3MJ 3K0JA 2BUNA 5EWEA 2RQMA 2CAJA 2Y0BB 2GFFA 3HVTB 4LMZA 5DG8A 2YBVA 2VA2A 2RRNA 1U09A 3QO9B 4UW2A 3UE2A 1S0VA 1FRLA 1HI1A 1SH2A 2O1PA 2AJ2A 3UDLA 3J7AN 5DDQC 3NGTA 3HHLA 1WNEA 4WFYA 4J7CA 1MN9A 2V50A 2PMHA 1RDRA 1H2UX 3CJ5A 2OELA 3DOMB 4DS4A 3BV8A 1DHMA 2CFXA 2XMMA 2AYBA 2RUSA 1SV5B 1IQTA 2JH3A 3EWGA 2G13A 1HR0J 3PW5A 1F60B 2V9KA 1DTTA 3PHTA 4ENOA 3OLBA 3W64A 3JTNA 3EPIA 4RUBA 1Q7LB 1VDHA 2YWFA 4P7TA 4H4KA 3DLLQ 5B0CA 3G71S 2GQQA 1HWUA 2ZHAA 4WP9A 2QFJA 1HWIA 2X3DA 2OH2A 5JUMA 1CPZA 3KHHA 1VQYA 2Z0GA 1SKRA 2KXHA 3GPAA 2W2QP 2K3IA 4GVBB 3LA0A 4CQ1A 1WDDA 3Q8UA 3W5XA 3KNGA 1NB2A 3IMQJ 4H4MB 5ETPA 3OL8A 4B9NA 3H59A 2OIHA 1U8SA 2C3YA 3SIPB 4B9VA 3R97A 2BM1A 5I3PA 4HL9A 1QAYA 4QW9A 1WC4A 1REVA 2JLGA 3PV8A 3QLHB 1XBWA 3EXCX 1JLGB 3D6FB 3L09A 5L8RC 1ELOA 2F1FA 4OIXA 2ZVSA 3D6HB 3BPDA 3RTVA 3HSZA 2J6TA 2GJ2A 4DFKA 3EJMA 4EUVA 2FLPA 2OUGA 1GMWD 3N79A 1MLAA 4KKOB 4URSA 5J2QB 1WWHA 1DQ8A 4ED6A 4OJGA 3MEEA 4PABA 4FXWA 5M2UA 2MZRA 3HZGA 5E0OA 2HNDA 4LF4J 1SV5A 3K57A 1W26A 2CNNB 4CLPA 4DHVA 4F2RA 1WACA 1NKCA 2V94A 2MZQA 2XLKA 1BC6A 2HQDA 3V4IB 2CVIA 3WIVA 5F9LA 1KHVA 3M2RA 1HNZF 1HARA 4DLEA 2DIVA 3GSIA 1JIHA 3K5NA 5A0YA 4KHPJ 2XNQA 5HROA 4JV5J 4OJ1A 1TV6A 2BJ9A 4WXOA 5J2PB 1Y5LB 4OYAA 2H9ZA 2EG2A 2FLOA 3OR2B 1OQ6A 4LSZB 3HP6A 1S1TA 2FC8A 3MWBA 4DPUA 1N0VC 2QV6A 5KFZA 3KFWX 1HNIA 1VRUA 2HS4A 3MMAA 2ZE2A 4ZHRA 2ZBQA 3QAEA 1U1NA 2KG0A 1DJ0A 1TFYA 2WB1D 3ILJA 1PC5A 5F8GA 1TKXB 2HFVA 1LK5A 2HS0A 2PFDA 3PVXA 1XQIA 2ACYA 5ETMA 1LNQA 3B54A 1B64A 2HHWA 2ILZA 1HNWF 1GX6A 2KFYA 2Q3PA 4AT1B 1T9VA 5KT2A 1C0UB 1U1OA 4G1QB 4O0NA 3M30B 1QTMA 1DURA 2HNDB 2JEIA 3ET6A 5I4MA 2JX2A 4M5HA 3EGNA 1SVDA 2LQ9A 3D2WA 4JV0A 4K50A 1NPRA 1RTHA 1X4EA 4FBUA 1G1XA 4ED0A 1Z1ZA 1C1BA 2VPWB 4DV0F 4V19J 2AZ1A 3SQGB 3N01A 5L1JA 2BE7D 1RACB 2A2CA 3NEKA 3POTB 1S1WA 4KGMA 5T14A 2KXFA 2C3OA 4DUYJ 2LECA 2VONA 4DCJB 2W9CB 1NDKA 3CDWA 1X9SA 4DR2J 2XWYA 4DR1F 2B4OA 2CZVC 4WTYA 4KTQA 4P2XA 1W2BR 1M5VC 4IFVB 1IR0A 2VFUA 3GB0A 1IKXB 4HHHA 2EFNA 2NPFA 3W5ZA 2FZCB 4B9TA 1SQEA 2D74B 2J7WA 1WC5A 1E6YA 1ROFA 1EAYC 1SKSA 3NXZA 4O4GA 2C2NA 2QEXS 5LJ3Y 4F02A 1ZM2A 3TJAA 2RILA 3TA1A 2W9BA 2FD2A 3MCOA 3C8YA 5HSPA 4KT0C 2DNZA 2HLTA 2KJWA 3BQ0A 3C19A 3E8OA 1KD1T 1RHKB 2YH0A 3R3TA 2B8QA 2DNNA 1WD6A 1B7FA 2HNYB 2FB0A 2WVEA 