2MDGA

Solution nmr structure of zinc finger protein 423 from homo sapiens, northeast structural genomics consortium (nesg) target hr7298f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
b'MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 423
publication title Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mdgA00
2EORA 2DRPA 2LT7A 2WBUA 2EMCA 1F2IG 2EMZA 1X3CA 2NABA 4F6NA 2EMFA 2EPCA 3MHSC 2EM7A 2MDGA 2EMIA 2EMXA 2EM6A 4GZNC 2RPCA 2EM3A 2EQ1A 2YTPA 2WBSA 2PRTA 2YRMA 2EL6A 3VHTB 3M99B 1WJPA 1TN9A 2EN3A 1A1JA 2LV2A 2DLQA 2EMGA 2YRHA 2EMBA 2ELZA 1BB8A 4R2RA 2ENHA 2EJ4A 4R2QA 1B69A 2EM2A 2EOJA 2EN4A 2YU8A 2EOHA 1G2DC 1Z1BA 4IS1C 4IJDA 1TF3A 5KL3A 2JPAA 2DLKA 2EMLA 2CTDA 5KL7A 2JP9A 2EOSA 2HGHA 4R2AA 1TF6A 2YTQA 2EMYA 2YTFA 2EMWA 1KJKA 2I13A 2YTOA 2EN1A 1RMDA 2EOFA 5KL6A 2ENCA 1X6EA 2GLIA 2EOIA 1YUJA 1ZU1A 2YTNA 1LLMC 2EM5A 3EPKA 1X6FA 2E72A 1NCSA 1A1FA 2EOOA 1A1IA 2EOZA 2EQ3A 2YTGA 2ELYA 2EN7A 2YSPA 2D9HA 4F6MA 2EOQA 2EQ0A 2EPXA 1A1HA 2EM8A 4R2SA 1P47A 4WSGA 5KL2A 4R2EA 5KL4A 1YSAC 2GHFA 2EM4A 3EPJA 2RSIA 1G2FC 1ZAAC 2EOXA 2MKNA 2EE8A 2J7JA 2EMKA 1JK1A 4X9JA 1JK2A 2EPZA 2WBTA 2WCC3 2EN6A 2CT1A 2EOMA 2EOEA 2M9AA 2DGCA 4R2PA 1X5WA 3EPLA 2EPAA 2EOYA 1DGCA 2ENAA 1YUIA 2EPUA 2EN8A 2YTIA 3MHHC 2EN2A 2YU5A 2EL4A 2LO3A 4FK5C 2A25A 3EPHA 4M9VC 5KL5A 2VRDA 4F2JC 2LVHA 1A1GA 2YRKA 2YTDA 4R2CA 1UN6B 2YTJA 2CSHA 1A1KA 2BB8A 2EM9A 2EP3A 1AAYA 2LCEA 2MKDA 2EM0A 1BBOA 2DMIA 1X6HA 2YSOA 2EPPA 2EMAA 1UBDC 2ADRA 4R2DA 1MEYC 2EMHA 2R1FA 2EL5A 3UK3C 2YTEA 1ZR9A 2EPRA 1A1LA
chains in the Genus database with same CATH superfamily
