2MDGA

Solution nmr structure of zinc finger protein 423 from homo sapiens, northeast structural genomics consortium (nesg) target hr7298f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 423
publication title Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mdgA00
2LO3A 2EN3A 1A1FA 2EMZA 1ZAAC 1A1KA 1A1IA 2WBSA 2EL4A 2WCC3 2ENHA 2YTEA 4IS1C 1JK2A 2EOJA 2ELYA 2YU5A 2EQ0A 2EMIA 2EPXA 2EM2A 2EMHA 2DMIA 2DLKA 1A1JA 2EOHA 2EOSA 4R2AA 2EOQA 3EPLA 2EMLA 1TN9A 2A25A 2EN8A 4R2QA 2EM3A 4M9VC 2EMYA 2YRKA 2YU8A 1RMDA 2EJ4A 3EPJA 1Z1BA 4R2CA 1G2DC 2MKDA 2RPCA 2YTFA 1BB8A 2EL5A 4R2RA 3UK3C 2VRDA 1WJPA 2ENCA 1JK1A 2YSOA 2YSPA 1ZU1A 2ELZA 2EQ3A 2YTPA 3EPKA 1X6EA 2YTDA 1YUIA 1B69A 2I13A 2EMXA 1G2FC 1P47A 1F2IG 2EM0A 1X6FA 1A1HA 2E72A 4F2JC 3EPHA 2EOZA 2EPRA 4F6MA 2LVHA 2LCEA 2EPAA 2EPZA 2EMAA 2M9AA 2YRMA 2CSHA 2EMGA 2NABA 3M99B 2MKNA 2YTOA 2CT1A 3MHSC 2EM8A 4GZNC 1UN6B 2DLQA 4R2PA 1NCSA 2EMBA 2RSIA 5KL6A 2J7JA 2DRPA 5KL3A 1TF3A 1A1LA 2JPAA 2EOEA 2EPPA 1X3CA 2LT7A 2MDGA 4FK5C 2EPCA 5KL5A 1ZR9A 2EM5A 4R2DA 2YTJA 4WSGA 5KL4A 1YUJA 4IJDA 2D9HA 2EE8A 1MEYC 2ENAA 2EOIA 2EN7A 3MHHC 4X9JA 4F6NA 1DGCA 2EP3A 2JP9A 5KL7A 2LV2A 2EL6A 3VHTB 2EM7A 2EORA 2HGHA 2EM4A 2CTDA 2ADRA 2EOMA 1TF6A 2EOXA 2EQ1A 1BBOA 2YTNA 2BB8A 2YRHA 2WBUA 4R2EA 2EOOA 2EPUA 2EM9A 2YTGA 4R2SA 2EMCA 1AAYA 2EMFA 2EN4A 2EMKA 1UBDC 1KJKA 1YSAC 2EN2A 2EN1A 2DGCA 1X6HA 2PRTA 2R1FA 2EN6A 1X5WA 2YTIA 2EMWA 2GHFA 2EOYA 2GLIA 2WBTA 2EM6A 2EOFA 1LLMC 5KL2A 1A1GA 2YTQA
chains in the Genus database with same CATH superfamily
2EN3A 2V83A 4TUGA 2EMZA 5AE3A 1A1KA 4NHRA 4B3ME 1IBKE 4NXNE 3MSWA 5AASA 4DV2E 1JK2A 2LJHA 2YT4A 2VE7C 4KWYA 2EPXA 2EM2A 1A1JA 1TN9A 2EOSA 4R2AA 4R2QA 1YZ9A 2JY9A 4M9VC 2YU8A 3EQ1A 1RMDA 1J26A 1Z1BA 4DV7E 2RPCA 3UK3C 2UXBE 2VRDA 4F9BB 1ZU1A 2L2NA 2L33A 2YTPA 4WXCA 2YTDA 1YUIA 4R03A 3BGHA 4DV1E 1P47A 5A6JA 3IWDA 2FV4B 4DR1E 1XMQE 2E72A 1BBGA 2EOZA 2LE2A 4DR3E 4WX9A 3AUZA 2JOBA 2EMGA 2UUBE 2NABA 