2BBEA 4DLGA 2HWIA 3VALA 1AZSA 2IBOA 3MM5B 3W66A 1W2IA 4NL5A 2L08A 2RNEA 1YDLA 4QIEA 4UY8T 1WF1A 2GQCA 2HFZA 3KJFB 4N8NA 1HMVA 2I8EA 3GZ7A 2ZJPQ 1Q1KA 1CEZA 2VBZA 2VDHA 4PXBA 4CTAB 2DNRA 4OZNA 1R8BA 2YQ0A 2FPHX 4ZDNA 2R7TA 4RU9A 1SH3A 4O3PA 3UVJB 5KFGA 2VOOA 4NLGA 3CC4S 3Q8QB 4ZITA 4LRAA 2MQ8A 4K4VA 3ULHA 3NS5A 2CQIA 1S1UA 3VR1A 1Q5YA 3OUYB 1S9GA 4L75A 4EGLA 2RD5C 4QQBA 3V4MA 3T5JA 4MFBB 1FX2A 4TNOA 4BBYA 4N41A 2PT0A 4I2QB 3F41A 4JI5J 3DLJA 3VCDA 3JQKA 3NWGA 1S10A 1QTNB 4ZCLA 2N7YA 4FS1A 1WTBA 2DCUB 3R6GB 4ZLNA 2QTWA 1MWQA 1YKWA 2J0SD 2POKA 2HFOA 2JC0A 4LF2A 3ZTQA 2JEGA 1JLBA 2PEHA 1N32F 1Z2ZA 3T1YF 3GG0A 1MROA 4WFZA 1HMVB 4FNHA 1D9DA 1JK9B 3M8WA 5LSLA 2R2UA 4YOEA 4DSEA 1G7CB 1YBAA 3VGSA 3NMAA 5D6GA 3U02A 4CYUB 3ITHA 4LBHA 5K5MA 1T3NA 3IGNA 1TKTB 2RQKA 5F41A 1KS2A 4BWMA 4DPXA 1N56A 2F9DA 1B0VA 4F4ZA 3RG6A 1FNXH 2A18A 1AROP 2VG7A 1VQ5S 2HVEA 3H2UB 4A46A 2IBKA 1L3KA 2VFRA 3NS6A 5F8NA 2XS7A 1WC3A 1WEXA 1NSKL 3THPA 4X65F 3A13A 2NZ4A 4IYQA 3C14A 2WBRA 4LQ9A 3DNCA 4AQYF 1VQPS 3BN7A 1XMQF 5KFAA 3UR3C 1QSSA 2B6AA 3QGPA 4YB1P 2DHSA 3ZXWA 2VC1A 4ZCMA 4JOUA 5H1SV 1WI8A 3KHRA 3THVA 2NSCA 4MJKA 1RKJA 2MJUA 3L7PA 5KG3A 1KRPA 1H7WA 4XDCA 2EKYA 2MYFA 4A8SA 3C14B 3QRPA 2ERRA 4OYZA 4LRFA 4HKQA 4LIWA 4DQPA 3ICLA 4IQMA 2CZ9A 2B5JB 1RT2B 2J9EA 4RX6A 5E7OB 3SCKE 5ETQA 4IKAA 3MURP 3CJRA 2OD4A 2AMCB 2R7OA 5D4PA 4J37A 3IO1A 2HK2A 1D3WA 2K1RA 4Q2MA 4RW7B 3PZPA 3R8YA 4K4YA 4CDIA 1R7IA 2JDJA 4ED4A 2MKHA 2WBMA 4ZVQB 1AFJA 3DCAA 2MB0B 2KM8C 2E5HA 3RUBL 1YK9A 1LWFA 3CJ2A 3CTRA 1CJVA 1CJTB 2DTJA 2GVZA 3LTOA 3B78A 4I2PA 4EI2A 4X4PA 2UXDF 2Z57B 4LSLA 4NZ7A 1TK8A 1T95A 4DJBA 5LSOA 1RYRA 3PX6A 1RADB 2O01C 4PWUA 4DS5A 4J9OA 1RWNB 5IWAF 1C1CB 1T9UA 1FVSA 4DPWA 1UZHA 2DXFA 2V4QA 2F3JA 4ZJOA 2DEIA 2Q79A 2FVRA 2EC0A 1N33J 4P7VA 4CLZA 1PC4A 2DH7A 2ABYA 3GTYX 3HHKA 3CDAA 3KK1A 3KTQA 2PDAA 2CQ4A 2GHPA 4IFYA 3T6BA 1X4AA 1PJ6A 2Z2ZA 4ZVHA 3BQ1A 3CCQS 3C6UB 2XS2A 2B9WA 1PILA 3OTDA 4QWEA 4N76A 4PR6A 4IDKA 3TARA 2NUHA 4HACA 4NXNJ 3LALA 5J1NA 1C0TB 1IXKA 1RAOA 2ZOFA 1UFWA 2VFSA 3CIZA 2C42A 5HMXA 4QYRA 3HLUA 3PIPQ 2R8JA 3I87A 2W25A 5A8RA 3JB9k 1OSDA 4MMOA 1RBOB 1U0SA 3F56A 4PCQA 1QDUB 3FBFA 1HBOB 2XCPA 1YWXA 3T9NA 1S1XA 4FYXB 4WU2A 2G0CA 4J90A 3AJDA 1XEZA 1N5YB 4U9RA 4C8OA 4YR0A 4RNMA 1FKOB 2W4PA 3PY8A 2QA1A 