3BBGA 1X3CA 1YYWA 3C6KA 4BC9A 3L00A 2EMXA 2EM6A 4GZNC 4X66E 2EM3A 4BBYA 3OMLA 3HQ1A 2HHHE 2B9DA 2KHXA 2EN3A 1BBGA 3HTXA 2EMBA 5T6JA 4R2RA 1PJQA 2B3TB 1B69A 3THNA 2EM2A 4B3SE 2LJUA 3HXLA 2L3JA 4TUGA 2KOUA 4LF5E 2BBGA 4DR1E 2EMLA 4LTYA 1T38A 1O0WA 5TSEA 4DV3E 1X48A 2HGHA 2DMYA 1KJKA 2I13A 2EN1A 1RMDA 2YWQA 5KL6A 2ENCA 3FIGA 1YUJA 2YTNA 3EPKA 2R76A 2E72A 1A1FA 2FGGA 3P1XA 4DR5E 2V88A 1N36E 4YY3E 1XNRE 4LFAE 3ECRA 1J5EE 2EPXA 3KZZA 4YHHE 4BHBA 2YT4A 1ZBTA 2LRSA 2Q8UA 5KL2A 4X65E 3F6HA 4R2EA 5A6JA 4HTGA 1YFHA 3OTOE 2EM4A 3EPJA 2RSIA 1YYKA 2VQEE 2F8BA 3C4BA 4WFTA 2LTRA 2LJHA 4DV5E 3HPSA 2UXCE 2JR1A 4LF7E 4F9AB 1X5WA 2B7TA 2EPAA 4X8WA 2JWOA 1DGCA 2EPOA 2EN8A 1KYQA 2ODRD 2L2NA 2YU5A 2LO3A 2A25A 2YPNA 4M9VC 4F2JC 2LVHA 2UXBE 2RTXA 2JOBA 5AE3A 1ZBQA 1A1KA 1AAYA 1GQEA 1EKZA 2M1SA 2UXDE 1IBKE 1N33E 2EMAA 2V86A 1MEYC 2EMHA 4WYQB 4LU9A 1HR0E 3DJWA 3UK3C 3IWBA 1DI2A 2MDRA 1G2FC 1YPNA 1A1LA 3KZYA 1IQSA 2JYAA 2NUFA 2EMZA 4F6NA 2V87A 2JVAA 1FJGE 1N34E 3MHSC 2EMIA 4JI3E 3LMLA 1N3GA 4LF8E 2WZOA 5IV8B 4HEIA 2EMGA 2YRHA 5A6AA 3DF6A 2EJ4A 3BIDA 2EOJA 2EWLA 2EN4A 4WX9A 1AH5A 2EOHA 3H09A 1PKPA 2E5LE 4DV7E 4X64E 3J81C 4ZYDA 4OX9E 2RS6A 2YTFA 3ADGA 4B3ME 1X49A 5AASA 2EOIA 1LLMC 1X6FA 2H36X 4DV1E 2EOOA 1A1IA 2EQ3A 2V83A 3F6GA 4P7DA 2YSPA 4NZVA 4F6MA 2EOQA 3AUZA 2L92A 2MC5A 3EQ1A 3ZOQB 4JI8E 2NA2A 2GHFA 4GKJE 2EPLX 1PJSA 1ZAAC 1QNTA 4KHPE 2EOXA 4F9BB 2V8QB 2EE8A 2MC6A 2RSMA 2GPIA 2V85A 4X9JA 2EPZA 1T4OA 2WBTA 2EOMA 4DKKA 2LE2A 4O24A 3ADLA 2DGCA 2UUAE 3EPLA 3J7Yp 5IXMB 2EPUA 3MHHC 1I94E 2EL4A 1L4SA 4KZSA 5A2QC 3EPHA 4O5GA 5F3WA 2E1MA 2CPNA 2YRKA 4R2CA 4DUZE 2CSHA 3T1YE 4LF6E 1YYOA 2BB8A 2EM9A 2EM0A 1BBOA 4K0KE 4F9CB 4WSPA 2UUBE 2YSOA 1WXRA 4R2DA 1T4LB 4DUYE 3M99B 1WHNA 2EPRA 1RQ0A 4P78A 2YZTA 4KWYA 2LT7A 2WBUA 1F2IG 3C4TA 2NABA 4JI1E 2EPCA 2EM7A 2MDGA 2DSYA 3JTZA 2YTPA 5BR8E 2LUPB 2EL6A 4WXCA 3VHTB 2L8TA 1WJPA 3VK6A 2LTSA 5AC5A 1TN9A 2LV2A 2EPKX 2EPMX 1DQ3A 1SR9A 2L3CA 5LMUE 1N32E 1G2DC 2V89A 4IJDA 4NXME 4WXDA 1STUA 4DV2E 2L6MA 4BCAA 1QU6A 1TF3A 2DLKA 3TQMA 1IMUA 5KL7A 2JP9A 5ADZA 2DB2A 2VQFE 4R2AA 1X47A 1TF6A 5AE2A 3IWDA 4B3RE 2DIXA 2RQLA 2GLIA 4DR6E 3HPZA 4AQYE 2L33A 1PJTA 