5AC4A 4DUZE 2VQEE 2JVAA 4R2PA 1WRJA 3DJWA 1YYOA 1A1LA 4NZVA 4OX9E 4X65E 2LT7A 1RQ0A 1ZR9A 4GKKE 4LFBE 2YTJA 4BMJA 4J8ZA 1YUJA 2LMZA 3C6KA 2ENAA 2KOUA 2ODRD 1NEIA 1WXRA 2LV2A 3VHTB 2HGHA 2ADRA 2RTXA 2NUEA 2UXDE 2K7IA 2JWOA 4KZSA 2YTNA 2YRHA 1T4OA 4DMIA 2EPUA 3KZZA 1AAYA 2EMKA 1T39A 1UBDC 2E5LE 2UUCE 5LMUE 1I94E 2B7VA 2R1FA 4BCAA 4M2ZA 2UXCE 1FKAE 2GHFA 2EOYA 2GLIA 1HNWE 1LLMC 2EPMX 1A1GA 4LF8E 2GPIA 1A1IA 2EL4A 2WCC3 4WXDA 2ENHA 2EPKX 3JTZA 4RH8A 2KONA 4DV6E 4IS1C 1ZBQA 2ELYA 5A6BD 2EMIA 4BC9A 1IQOA 2RSMA 2MDRA 2EOHA 2LTRA 3EPLA 2EMLA 1GTKA 4JI4E 2EMYA 3IWCA 5DNYA 2YPNA 4N4RB 2G7HA 4WYQB 2L2MA 3AV0A 1T38A 3T1HE 4DR6E 3L00A 1WJPA 2R76A 2ELZA 1QU6A 2B7TA 4LFAE 4JI6E 1KYQA 1B69A 4TUIA 2LRSA 2I13A 1HR0E 3H09A 2V86A 1EH6A 3ZOQB 2EZ6A 4GKJE 2L92A 4F2JC 3EPHA 2EPRA 3ADLA 4P78A 2V8QB 4I8OA 2EMAA 2NA2A 2CSHA 2MKNA 3ECRA 4GZNC 2N8XA 2DLQA 5T6JA 2EPOA 4DV3E 4HEIA 4BHBA 1XNQE 4JI2E 2J7JA 5KL3A 1TF3A 2DIXA 1L4SA 3HXLA 5ADZA 1HNXE 4WPYA 2MDGA 2B3TB 3KWRA 4LTYA 4R2DA 4ZYHA 3LLHA 4IJDA 2EOIA 2JP9A 4F6NA 2EP3A 1UHZA 3F6HA 2JR1A 2JOXA 2DMYA 1DI2A 2EL6A 2EWLA 2EORA 2L8TA 4DR2E 2EQ1A 5A6KA 2L3JA 3RMPA 2WBUA 2BB8A 2EOOA 2EPLX 1YYWA 2YTGA 3BIDA 4O5GA 4MLVA 2RS7A 2EN4A 3VYYA 3J81C 3THOB 4AQYE 4GEQB 1YSAC 2EN1A 1X6HA 4LF6E 2EMWA 2WBTA 4BHCA 2Q8UA 3BF2A 2YTQA 1ZAAC 2YTEA 4LU9A 4JI1E 2EOJA 2FGGA 2YU5A 2EQ0A 4K0KE 2MC6A 5AE1A 2EMHA 2DMIA 2KHXA 2N3GA 2DLKA 2EOQA 3C6MA 2YWQA 2A25A 3VYXA 2MC5A 2EM3A 4F54A 4B3TE 1DQ3A 2FTXB 4LF9E 4R2CA 2M4IA 2YTFA 1ZBTA 4R2RA 3K6QA 4X66E 1XNRE 4ZYDA 2EQ3A 4M30A 4BS9A 1IBLE 4OOGC 2H36X 2LJUA 2EMXA 3ADIA 4BBYA 1F2IG 2EM0A 2F8BA 1A1HA 4DR7E 4F6MA 2LVHA 2LCEA 2EPZA 1IQSA 5A69A 2YRMA 2NUGA 1X48A 3IWBA 2BBGA 1UILA 2DB2A 3FIGA 1O0WA 2CT1A 4LF7E 5AE2A 4DV4E 2EMBA 3J80C 5KL6A 4JI0E 1N33E 1STUA 2K4VA 4L8NA 1PJSA 1IBME 2JPAA 2M7QA 1FJGE 1PJQA 3HQ1A 1XMOE 4O43A 2EM5A 2L6MA 5KL4A 2HJJA 2D9HA 2EE8A 3JU0A 3TQMA 3MHHC 2ODRC 2VF1A 1J5EE 4NXME 1X47A 5KL7A 4MLQA 4X64E 