2CZ4A 1TVRA 2XEXA 1YRUA 3G8SA 1U48A 4A8QA 1N36F 1QLNA 4PQUB 3GFHA 3IS9B 2VQFF 2HMIA 1Y7PA 3KLGB 3VAHA 4LF6J 1CULA 2L48A 2J5AA 3BF4A 3MMJA 3QFHA 4EBCA 5HVFA 4EFAC 2YQ1A 1DAXA 1F5CA 3H90A 5CQGA 3G6ES 2QJ3A 4OJHA 3LP2B 1VRTB 1RQ0A 4RL1A 2EFVA 4CO1A 2JC1A 1VI7A 2WSCC 2LQBA 3FEYB 3G96A 4M94A 1N34F 5CZVA 5K8NA 2OPPA 1U26A 3QT8A 1SC3B 3FCHA 3UN5A 4EYHB 2IA0A 2IFXA 4KHMA 5HLFA 4KR0B 2FY8A 4NXMJ 2R2RA 1VLOA 2A6OA 3GR1A 1Q8BA 1SUQA 3SQOP 1DQ9A 2PMZD 5H9EJ 4MIWA 5D0GA 3NNAA 2UXBF 2FVCA 2VPZB 1WG1A 4Y34A 4BC7A 1TFWA 4Y3CA 4K5SA 1KLMA 2BZ2A 1JNZB 4PQUA 7FDRA 3PYGA 4O23A 2HHHJ 3VVUA 2N4CA 2ATCB 2OAUA 1FKOA 4FZVA 4CLLA 1ZM3A 5KFDA 1OJ4A 4U95A 1A9NB 4DPTA 2DIUA 2CJYB 2V2ZA 4OQJA 3RBXA 3H5UA 1WDTA 1G6BA 1S1XB 2ZITA 4HYKA 3DLHA 2XO7A 4ZVUB 1KEKA 1IBKF 3LPEA 4Y2KA 2R8KA 4JYAF 2DR6A 4LF9F 4YN3B 3HSGA 4PXDA 4WE1A 1NZ8A 3PKYA 1S0NA 1OY6A 3D4JA 4BWJA 4S0MA 1DLOA 1LW2B 1UWBA 3IG1A 1I6JA 3OJSA 4MKAA 3PX0A 4CZCA 5I3QA 3BGRA 3DU5A 4GRSA 4TYAA 4O3OA 3Q8PB 2VOPA 3TNVA 2WVCA 4ED2A 2VQEJ 5RUBA 3C6UA 1WKKA 5CYQB 3ENVA 4LQ3A 5GAHU 4I67A 3OR1A 2M2BA 3LP0A 4C8ZA 1ZOTA 2I6WA 3G6XA 3VHQA 2VH7A 3C66A 3TYTA 1R0AB 2FGCA 4OZLA 3H8YA 3LANA 2XG8A 3CJ0A 2F63A 1JXLA 4QWAA 2G0JA 2IDEA 3N9UC 2DNLA 2BACA 3F44A 4W4MA 2D3UA 3I32A 4U7UD 2LMIA 2YWWA 4WU3A 5D0RA 3KJVB 1CJUB 1F0XA 3AJ2A 2JWNA 3EXYA 1IBLJ 1V3RA 4CLSA 2FHJD 1NJZA 4ZCKA 2XZWA 1BQNB 4R5PB 4F3QA 4PWDB 3B82A 4J91A 1RWPB 3MDFA 1KQSR 2J0QD 5D4NA 2IRYA 3MM5A 3BSAA 4HH0A 3R5AA 3LP0B 5H9FJ 2R42A 1ZA2B 5KOWA 3HFKA 2PMWA 1T94A 2Q1LA 2YTCA 3OFGA 4Y2IA 4ZIWA 2DNMA 2AT1B 1UAWA 3G8QA 1WKJA 2JRSA 3I5CA 4GMKA 3DGPA 3GJRB 1JLFA 2B8PA 5DRKA 2YVSA 3QT6A 4JI0J 3M6VA 2B43A 5KFVA 5F8JA 2HZCA 2NXJA 3D54A 1K1SA 1AXQA 4QIWD 1A0OB 4JV5F 2J6SA 4LVNP 1ZPVA 1NU4A 2MSSA 4C98A 4CO0A 9ATCB 2PO4A 1DFDA 1FJ7A 4QR2A 2VF3A 3NGDA 1NUEA 1ZZNA 3M32B 1FHTA 1NDCA 3FGVA 4H4MA 1JLCB 2HQGA 2J7KA 1PKUA 1E6VB 1UTAA 3CSKA 3RGIA 4P2MA 3GJSB 2CJ9A 3PRVA 4CNYA 1NHKL 2MKKA 3OV7A 1M5KC 5GVQA 2CUYA 1FX4A 2JL9A 1RB0A 1EKSA 4DN9A 5B09A 3MMCB 1RBLA 4RW9A 5DZ7A 4PYDA 5LXRA 4DV4F 3FUYA 1N5SA 4NWBA 1IM4A 1NJWA 5KFKA 2MKYA 2AZ3A 4U7CA 1FDNA 1T3OA 2CQGA 2GAGC 3S8SA 1YJ9S 2LFVA 4YR2A 4ANEA 2CYYA 1IKVA 1K0TA 1QJHA 1VIXA 4Q0BB 5DQGA 3LP2A 4LFAJ 4OX9F 3CCLS 2C2EA 1AFIA 1KP6A 5KG4A 1WC6A 3CCSS 1S9FA 1AT1B 