1NEIA 1PDAA 1NCSA 4DV4E 2K7IA 1WRJA 4LFBE 4M30A 4BHCA 4WPYA 2EN7A 4BMJA 2KONA 2JY9A 4ZYGA 2N3GA 2EQ0A 4M0VA 1A1HA 1P47A 4L8NA 2HC5A 2ODRC 2ZM6E 2UUCE 2UU9E 4I8OA 1IQOA 5KL4A 1YSAC 3LLHA 2N8XA 4GEQB 1XMQE 3J7AG 3J80C 5LMNE 4LF9E 1EH8A 1JK1A 4DV6E 5A69A 1JK2A 2WCC3 2EN6A 2CT1A 2M7QA 2EOEA 2M9AA 1HNXE 2EZ6A 2G7HA 2EOYA 4Q35B 1EH7A 2B7VA 4FK5C 2VF1A 5KL5A 2VRDA 4DMIA 2YTDA 2YTJA 2NUGA 1YZ9A 5LL6R 4Q28A 2LCEA 2MKDA 5A6BD 4DR4E 2DMIA 2FTXB 1HNZE 4R8OA 4ZYEA 3JAMC 2LBSB 3KWRA 1UBDC 2R1FA 4DR2E 3ADJA 4JI4E 3VYXA 1ZR9A 2EPNA 2EORA 4GKKE 2DRPA 4J8ZA 4DR3E 2EMCA 2F4VE 3BF2A 2NUEA 2EMFA 2VE7C 1J26A 4DR7E 4O4KA 2RPCA 3ADIA 2EQ1A 2PRTA 4NHRA 2WBSA 2YRMA 4NXNE 5AC4A 4RHBB 4LF4E 1A1JA 2DLQA 5AE1A 2ELZA 1BB8A 2ENHA 4R2QA 5IT9C 1T4NA 1EH6A 3JU0A 3AV0A 5A6BA 2JOXA 3QG5C 2YU8A 1UHZA 4OOGC 2LMZA 1GZ6A 4IS1C 1Z1BA 1T39A 4JI5E 4N4RB 5KL3A 2JPAA 3THOB 2CTDA 2EOSA 5FLXC 3T1HE 1MGTA 2N3HA 4F54A 2YTQA 2EMYA 2EMWA 2YTOA 2EOFA 5A6KA 1X6EA 4TUIA 4BC7A 1ZU1A 2K4VA 2EM5A 4DV0E 4MLVA 1IBME 4M2ZA 5IWAE 2FV4B 1FKAE 2EOZA 5DNYA 2YTGA 2ELYA 2L2KB 2D9HA 2RS7A 1RC7A 4R03A 2EM8A 2LUQA 4R2SA 4WSGA 4JI0E 4JYAE 4L5NC 1GTKA 4RH8A 2JXPA 4JI6E 2L2MA 1HNWE 4O43A 4JV5E 2MKNA 5CFFE 4JI2E 2HJJA 2J7JA 4BS9A 2EMKA 4LFCE 4JI7E 4ZYHA 1XNQE 4R2PA 3MSWA 3RMPA 1UILA 2ENAA 1YUIA 2YTIA 2EN2A 1WHQA 1IBLE 1UN6B 1A1GA 3C6MA 3VYYA 2EP3A 5LLQA 1SFEA 4X62E 4B3TE 3K6QA 1X6HA 1XMOE 2EPPA 2ADRA 3BGHA 4MLQA 3IWCA 2IHR1 2EL5A 2YTEA 2M4IA 2I9IA
chains in the Genus database with same CATH topology
2EORA 2DRPA 2LT7A 2WBUA 2EMCA 1F2IG 2EMZA 1X3CA 2NABA 4F6NA 2EMFA 2EPCA 3MHSC 2EM7A 2MDGA 2EMIA 2EMXA 2EM6A 4GZNC 2RPCA 2EM3A 2EQ1A 2YTPA 2WBSA 2PRTA 2YRMA 2EL6A 3VHTB 3M99B 1WJPA 1TN9A 2EN3A 1A1JA 2LV2A 2DLQA 2EMGA 2YRHA 2EMBA 2ELZA 1BB8A 4R2RA 2ENHA 2EJ4A 4R2QA 1B69A 2EM2A 2EOJA 2EN4A 2YU8A 2EOHA 1G2DC 1Z1BA 4IS1C 4IJDA 1TF3A 5KL3A 2JPAA 2DLKA 2EMLA 2CTDA 