2L3CA 2LTSA 4WFTA 2EOMA 4DV5E 2EOXA 1TF6A 4HTGA 1BBOA 4JYAE 2DSYA 4R2EA 4DKKA 3HTXA 4DUYE 3C4BA 4P7DA 3HPZA 4F9CB 3JAMC 1KJKA 2EN2A 2DGCA 1QNTA 2RQLA 1RC7A 2PRTA 4JI5E 4LF4E 2YTIA 1EH8A 1AH5A 5FLXC 2EM6A 4X8WA 4ZYGA 5KL2A 2NUFA 4L5NC 3BBGA 2LO3A 1A1FA 2WBSA 2JXPA 2HHHE 2M1SA 3DF6A 3QG5C 5LL6R 4DV0E 1PDAA 4ZYEA 2EPNA 1EKZA 3KZYA 2JYAA 5BR8E 4F9AB 2EN8A 3OMLA 3ADJA 4WSPA 2YRKA 2E1MA 2YZTA 4B3RE 2V89A 2EJ4A 1G2DC 3EPJA 5A6BA 1SR9A 5TSEA 3OTOE 3THNA 4KHPE 2MKDA 1BB8A 2EL5A 3J7AG 1IMUA 2ENCA 1JK1A 2YSOA 2YSPA 4LF5E 4BC7A 3EPKA 1GZ6A 1N3GA 1X6EA 5LLQA 1G2FC 1WHQA 4YY3E 2B9DA 4YHHE 2L2KB 4LFCE 4Q28A 1X6FA 4M0VA 2V88A 4B3SE 1YYKA 3J7Yp 2EPAA 2RS6A 1HNZE 4X62E 2ZM6E 1N32E 2LBSB 2M9AA 1GQEA 4R8OA 2UUAE 3M99B 4DR5E 5IWAE 2YTOA 3MHSC 2EM8A 4Q35B 4O24A 1UN6B 2V85A 4JV5E 2CPNA 2VQFE 3VK6A 1NCSA 2RSIA 3T1YE 2DRPA 4O4KA 3ADGA 2EOEA 4JI8E 2EPPA 1X3CA 2V87A 2LUQA 4FK5C 2EPCA 1PKPA 5KL5A 2LUPB 2N3HA 2HC5A 1PJTA 4WSGA 1X49A 1MGTA 1MEYC 2EN7A 1DGCA 4X9JA 4JI3E 2I9IA 5IV8B 2EM7A 2EM4A 2CTDA 2WZOA 2IHR1 5LMNE 1N34E 3C4TA 5A2QC 1T4LB 4JI7E 3P1XA 3HPSA 1EH7A 2EM9A 4R2SA 5A6AA 4DR4E 2EMCA 2EMFA 5IT9C 2F4VE 1WHNA 2UU9E 1SFEA 5IXMB 3LMLA 3F6GA 5AC5A 5F3WA 1T4NA 1X5WA 2EN6A 1N36E 5CFFE 1YPNA 2EOFA 1YFHA 4RHBB
chains in the Genus database with same CATH topology
2LO3A 2EN3A 1A1FA 2EMZA 1ZAAC 1A1KA 1A1IA 2WBSA 2EL4A 2WCC3 2ENHA 2YTEA 4IS1C 1JK2A 2EOJA 2ELYA 2YU5A 2EQ0A 2EMIA 2EPXA 2EM2A 2EMHA 2DMIA 2DLKA 1A1JA 2EOHA 2EOSA 4R2AA 2EOQA 3EPLA 2EMLA 1TN9A 2A25A 2EN8A 4R2QA 2EM3A 4M9VC 2EMYA 2YRKA 2YU8A 1RMDA 2EJ4A 3EPJA 1Z1BA 4R2CA 1G2DC 2MKDA 2RPCA 2YTFA 1BB8A 2EL5A 4R2RA 3UK3C 2VRDA 1WJPA 2ENCA 1JK1A 2YSOA 2YSPA 1ZU1A 2ELZA 2EQ3A 2YTPA 3EPKA 1X6EA 2YTDA 1YUIA 1B69A 2I13A 2EMXA 1G2FC 1P47A 1F2IG 2EM0A 1X6FA 1A1HA 2E72A 4F2JC 3EPHA 2EOZA 2EPRA 4F6MA 2LVHA 2LCEA 2EPAA 2EPZA 2EMAA 2M9AA 2YRMA 2CSHA 2EMGA 2NABA 3M99B 2MKNA 2YTOA 2CT1A 3MHSC 2EM8A 4GZNC 1UN6B 2DLQA 4R2PA 1NCSA 2EMBA 2RSIA 5KL6A 