1DQAA 2EK1A 1WSRA 1UEVA 2F65A 3FCVA 4PG8A 4JI5F 5HJYA 3DRRB 4OX8A 4LBPA 2G1DA 1XMQJ 5CAAA 5E41A 3GE9A 3DLGA 1HW8A 4RW6A 3DRSA 5IV3A 4JBCA 2DGQA 2QLWA 5KFJA 3CMQA 1Q95G 1Y10A 5IC6B 3T5HA 4DV1F 4DSIA 1FXRA 1NEEA 2BJ1A 3H7HB 4DG1A 4EYIB 1LK7A 5A6PA 3DLBA 4FKXA 5C42A 3EYZA 3PW4A 4B9UA 2XNRA 1EP4A 3H2VE 2W2OP 3ZZOA 2B4UA 2M4MA 3D1OA 1ZPWX 4C3KA 4RW8B 5E3CA 2OHDA 4ZVSB 2XQCA 3RR8A 2F4VF 3E3XA 2UUAJ 2IPOB 1RT3A 2CJQA 3L7OA 4X84A 2YKNA 2L3MA 1QSLA 5IT9Y 1HLWA 2GJFA 2WB4A 2XMWA 3CCES 4JI2F 2HWTA 5IWAJ 1N48A 1RTDA 4X4TA 1HNXJ 2ZH8A 3RB6A 2Z8QA 3MPVA 4WF9Q 3D5MA 1HL6A 2H65B 2COLA 2G0IA 2HHPA 2E1AA 3C6TA 4Y65A 3HVAA 2W8LA 3HHLD 3VTIA 2E9RX 4QYZK 2GIFA 2DEJA 2XHCA 3BGUA 2BW7A 2OO4A 4MK9A 1IM6A 1B4SA 3HJVA 4UOHA 2LQJA 2RVJA 2XI3A 2XC9A 1GFWB 1PJ7A 1T02A 4DU7A 3CGIA 1FE0A 1P9QC 1JJ4A 3CW2C 4DUZJ 1SQFA 3ILIA 1S9EA 1X0FA 1WC1A 2BJEA 1WF2A 4P2SA 3PR4A 3LGHA 1KONA 3HHLC 1MU2A 1S48A 5F8HA 1SIZA 2AD9A 1RT5B 2V2VA 2WRMA 3FMBA 2H5IB 4FXVA 4O4GB 4P75A 3UO0A 4X4OA 1BWEA 4MT1A 4QIFA 1HBNB 4H4OB 1KFSA 1RWMB 5KFBA 4UQGA 1NJXA 2LU1A 3D0HE 1DRZA 4R8UB 3T1AA 1H0HB 4W98A 4Q45A 1IKYA 2ZBRA 3HJFA 3QGGA 3BB5A 5KG6A 3GYNA 1P6TA 2U1AA 2CADA 2HK3A 3BO4A 4OYXA 1OYDA 1WOSA 5HL7Q 4F36A 1HPZA 3JXOA 2YNIB 4ZVFA 2FHMA 4KGKA 2BKNA 3CDUA 3TW0A 5DDOC 2WTFA 1J27A 3B4DA 2KH9A 3X3UA 4ECYA 4OI4A 1F5BA 3CJSA 1N36J 2LVWA 4M5DA 2D1CA 3A4TA 1R27B 1RWVB 2YKPA 4KYZA 4I7FA 2HEKA 3HF5A 4M5LA 1TL1B 2CDQA 1IQZA 1B0PA 1YI2S 2MHEA 2MTLA 3V6DA 4LFBJ 2GGPB 2HZVA 3POTA 3BREA 2Y1LB 2YKMB 3Q0AA 1QVFR 5B0BA 2AP6A 3IWNC 3AT1B 2IJRA 3EDQB 3UW1A 3GMGA 4LJMA 4J9UE 1ITPA 3I82A 1RP5A 1N54B 1TKXA 5DDPC 1CQNA 1WOOA 3FBBA 4DSLA 2F4VJ 2MQOA 1XMBA 4DEZA 2Z2MA 3MF5A 5AE1A 4K8RA 4DV3J 2LA6A 2IRXA 3GONA 3H4DA 1U1PA 4NXMF 1MN7A 3PO4A 3M8QA 4K4UA 3M2UB 2RJZA 3EZUA 1OMSA 2CPJA 3TX0A 3CC2S 2JOQA 3BQ2A 2PC6A 1HWLA 4P73A 4LF5F 5F9NA 4YR3A 3DKDA 5HQ8A 5H9FK 3L9ZA 1S1VB 2BX6A 4USUA 2BABA 2QA4S 2MQNA 4Q0BA 2YX1A 3GFXA 4LVOP 1VK8A 1BD6A 2VU5A 1BWVA 3M8QB 3BH6B 4K4WA 1LWCA 3IAM9 3KK1B 1UJ6A 1FRKA 1YJRA 1YX2A 3DYAB 3SDEB 1U24A 2QA2A 1QM9A 2AEJA 3IM9A 3L7UA 3MUMP 2ZH5A 4I2QA 1NK4A 2HQFA 1RWOB 3DGVA 3NCRA 2J6UA 1Q53A 2CPZA 1FDDA 2RSQA 3JSRA 2RHSB 2FHOB 3AQPA 2GC8A 3PEJA 4UUXA 3TQEA 2Z2YB 3AD7C 4QWDA 3OUYA 1IKWA 3MR7A 4X66J 3SFUA 1RSCA 4I2PB 4O3NA 