5KL7A 2JP9A 2EOSA 2HGHA 4R2AA 1TF6A 2YTQA 2EMYA 2YTFA 2EMWA 1KJKA 2I13A 2YTOA 2EN1A 1RMDA 2EOFA 5KL6A 2ENCA 1X6EA 2GLIA 2EOIA 1YUJA 1ZU1A 2YTNA 1LLMC 2EM5A 3EPKA 1X6FA 2E72A 1NCSA 1A1FA 2EOOA 1A1IA 2EOZA 2EQ3A 2YTGA 2ELYA 2EN7A 2YSPA 2D9HA 4F6MA 2EOQA 2EQ0A 2EPXA 1A1HA 2EM8A 4R2SA 1P47A 4WSGA 5KL2A 4R2EA 5KL4A 1YSAC 2GHFA 2EM4A 3EPJA 2RSIA 1G2FC 1ZAAC 2EOXA 2MKNA 2EE8A 2J7JA 2EMKA 1JK1A 4X9JA 1JK2A 2EPZA 2WBTA 2WCC3 2EN6A 2CT1A 2EOMA 2EOEA 2M9AA 2DGCA 4R2PA 1X5WA 3EPLA 2EPAA 2EOYA 1DGCA 2ENAA 1YUIA 2EPUA 2EN8A 2YTIA 3MHHC 2EN2A 2YU5A 2EL4A 2LO3A 4FK5C 2A25A 3EPHA 4M9VC 5KL5A 2VRDA 4F2JC 2LVHA 1A1GA 2YRKA 2YTDA 4R2CA 1UN6B 2YTJA 2CSHA 1A1KA 2BB8A 2EM9A 2EP3A 1AAYA 2LCEA 2MKDA 2EM0A 1BBOA 2DMIA 1X6HA 2YSOA 2EPPA 2EMAA 1UBDC 2ADRA 4R2DA 1MEYC 2EMHA 2R1FA 2EL5A 3UK3C 2YTEA 1ZR9A 2EPRA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  2DRP A;  2LT7 A;  2WBU A;  2EMC A;  1F2I G;  2EMZ A;  1X3C A;  2NAB A;  4F6N A;  2EMF A;  2EPC A;  3MHS C;  2EM7 A;  2MDG A;  2EMI A;  2EMX A;  2EM6 A;  4GZN C;  2RPC A;  2EM3 A;  2EQ1 A;  2YTP A;  2WBS A;  2PRT A;  2YRM A;  2EL6 A;  3VHT B;  3M99 B;  1WJP A;  1TN9 A;  2EN3 A;  1A1J A;  2LV2 A;  2DLQ A;  2EMG A;  2YRH A;  2EMB A;  2ELZ A;  1BB8 A;  4R2R A;  2ENH A;  2EJ4 A;  4R2Q A;  1B69 A;  2EM2 A;  2EOJ A;  2EN4 A;  2YU8 A;  2EOH A;  1G2D C;  1Z1B A;  4IS1 C;  4IJD A;  1TF3 A;  5KL3 A;  2JPA A;  2DLK A;  2EML A;  2CTD A;  5KL7 A;  2JP9 A;  2EOS A;  2HGH A;  4R2A A;  1TF6 A;  2YTQ A;  2EMY A;  2YTF A;  2EMW A;  1KJK A;  2I13 A;  2YTO A;  2EN1 A;  1RMD A;  2EOF A;  5KL6 A;  2ENC A;  1X6E A;  2GLI A;  2EOI A;  1YUJ A;  1ZU1 A;  2YTN A;  1LLM C;  2EM5 A;  3EPK A;  1X6F A;  2E72 A;  1NCS A;  1A1F A;  2EOO A;  1A1I A;  2EOZ A;  2EQ3 A;  2YTG A;  2ELY A;  2EN7 A;  2YSP A;  2D9H A;  4F6M A;  2EOQ A;  2EQ0 A;  2EPX A;  1A1H A;  2EM8 A;  4R2S A;  1P47 A;  4WSG A;  