2J7JA 2DRPA 5KL3A 1TF3A 1A1LA 2JPAA 2EOEA 2EPPA 1X3CA 2LT7A 2MDGA 4FK5C 2EPCA 5KL5A 1ZR9A 2EM5A 4R2DA 2YTJA 4WSGA 5KL4A 1YUJA 4IJDA 2D9HA 2EE8A 1MEYC 2ENAA 2EOIA 2EN7A 3MHHC 4X9JA 4F6NA 1DGCA 2EP3A 2JP9A 5KL7A 2LV2A 2EL6A 3VHTB 2EM7A 2EORA 2HGHA 2EM4A 2CTDA 2ADRA 2EOMA 1TF6A 2EOXA 2EQ1A 1BBOA 2YTNA 2BB8A 2YRHA 2WBUA 4R2EA 2EOOA 2EPUA 2EM9A 2YTGA 4R2SA 2EMCA 1AAYA 2EMFA 2EN4A 2EMKA 1UBDC 1KJKA 1YSAC 2EN2A 2EN1A 2DGCA 1X6HA 2PRTA 2R1FA 2EN6A 1X5WA 2YTIA 2EMWA 2GHFA 2EOYA 2GLIA 2WBTA 2EM6A 2EOFA 1LLMC 5KL2A 1A1GA 2YTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO3 A;  2EN3 A;  1A1F A;  2EMZ A;  1ZAA C;  1A1K A;  1A1I A;  2WBS A;  2EL4 A;  2WCC 3;  2ENH A;  2YTE A;  4IS1 C;  1JK2 A;  2EOJ A;  2ELY A;  2YU5 A;  2EQ0 A;  2EMI A;  2EPX A;  2EM2 A;  2EMH A;  2DMI A;  2DLK A;  1A1J A;  2EOH A;  2EOS A;  4R2A A;  2EOQ A;  3EPL A;  2EML A;  1TN9 A;  2A25 A;  2EN8 A;  4R2Q A;  2EM3 A;  4M9V C;  2EMY A;  2YRK A;  2YU8 A;  1RMD A;  2EJ4 A;  3EPJ A;  1Z1B A;  4R2C A;  1G2D C;  2MKD A;  2RPC A;  2YTF A;  1BB8 A;  2EL5 A;  4R2R A;  3UK3 C;  2VRD A;  1WJP A;  2ENC A;  1JK1 A;  2YSO A;  2YSP A;  1ZU1 A;  2ELZ A;  2EQ3 A;  2YTP A;  3EPK A;  1X6E A;  2YTD A;  1YUI A;  1B69 A;  2I13 A;  2EMX A;  1G2F C;  1P47 A;  1F2I G;  2EM0 A;  1X6F A;  1A1H A;  2E72 A;  4F2J C;  3EPH A;  2EOZ A;  2EPR A;  4F6M A;  2LVH A;  2LCE A;  2EPA A;  2EPZ A;  2EMA A;  2M9A A;  2YRM A;  2CSH A;  2EMG A;  2NAB A;  3M99 B;  2MKN A;  2YTO A;  2CT1 A;  3MHS C;  2EM8 A;  4GZN C;  1UN6 B;  2DLQ A;  4R2P A;  1NCS A;  2EMB A;  2RSI A;  5KL6 A;  2J7J A;  2DRP A;  5KL3 A;  1TF3 A;  1A1L A;  2JPA A;  2EOE A;  2EPP A;  1X3C A;  2LT7 A;  2MDG A;  4FK5 C;  2EPC A;  5KL5 A;  1ZR9 A;  2EM5 A;  4R2D A;  2YTJ A;  4WSG A;  5KL4 A;  1YUJ A;  4IJD A;  2D9H A;  2EE8 A;  1MEY C;  2ENA A;  2EOI A;  2EN7 A;  3MHH C;  4X9J A;  4F6N A;  1DGC A;  2EP3 A;  2JP9 A;  5KL7 A;  2LV2 A;  2EL6 A;  3VHT B;  2EM7 A;  2EOR A;  