3WIUA 2ADBA 2UVRA 2KN4A 1D1UA 2NQPA 1LW0A 4JUZA 2XS5A 3VV2B 1GXLA 1XMOJ 4AXIA 1K8AT 4DFPA 4RW7A 3VGTA 3MEEB 4NLWA 5KFPA 3EDRB 1FEEA 4NASA 4UOCA 3W60A 4DCOB 3EZ5A 1X5PA 2FY1A 1OIAA 3ZTSA 1FXLA 4OYBA 2Y3YA 4LUBA 2B6AB 4NRUA 3OT9A 3M9NB 3BSNA 2ASLA 2P6SA 3PKMA 4RO0A 2KVIA 3KK3B 1HHSA 1S49A 1RT2A 4C97A 3RBDA 1IKYB 1BE4A 1U4BA 5D3GA 4KGVB 4PXCA 2MZJA 5SZTA 4NLVA 2NXNA 2YPYA 1IBLF 2E5JA 1N6QB 2HHQA 3KG0A 3QIPB 5KFLA 4Y2AA 3KK3A 3ILLA 1OPIA 2R4FA 2F40A 2EFGA 1CS4B 2ZVIA 3C16A 4ZPCA 4JI0F 1UVJA 3ITHB 3M05A 1U2FA 2CG8A 1S6QB 5HVHA 3G87A 4DWIA 2J8AA 2E7VA 1RAGB 1DY3A 1Y3KA 2B51A 2W9BB 4F4WA 1HD1A 4Y28C 5GAHI 5T41A 2Y1IA 2AYGA 3QZ8A 1WC0A 5DQHA 2AJFE 2FJXA 2UUBF 2GO8A 2WVFA 1E6YB 1RHMB 3R5GA 4CNZA 1SL2A 3HK2A 2XBPA 2Z56B 3I0RA 4QJVA 2MKCA 1VQLS 3BZQA 3GYGA 3BO3A 1U02A 5DS7A 5LMUF 3KLGA 5GADU 3K8WA 4K4TA 4G3IA 3MPUB 4DF8A 1KVKA 3PFOA 3QGHA 3QO9A 4FF2A 2HG4A 1HW9A 3OVAA 1Q82T 2HHSA 1PYTA 4ZPWR 3SQGA 3T5LA 3KYLA 4DR7J 1NJIT 4X4UA 1KR4A 3H5XA 2B4VA 1C1BB 2V8DA 3T9ZA 2ROPA 4OYPA 3DOMA 4OHVA 4DDFA 3OL6A 1XC9A 2ROEA 4OZ3A 4CM0A 1UVLA 2G4BA 3G4SS 1TL4A 4TLQA
chains in the Genus database with same CATH topology
1X4BA 2R7WA 1KTQA 3WDOA 4UUWA 3NNHA 2GGPA 3R5DA 4ERDA 3VZIA 1HD0A 1SXLA 2KRBA 1EP4B 2LDIA 5C25B 2P5VA 2ZH6A 1VHFA 4J9RA 3O6QA 1UA1A 3OTCA 4V19X 3NGKA 4ECQA 2DGUA 2J9DA 2MQMA 4H54A 4KB7A 3G86A 2RF2B 5KG0A 2ZH4A 1NKEA 4AXJA 3LGNA 4PQAA 4LFAF 1KVIA 1JLAA 3M9MB 1LXNA 5KFXA 1FTCA 4HI2A 4ELUA 3DOKA 4ILRA 3DXBA 3W2VA 1N5QA 4X4SA 3I0RB 4I7FB 2VBWA 4IRDA 1FK9A 5IXUA 1T7PA 2WSFC 4OL8A 2QLXA 4J9LA 2YNIA 3KNAA 1FKPB 1XR5A 3SSSA 3WBZA 1HR0F 5HMZA 2RRBA 2OMLA 4J9MA 3TANA 2A2DA 2BW2A 1N6QA 3TVKA 2ZJRQ 1X4FA 4MYTA 2VPYB 1X5SA 1X8DA 3DOKB 4KJIA 2UUAF 1GNKA 4Y6IA 5EX3A 4CIOA 3HHDA 4Q43A 5HBMA 4B3TF 5GAEU 2MHNA 5G4DA 2UZAA 5G0RB 1TR0A 1BLUA 4X4QA 1O5JA 2KTQA 1RK8A 3HVRA 4DL5A 4DUZF 1V9OA 2VD3A 2Z4PA 2WONA 1FK9B 2I5JA 2E1MC 2CJBA 3CT9A 2MKJA 1MW7A 3D1HA 1FEHA 2NUUG 5HMYA 4Q5VA 3NLCA 2RU3A 1CG2A 2OP5A 4ECSA 4EBDA 3M2VA 3OL7A 3DHXA 2OPRA 4DR7F 4Y0FA 3MM9A 3MM8B 2GIRA 1S6PB 5K8OA 2IC3A 4F4YA 1FJGF 1Y4ZB 3TUJC 1U1QA 4YY3F 1R31A 4N47A 1SJ3P 3W7BA 2M8DB 2KRRA 4ETZA 3GR0A 2MQQA 3V5RA 2X1FA 3IXQA 2OPQA 3JSMB 2BQUA 1CC7A 2RDJA 3TAQA 5BR8F 5C5JA 2E9TA 4N8OA 5BYSA 2WK4A 2IAJA 1R8CA 4CO3A 1RISA 