5KL2 A;  4R2E A;  5KL4 A;  1YSA C;  2GHF A;  2EM4 A;  3EPJ A;  2RSI A;  1G2F C;  1ZAA C;  2EOX A;  2MKN A;  2EE8 A;  2J7J A;  2EMK A;  1JK1 A;  4X9J A;  1JK2 A;  2EPZ A;  2WBT A;  2WCC 3;  2EN6 A;  2CT1 A;  2EOM A;  2EOE A;  2M9A A;  2DGC A;  4R2P A;  1X5W A;  3EPL A;  2EPA A;  2EOY A;  1DGC A;  2ENA A;  1YUI A;  2EPU A;  2EN8 A;  2YTI A;  3MHH C;  2EN2 A;  2YU5 A;  2EL4 A;  2LO3 A;  4FK5 C;  2A25 A;  3EPH A;  4M9V C;  5KL5 A;  2VRD A;  4F2J C;  2LVH A;  1A1G A;  2YRK A;  2YTD A;  4R2C A;  1UN6 B;  2YTJ A;  2CSH A;  1A1K A;  2BB8 A;  2EM9 A;  2EP3 A;  1AAY A;  2LCE A;  2MKD A;  2EM0 A;  1BBO A;  2DMI A;  1X6H A;  2YSO A;  2EPP A;  2EMA A;  1UBD C;  2ADR A;  4R2D A;  1MEY C;  2EMH A;  2R1F A;  2EL5 A;  3UK3 C;  2YTE A;  1ZR9 A;  2EPR A;  1A1L A; 
#chains in the Genus database with same CATH topology
 3BBG A;  1X3C A;  1YYW A;  3C6K A;  4BC9 A;  3L00 A;  2EMX A;  2EM6 A;  4GZN C;  4X66 E;  2EM3 A;  4BBY A;  3OML A;  3HQ1 A;  2HHH E;  2B9D A;  2KHX A;  2EN3 A;  1BBG A;  3HTX A;  2EMB A;  5T6J A;  4R2R A;  1PJQ A;  2B3T B;  1B69 A;  3THN A;  2EM2 A;  4B3S E;  2LJU A;  3HXL A;  2L3J A;  4TUG A;  2KOU A;  4LF5 E;  2BBG A;  4DR1 E;  2EML A;  4LTY A;  1T38 A;  1O0W A;  5TSE A;  4DV3 E;  1X48 A;  2HGH A;  2DMY A;  1KJK A;  2I13 A;  2EN1 A;  1RMD A;  2YWQ A;  5KL6 A;  2ENC A;  3FIG A;  1YUJ A;  2YTN A;  3EPK A;  2R76 A;  2E72 A;  1A1F A;  2FGG A;  3P1X A;  4DR5 E;  2V88 A;  1N36 E;  4YY3 E;  1XNR E;  4LFA E;  3ECR A;  1J5E E;  2EPX A;  3KZZ A;  4YHH E;  4BHB A;  2YT4 A;  1ZBT A;  2LRS A;  2Q8U A;  5KL2 A;  4X65 E;  3F6H A;  4R2E A;  5A6J A;  4HTG A;  1YFH A;  3OTO E;  2EM4 A;  3EPJ A;  2RSI A;  1YYK A;  2VQE E;  2F8B A;  3C4B A;  4WFT A;  2LTR A;  2LJH A;  4DV5 E;  3HPS A;  2UXC E;  2JR1 A;  4LF7 E;  4F9A B;  1X5W A;  2B7T A;  2EPA A;  4X8W A;  2JWO A;  1DGC A;  2EPO A;  2EN8 A;  1KYQ A;  