2HGH A;  2EM4 A;  2CTD A;  2ADR A;  2EOM A;  1TF6 A;  2EOX A;  2EQ1 A;  1BBO A;  2YTN A;  2BB8 A;  2YRH A;  2WBU A;  4R2E A;  2EOO A;  2EPU A;  2EM9 A;  2YTG A;  4R2S A;  2EMC A;  1AAY A;  2EMF A;  2EN4 A;  2EMK A;  1UBD C;  1KJK A;  1YSA C;  2EN2 A;  2EN1 A;  2DGC A;  1X6H A;  2PRT A;  2R1F A;  2EN6 A;  1X5W A;  2YTI A;  2EMW A;  2GHF A;  2EOY A;  2GLI A;  2WBT A;  2EM6 A;  2EOF A;  1LLM C;  5KL2 A;  1A1G A;  2YTQ A; 
#chains in the Genus database with same CATH topology
 2EN3 A;  2V83 A;  4TUG A;  2EMZ A;  5AE3 A;  1A1K A;  4NHR A;  4B3M E;  1IBK E;  4NXN E;  3MSW A;  5AAS A;  4DV2 E;  1JK2 A;  2LJH A;  2YT4 A;  2VE7 C;  4KWY A;  2EPX A;  2EM2 A;  1A1J A;  1TN9 A;  2EOS A;  4R2A A;  4R2Q A;  1YZ9 A;  2JY9 A;  4M9V C;  2YU8 A;  3EQ1 A;  1RMD A;  1J26 A;  1Z1B A;  4DV7 E;  2RPC A;  3UK3 C;  2UXB E;  2VRD A;  4F9B B;  1ZU1 A;  2L2N A;  2L33 A;  2YTP A;  4WXC A;  2YTD A;  1YUI A;  4R03 A;  3BGH A;  4DV1 E;  1P47 A;  5A6J A;  3IWD A;  2FV4 B;  4DR1 E;  1XMQ E;  2E72 A;  1BBG A;  2EOZ A;  2LE2 A;  4DR3 E;  4WX9 A;  3AUZ A;  2JOB A;  2EMG A;  2UUB E;  2NAB A;  5AC4 A;  4DUZ E;  2VQE E;  2JVA A;  4R2P A;  1WRJ A;  3DJW A;  1YYO A;  1A1L A;  4NZV A;  4OX9 E;  4X65 E;  2LT7 A;  1RQ0 A;  1ZR9 A;  4GKK E;  4LFB E;  2YTJ A;  4BMJ A;  4J8Z A;  1YUJ A;  2LMZ A;  3C6K A;  2ENA A;  2KOU A;  2ODR D;  1NEI A;  1WXR A;  2LV2 A;  3VHT B;  2HGH A;  2ADR A;  2RTX A;  2NUE A;  2UXD E;  2K7I A;  2JWO A;  4KZS A;  2YTN A;  2YRH A;  1T4O A;  4DMI A;  2EPU A;  3KZZ A;  1AAY A;  2EMK A;  1T39 A;  1UBD C;  2E5L E;  2UUC E;  5LMU E;  1I94 E;  2B7V A;  2R1F A;  4BCA A;  4M2Z A;  2UXC E;  1FKA E;  2GHF A;  2EOY A;  2GLI A;  1HNW E;  1LLM C;  2EPM X;  1A1G A;  4LF8 E;  2GPI A;  1A1I A;  2EL4 A;  2WCC 3;  4WXD A;  2ENH A;  2EPK X;  3JTZ A;  4RH8 A;  2KON A;  4DV6 E;  4IS1 C;  1ZBQ A;  2ELY A;  5A6B D;  2EMI A;  4BC9 A;  1IQO A;  2RSM A;  2MDR A;  2EOH A;  2LTR A;  3EPL A;  2EML A;  1GTK