3DXSX 3PIOQ 2DH8A 1AUDA 2DD8S 2C28A 4F2SA 3CE8A 4DQRA 2B0GA 4C0BA 1VBYA 4DL2A 2MKIA 2DNQA 4KHPF 6FDRA 3NAIA 1RTIA 3TX8A 2EK6A 3TAMA 2BE2B 4FF1A 2N82B 4A8OA 4PUOA 4ALZA 1YJNS 2HVIA 1YGYA 2Y1RI 5HROB 3NCQA 2XSJB 3MM9B 3UNGC 5DGAA 1JXEA 1S72S 2AV5A 4EZ6A 1W25A 4N77A 2GX8A 1B0TA 3CUNA 1TK5A 3K5MA 2B5JA 3AQOA 3D1QA 3O2IA 2R7QA 3MM6B 1TL1A 5KG1A 4KO0B 2GHVC 2DNGA 4ICLA 3W2WA 2ZD1A 2ZBCA 1KFDA 2OPQB 3N6NA 2JLEA 3TP2A 5KG2A 1S6QA 2DGWA 1TK0A 5CYMA 4A8XA 2DO0A 1NH7A 5KFOA 2DR7A 4BS2A 5EUHA 1YHQS 1WF0A 3IGVA 2PSZA 5GAGI 3DU6A 3QLHA 1CSJA 1YIJS 2V0NA 4TY9A 1VQ4S 1PSDA 1SL0A 3OHAA 2M5YA 2XSJA 2V4RA 2ZNZA 3C46A 4WK1A 3M1VB 2NREA 4DN0A 1ZAXA 1SJ1A 3I31A 2BQ3A 1XNRF 1SJ4P 4XDDA 1TL3B 2FVPA 3TAMB 4O4RA 2FVSA 4TY8A 5K14A 1XMOF 3KHLA 4NZ0A 1BY9A 2X1GA 3MECA 4KO0A 5KFRA 5FJ4A 4JI8F 2FJWA 2GV1A 4CO5A 3BS9A 2BRKA 3I4PA 4BDPA 3MUTP 3TA0A 4WFBQ 2UUTA 2VBYA 1R8HA 1GXTA 1XR6A 2GIQA 3KLEB 4UY85 3J7Z5 3N4WA 4YDDB 3VZHA 1KC8T 5IS2A 4GC7A 1S6PA 3ISZA 3D28A 2A1BA 1X5OA 1XTZA 2NSBA 5DETA 1TFYA 4ED1A 2XY7A 4C8KA 2CJAA 3GV5B 3CO9A 5LJ5Y 2W8KA 5AXNA 2PE8A 1WHWA 2YNGB 3Q22A 4DSFA 4QCLA 3M8RA 4M1KA 2ZNYA 2NR0A 3OXFA 3U1NA 1ZTWA 2PI4A 4OI6A 2IJFA 3CJKA 3G6YA 4OZ5A 4F26A 3V81A 4LF8F 1EETB 3E01B 1CQMA 1F9FA 1S7HA 3US5A 1QUPA 3ZZZA 2LYVA 3FZ2A 1M1KT 4TKTA 1TQLA 2X3GA 2XY6A 3EGWB 3MR6A 1J5OA 3FSXA 2AW0A 2FGOA 3IG1B 4C8NA 3SV3A 3SYZA 4N56A 1DTQA 1SH0A 4X4NA 2KB2A 2D41A 4FF4A 4LSLB 2ZOMA 4NRTA 4YB6A 4CI0B 4ZKAA 3MM7B 1HBUA 1X5TA 3DLKB 1WEZA 5B7WA 4MH8A 2KXNB 4J9SA 3OTOF 4CH7A 2QO3A 4DV6F 2V2KA 2KHCA 5LT5A 2CVEA 2M8HA 3LWLA 3JYTA 1RT1A 3THTA 1R6YA 2YH1A 2WW8A 2DISA 4G1IA 5KG7A 3CMES 2ZKTA 4WYLA 1T8EA 2GNKA 2YKOA 3NBPB 1HWJA 3MPYA 4OHYA 4KHRA 2ZM6F 3MGJA 2R7RA 1CVJA 4MK7A 4CCHA 4FVMA 2B9XA 2M7SA 4OI1A 3HMJG 1YRTA 1FRIA 1YJUA 2CPFA 3ISNC 4WJBA 3NMRA 4X62F 1H6KX 4HT7A 3FEXB 5DLFA 3M1VA 1JJHA 4NYPA 4F4XA 1KHWA 2FHKA 1T05B 3H40A 2AGPA 4A8KA 3TVZA 1J5OB 2R7SA 3PRDA 4QR1A 3RRHA 3MFHA 5M2PA 1WHXA 2O3DA 3LQVA 2DR8A 5M2RA 2V4JA 3RAMA 1MWYA 4GKJF 4RNFA 3TOQA 3TRGA 4XO0A 1S1TB 3GYXB 3MR3A 4PXEA 4GO5X 3KKFA 4HDGA 2XSFA 2KYXA 3TO8A 2BANB 4Q7AA 4IR1A 2M0GB 2HQ3A 3CCVS 2BANA 3G6VA 5J2NB 3FQKA 2JFDA 4EEYA 3U7JA 3DRPA 4LT6A 2EBGA 5J1EA 2VG6A 5K8PA 2XY5A 4RW6B 1HWKA 2ZUGA 3LW5C 3BSOA 2ZOGA 1U25A 2P9EA 3M9OB 3SDEA 2DNYA 4OHZA 3TR5A 1V6HA 5I3UB 1L3UA 4GKKF 3NCPA 5AXLA 4F67A 4YMEA 3V6HA 5J2NA 3DI6B 1X9MA 3I0SB 2L9WA 4WZMA 3R27A 1FTRA 1VOMA 2E44A 2KT5A 1NRKA 1HNVB 1E6VA 4GO7X 1LOUA 5HP1A 2BM0A 2R7XA 4YQWA 4I4BA 1ZYQA 2B3TB 2PA3A 3OBIA 3FEZA 5GAEI 4ZP8A 2J9CA 3R1LA 1RJJA 2DNKA 2MPUA 2OSRA 3S6EA 4B3OA 1KNZA 1TAQA 2XGQA 3MD1A 2R7UA 3RB4A 1Q81T 3KMSA 1SB6A 3O8WA 2HHUA 2ADCA 3MMBB 2GW8A 3Q23A 1JLFB 1U47A 1WG4A 3ZC4A 3FDSA 2ASJA 5FDLB 1OWXA 3GSDA 4B3OB 3B8HA 4QU6A 3ZZYA 2GMLA 4M5DB 2DK2A 3MOZA 4YUDA 3UD3P 1RT6B 4TN2A 3CD5A 1TKDA 4C3LA 3H20A 3LGMA 3P96A 2FJDB 4DR6F 1FE4A 4ZMMA 5EDWA 4EBEA 2F8EX 3OFHA 5KFIA 3RB0A 1U6BA 3M6XA 5J1PA 3OVSA 3I9V9 3BSCA 2P9CA 4OHXA 3T5KA 2VG7B 2IYGA 2W9CA 2GHWA 1LWEA 2W4CA 3UDCA 3I55S 2CPHA 3GFYA 4CT8A 4P6QA 1RT5A 2CPDA 1NO8A 4QZVB 4K5RA 3OFEA 4D3HA 5IQQA 3DYAA 1GX5A 1RTJB 3RRKA 3ISND 5CCLA 1BQMA 4GC6A 5DGBA 2Q6BA 5D4LA 1DZ5A 1D9FA 1CLFA 3M4XA 4MTPA 5LSRA 1QSYA 1H2VZ 4OJ3A 3MAQA 1XERA 3P6YC 2X51A 3V6DB 2W7OA 2HQIA 4F50A 5K9FA 3GILA 3K7RA 3GV7B 2E5IA 2DT9A 1VQSA 1NB7A 5LXYA 5ADZA 4ID5B 3UPFA 3K59A 1UVIA 3U1LA 4EWTA 1UP1A 2RB7A 5KFNA 2V4JB 2R2TA 3DRSB 1QE1B 3S1TA 1HNIB 1VRUB 4ID5A 1WELA 4ZPDA 4AYBD 4ZHRB 5KFHA 3NG8A 5GMKa 4LF4F 4BCAA 1L5UA 5A6WA 3CD0A 3J81Y 4DR3F 1R89A 4DL4A 3WC2A 4DR5F 1FXDA 4O3RA 5JVGQ 1BQXA 4KRWA 2EPIA 3VQSA 1UVNA 5B0DA 1XR7A 3IBWA 5E3QA 2AX1A 5L1KA 3UR0A 4NPOA 1IJEB 3ZFVA 3IN5A 1S79A 2ALZA 1X4GA 1VRTA 2MJNA 5KFCA 4NLTA 5LL6d 1JLQB 4IRCA 1KTVA 1KLMB 3L3CA 4O3SA 3KOAA 4IFVA 5KFTA 4ED7A 4LFBF 4QPXA 4A8MP 1FNMA 4KC5A 4IOAQ 3CCRS 4WKYA 2HW3A 1RT1B 2LXIA 3GFZA 2RF2A 4NA1A 4AL5A 3IR7B 2UU9F 2W7PA 4M8LA 2YKQA 3KG1A 4RBUA 3K5LA 3MR5A 1MNEA 1KOHA 3Q2TC 4MK8A 1LFPA 1NJYA 4Q8EA 1WHYA 1HBOA 1RA7A 2YKNB 3AB2B 5KT7A 2BRLA 3OHBA 3D0GE 3KLVA 2EFPA 2RQCA 2RKIB 4MAKA 5A8WB 5E2QA 3TUZC 1Y5IB 3MMBA 3CC4S 4K0KF 1S99A 4WXWA 1SJRA 4ZK7M 5D3GB 3CDEA 4URGA 4RNNA 2HLUA 5B0EA 1H98A 2PIIA 1UVKA 4OZ0A 1ZBTA 2CPXA 1KOOA 2GO9A 1EETA 2VPXB 3E01A 3PW7A 5IT4A 2IVYA 2VG6B 3T1HF 2HGLA 1M5HA 2E9ZA 2Q66A 2I1RA 3OR2A 5KT6A 2HRUA 3N28A 1RT3B 1IUJA 2H5EA 4G1QA 3OLAA 5CCMA 1A7GE 3MPWA 2MGZA 1TZ0A 5KTQA 3A8EA 2KJVA 5C42B 1FRMA 1Y5NB 3HDSA 5KT5A 2VFVA 3BDEA 1LFWA 3FFIA 4OZ1A 4WYWA 3SXLA 4EO8A 5F3ZA 1UEUA 3J80Y 2FJXA 4AFFA 2C22A 1P1TA 3PR5B 5SUHA 2DGXA 1FKAF 3C3LA 3HVTA 3HXMA 