A;  4JI4 E;  2EMY A;  3IWC A;  5DNY A;  2YPN A;  4N4R B;  2G7H A;  4WYQ B;  2L2M A;  3AV0 A;  1T38 A;  3T1H E;  4DR6 E;  3L00 A;  1WJP A;  2R76 A;  2ELZ A;  1QU6 A;  2B7T A;  4LFA E;  4JI6 E;  1KYQ A;  1B69 A;  4TUI A;  2LRS A;  2I13 A;  1HR0 E;  3H09 A;  2V86 A;  1EH6 A;  3ZOQ B;  2EZ6 A;  4GKJ E;  2L92 A;  4F2J C;  3EPH A;  2EPR A;  3ADL A;  4P78 A;  2V8Q B;  4I8O A;  2EMA A;  2NA2 A;  2CSH A;  2MKN A;  3ECR A;  4GZN C;  2N8X A;  2DLQ A;  5T6J A;  2EPO A;  4DV3 E;  4HEI A;  4BHB A;  1XNQ E;  4JI2 E;  2J7J A;  5KL3 A;  1TF3 A;  2DIX A;  1L4S A;  3HXL A;  5ADZ A;  1HNX E;  4WPY A;  2MDG A;  2B3T B;  3KWR A;  4LTY A;  4R2D A;  4ZYH A;  3LLH A;  4IJD A;  2EOI A;  2JP9 A;  4F6N A;  2EP3 A;  1UHZ A;  3F6H A;  2JR1 A;  2JOX A;  2DMY A;  1DI2 A;  2EL6 A;  2EWL A;  2EOR A;  2L8T A;  4DR2 E;  2EQ1 A;  5A6K A;  2L3J A;  3RMP A;  2WBU A;  2BB8 A;  2EOO A;  2EPL X;  1YYW A;  2YTG A;  3BID A;  4O5G A;  4MLV A;  2RS7 A;  2EN4 A;  3VYY A;  3J81 C;  3THO B;  4AQY E;  4GEQ B;  1YSA C;  2EN1 A;  1X6H A;  4LF6 E;  2EMW A;  2WBT A;  4BHC A;  2Q8U A;  3BF2 A;  2YTQ A;  1ZAA C;  2YTE A;  4LU9 A;  4JI1 E;  2EOJ A;  2FGG A;  2YU5 A;  2EQ0 A;  4K0K E;  2MC6 A;  5AE1 A;  2EMH A;  2DMI A;  2KHX A;  2N3G A;  2DLK A;  2EOQ A;  3C6M A;  2YWQ A;  2A25 A;  3VYX A;  2MC5 A;  2EM3 A;  4F54 A;  4B3T E;  1DQ3 A;  2FTX B;  4LF9 E;  4R2C A;  2M4I A;  2YTF A;  1ZBT A;  4R2R A;  3K6Q A;  4X66 E;  1XNR E;  4ZYD A;  2EQ3 A;  4M30 A;  4BS9 A;  1IBL E;  4OOG C;  2H36 X;  2LJU A;  2EMX A;  3ADI A;  4BBY A;  1F2I G;  2EM0 A;  2F8B A;  1A1H A;  4DR7 E;  4F6M A;  2LVH A;  2LCE A;  2EPZ A;  1IQS A;  5A69 A;  2YRM A;  2NUG A;  1X48 A;  3IWB A;  2BBG A;  1UIL A;  2DB2 A;  3FIG A;  1O0W A;  2CT1 A;  4LF7 E;  5AE2 A;  4DV4 E;  2EMB A;  3J80 C;  5KL6 A;  4JI0 E;  1N33 E;  1STU A;  2K4V A;  4L8N A;  1PJS A;  1IBM E;  2JPA A;  2M7Q A;  1FJG E;  1PJQ A;  3HQ1 A;  1XMO E;  4O43 A;  2EM5 A;  2L6M A;  5KL4 