2VZ9A 2RH3A 4ZPVR 2MQLA 3DRPB 2R9LA 1O0PA 1OO0B 1PGZA 1QLNA 3LO3A 2HWHA 2YQ3A 4PG4A 4E8UA 3DRRA 4XIUA 2LXFA 4FN5A 1NK5A 2AX0A 1Q4RA 2YX4A 2ZJQQ 3DRXA 3QYYA 4Z2XA 1NK0A 1UVMA 3MXHP 4L3NA 3FNNA 4R0JA 2DH9A 4WF9Q 3OJUA 4N41A 2CJKA 3IR5B 2D7SA 3CF5Q 1JLCA 2ZFHA 4AL6A 1REVB 2I2YA 4DPOA 2OFGX 2KFNA 2HHXA 2SXLA 3WZ0A 1WG5A 2CQ2A 2HAIA 3SV4A 3I4HX 1XN9A 1QAIA 1SIWB 4IH7A 3S7RA 4OLPA 2RIJA 5HBMB 1NKBA 3CDBA 1UJ5A 4IG3A 2ZZMA 2AGOA 1YSJA 1P27B 1WHVA 3FMWA 3M8PA 2UXCF 3HHEA 3IC1A 3GWCA 4IG3B 2HNYA 2B7BB 3OXGA 2YWGA 1C4AA 2N4DA 1U49A 1K73T 4RBTA 2EVZA 2I5JB 5BYQA 3CXCR 2ATLA 4MKYA 4I64A 4KAIA 4DFMA 1JJ2R 2WSEC 4XK8C 4DFJA 4ECZA 2W9AA 4JV1A 5CZXA 3MTKA 1FRHA 3RU0A 1HI8A 3QJJA 2HVZA 1VMBA 2L41A 2XCAA 1JLBB 3B4MA 2HHHF 4TU7A 5IZHA 3DDNA 4FXDA 3NBPA 4QOTA 2K2PA 2DRBA 2LEAA 1VC0A 2DVIA 2QRRA 3DI6A 3E51A 1JLAB 5DG7A 3VAMA 1JLQA 5CYJA 3RZAA 1TKZA 5F0WA 3I5BA 3ZZRA 3EPGA 3VAKA 1FF2A 1FKPA 2QIFA 1ZM9A 1TL5A 3EX7B 2BE2A 3IWLA 4MFBA 5T7LB 1OPZA 1N5YA 2B4PA 1VIOA 3PX4A 2JFKA 1U6FA 2J9DE 3BGFA 2IA6A 3M30A 2NLWA 5EGYA 2ZHBA 4DMZA 1URRA 3H5SA 3PDNA 4XPCA 1JLEA 2VQEF 4WE1B 1YTYA 2DO4A 2DHAA 4ECVA 2E1CA 5AE2A 1GQEA 1MMNA 1JLEB 3P49B 5CA5A 1NHUA 5KFFA 1UJ4A 1WI6A 2RDIA 4EO6A 5CYQA 4ETXA 1HQUA 3PW2A 2FLLA 2N7CA 3GIKA 5L9XA 3V81B 3LF0A 4FF3A 3AY0A 1ZAWA 3BEGB 1RGVA 3K2YA 4NA3A 5J2PA 2XLJA 2XMKA 2BXJA 1SUQB 2G9OA 3NAHA 5KFUA 1QAJA 2MQPA 2IMOA 4G1PA 1IBMF 1SC6A 1JKHA 2M88A 2VG5A 5CH7B 2KZMA 4E98A 4DUYF 4ZVEA 3K5PA 5AE3A 1VFJA 2RS8A 5J2MB 5KFQA 3PXGa 3J7YI 3X1LB 4IFYB 1S9EB 5DM7Q 1S4FA 2MZTA 1VQ6S 3HT3A 4MIBA 4B9MA 4E0DA 4ECRA 2HHTA 1T03B 1U7LA 3KG4A 3ONQA 5B0GA 2CKWA 1ZZFA 5F8LA 5CD4H 2MY7A 4JV2A 2XB2D 1FJEB 1U1MA 1L3TA 4C0HA 2OPSB 4X66F 4DSJA 3HZEA 3MECB 3TAPA 4JI3F 3SCIE 4TU9A 1RI7A 1U45A 2YWKA 1S0OA 1M90T 3R5BA 4HDHA 3ZZUA 4OI2A 2E5GA 4UQTA 5HI7A 4ED8A 3DFEA 3L95X 1FT8A 4RUCA 2GMJA 1NAQA 2K1RB 4QIGA 2ZZNA 4KQZA 5D4OA 4C2MA 4NXNF 1O51A 3AA9A 2E5LF 3PJWA 4K2XA 3PJXA 1XWLA 3LPYA 4LSNA 3FQLA 2BJDA 4PPDA 2KHDA 2RRAA 5BJRA 2VASA 4PUOB 3KHGA 1Q7YT 1JB0C 5D78A 3J7ZT 3UFCX 4ECUA 1VLYA 3Q24A 3C2PA 2KU7A 4C11A 1K9MT 5KFYA 3DLEB 2VA3A 4HTJA 2YNGA 4KSEB 1N5VA 3MM6A 4NYOA 4I6YA 4IH5A 4Y00A 5A0YB 3CCMS 3BO2A 5E3RA 3Q8RB 3CIMA 4IDKB 1S76D 3CWJA 3SZ2A 2DGOA 3KLFB 1LWFB 5HN0A 3M8SA 4URQU 2DRAA 2OKQA