A;  2HJJ A;  2D9H A;  2EE8 A;  3JU0 A;  3TQM A;  3MHH C;  2ODR C;  2VF1 A;  1J5E E;  4NXM E;  1X47 A;  5KL7 A;  4MLQ A;  4X64 E;  2L3C A;  2LTS A;  4WFT A;  2EOM A;  4DV5 E;  2EOX A;  1TF6 A;  4HTG A;  1BBO A;  4JYA E;  2DSY A;  4R2E A;  4DKK A;  3HTX A;  4DUY E;  3C4B A;  4P7D A;  3HPZ A;  4F9C B;  3JAM C;  1KJK A;  2EN2 A;  2DGC A;  1QNT A;  2RQL A;  1RC7 A;  2PRT A;  4JI5 E;  4LF4 E;  2YTI A;  1EH8 A;  1AH5 A;  5FLX C;  2EM6 A;  4X8W A;  4ZYG A;  5KL2 A;  2NUF A;  4L5N C;  3BBG A;  2LO3 A;  1A1F A;  2WBS A;  2JXP A;  2HHH E;  2M1S A;  3DF6 A;  3QG5 C;  5LL6 R;  4DV0 E;  1PDA A;  4ZYE A;  2EPN A;  1EKZ A;  3KZY A;  2JYA A;  5BR8 E;  4F9A B;  2EN8 A;  3OML A;  3ADJ A;  4WSP A;  2YRK A;  2E1M A;  2YZT A;  4B3R E;  2V89 A;  2EJ4 A;  1G2D C;  3EPJ A;  5A6B A;  1SR9 A;  5TSE A;  3OTO E;  3THN A;  4KHP E;  2MKD A;  1BB8 A;  2EL5 A;  3J7A G;  1IMU A;  2ENC A;  1JK1 A;  2YSO A;  2YSP A;  4LF5 E;  4BC7 A;  3EPK A;  1GZ6 A;  1N3G A;  1X6E A;  5LLQ A;  1G2F C;  1WHQ A;  4YY3 E;  2B9D A;  4YHH E;  2L2K B;  4LFC E;  4Q28 A;  1X6F A;  4M0V A;  2V88 A;  4B3S E;  1YYK A;  3J7Y p;  2EPA A;  2RS6 A;  1HNZ E;  4X62 E;  2ZM6 E;  1N32 E;  2LBS B;  2M9A A;  1GQE A;  4R8O A;  2UUA E;  3M99 B;  4DR5 E;  5IWA E;  2YTO A;  3MHS C;  2EM8 A;  4Q35 B;  4O24 A;  1UN6 B;  2V85 A;  4JV5 E;  2CPN A;  2VQF E;  3VK6 A;  1NCS A;  2RSI A;  3T1Y E;  2DRP A;  4O4K A;  3ADG A;  2EOE A;  4JI8 E;  2EPP A;  1X3C A;  2V87 A;  2LUQ A;  4FK5 C;  2EPC A;  1PKP A;  5KL5 A;  2LUP B;  2N3H A;  2HC5 A;  1PJT A;  4WSG A;  1X49 A;  1MGT A;  1MEY C;  2EN7 A;  1DGC A;  4X9J A;  4JI3 E;  2I9I A;  5IV8 B;  2EM7 A;  2EM4 A;  2CTD A;  2WZO A;  2IHR 1;  5LMN E;  1N34 E;  3C4T A;  5A2Q C;  1T4L B;  4JI7 E;  3P1X A;  3HPS A;  1EH7 A;  2EM9 A;  4R2S A;  5A6A A;  4DR4 E;  2EMC A;  2EMF A;  5IT9 C;  2F4V E;  1WHN A;  2UU9 E;  1SFE A;  5IXM B;  3LML A;  3F6G A;  5AC5 A;  5F3W A;  1T4N A;  1X5W A;  2EN6 A;  1N36 E;  5CFF E;  1YPN A;  2EOF A;  1YFH A;  4RHB B; 
#chains in the Genus database with same CATH homology
 2LO3 A;  2EN3 A;  1A1F A;  2EMZ A;  1ZAA C;  1A1K A;  1A1I A;  2WBS A;  2EL4 A;  2WCC 3;  2ENH A;  2YTE A;  4IS1 C;  1JK2 A;  2EOJ A;  2ELY A;  2YU5 A;  2EQ0 A;  2EMI A;  2EPX A;  2EM2 A;  2EMH A;  2DMI A;  2DLK A;  1A1J A;  2EOH A;  2EOS A;  4R2A A;  2EOQ A;  3EPL A;  2EML A;  1TN9 A;  2A25 A;  2EN8 A;  4R2Q A;  2EM3 A;  4M9V C;  2EMY A;  2YRK A;  2YU8 A;  1RMD A;  2EJ4 A;  3EPJ A;  1Z1B A;  4R2C A;  1G2D C;  2MKD A;  2RPC A;  2YTF A;  1BB8 A;  2EL5 A;  4R2R A;  3UK3 C;  2VRD A;  1WJP A;  2ENC A;  1JK1 A;  2YSO A;  2YSP A;  1ZU1 A;  2ELZ A;  2EQ3 A;  2YTP A;  3EPK A;  1X6E A;  2YTD A;  1YUI A;  1B69 A;  2I13 A;  2EMX A;  1G2F C;  1P47 A;  1F2I G;  2EM0 A;  1X6F A;  1A1H A;  2E72 A;  4F2J C;  3EPH A;  2EOZ A;  2EPR A;  4F6M A;  2LVH A;  2LCE A;  2EPA A;  2EPZ A;  2EMA A;  2M9A A;  2YRM A;  2CSH A;  2EMG A;  2NAB A;  3M99 B;  2MKN A;  2YTO A;  2CT1 A;  3MHS C;  2EM8 A;  4GZN C;  1UN6 B;  2DLQ A;  4R2P A;  1NCS A;  2EMB A;  2RSI A;  5KL6 A;  2J7J A;  2DRP A;  5KL3 A;  1TF3 A;  1A1L A;  2JPA A;  2EOE A;  2EPP A;  1X3C A;  2LT7 A;  2MDG A;  4FK5 C;  2EPC A;  5KL5 A;  1ZR9 A;  2EM5 A;  4R2D A;  2YTJ A;  4WSG A;  5KL4 A;  1YUJ A;  4IJD A;  2D9H A;  2EE8 A;  1MEY C;  2ENA A;  2EOI A;  2EN7 A;  3MHH C;  4X9J A;  4F6N A;  1DGC A;  2EP3 A;  2JP9 A;  5KL7 A;  2LV2 A;  2EL6 A;  3VHT B;  2EM7 A;  2EOR A;  2HGH A;  2EM4 A;  2CTD A;  2ADR A;  2EOM A;  1TF6 A;  2EOX A;  2EQ1 A;  1BBO A;  2YTN A;  2BB8 A;  2YRH A;  2WBU A;  4R2E A;  2EOO A;  2EPU A;  2EM9 A;  2YTG A;  4R2S A;  2EMC A;  1AAY A;  2EMF A;  2EN4 A;  2EMK A;  1UBD C;  1KJK A;  1YSA C;  2EN2 A;  2EN1 A;  2DGC A;  1X6H A;  2PRT A;  2R1F A;  2EN6 A;  1X5W A;  2YTI A;  2EMW A;  2GHF A;  2EOY A;  2GLI A;  2WBT A;  2EM6 A;  2EOF A;  1LLM C;  5KL2 A;  1A1G A;  2YTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...