2ODR D;  2L2N A;  2YU5 A;  2LO3 A;  2A25 A;  2YPN A;  4M9V C;  4F2J C;  2LVH A;  2UXB E;  2RTX A;  2JOB A;  5AE3 A;  1ZBQ A;  1A1K A;  1AAY A;  1GQE A;  1EKZ A;  2M1S A;  2UXD E;  1IBK E;  1N33 E;  2EMA A;  2V86 A;  1MEY C;  2EMH A;  4WYQ B;  4LU9 A;  1HR0 E;  3DJW A;  3UK3 C;  3IWB A;  1DI2 A;  2MDR A;  1G2F C;  1YPN A;  1A1L A;  3KZY A;  1IQS A;  2JYA A;  2NUF A;  2EMZ A;  4F6N A;  2V87 A;  2JVA A;  1FJG E;  1N34 E;  3MHS C;  2EMI A;  4JI3 E;  3LML A;  1N3G A;  4LF8 E;  2WZO A;  5IV8 B;  4HEI A;  2EMG A;  2YRH A;  5A6A A;  3DF6 A;  2EJ4 A;  3BID A;  2EOJ A;  2EWL A;  2EN4 A;  4WX9 A;  1AH5 A;  2EOH A;  3H09 A;  1PKP A;  2E5L E;  4DV7 E;  4X64 E;  3J81 C;  4ZYD A;  4OX9 E;  2RS6 A;  2YTF A;  3ADG A;  4B3M E;  1X49 A;  5AAS A;  2EOI A;  1LLM C;  1X6F A;  2H36 X;  4DV1 E;  2EOO A;  1A1I A;  2EQ3 A;  2V83 A;  3F6G A;  4P7D A;  2YSP A;  4NZV A;  4F6M A;  2EOQ A;  3AUZ A;  2L92 A;  2MC5 A;  3EQ1 A;  3ZOQ B;  4JI8 E;  2NA2 A;  2GHF A;  4GKJ E;  2EPL X;  1PJS A;  1ZAA C;  1QNT A;  4KHP E;  2EOX A;  4F9B B;  2V8Q B;  2EE8 A;  2MC6 A;  2RSM A;  2GPI A;  2V85 A;  4X9J A;  2EPZ A;  1T4O A;  2WBT A;  2EOM A;  4DKK A;  2LE2 A;  4O24 A;  3ADL A;  2DGC A;  2UUA E;  3EPL A;  3J7Y p;  5IXM B;  2EPU A;  3MHH C;  1I94 E;  2EL4 A;  1L4S A;  4KZS A;  5A2Q C;  3EPH A;  4O5G A;  5F3W A;  2E1M A;  2CPN A;  2YRK A;  4R2C A;  4DUZ E;  2CSH A;  3T1Y E;  4LF6 E;  1YYO A;  2BB8 A;  2EM9 A;  2EM0 A;  1BBO A;  4K0K E;  4F9C B;  4WSP A;  2UUB E;  2YSO A;  1WXR A;  4R2D A;  1T4L B;  4DUY E;  3M99 B;  1WHN A;  2EPR A;  1RQ0 A;  4P78 A;  2YZT A;  4KWY A;  2LT7 A;  2WBU A;  1F2I G;  3C4T A;  2NAB A;  4JI1 E;  2EPC A;  2EM7 A;  2MDG A;  2DSY A;  3JTZ A;  2YTP A;  5BR8 E;  2LUP B;  2EL6 A;  4WXC A;  3VHT B;  2L8T A;  1WJP A;  3VK6 A;  2LTS A;  5AC5 A;  1TN9 A;  2LV2 A;  2EPK X;  2EPM X;  1DQ3 A;  1SR9 A;  2L3C A;  5LMU E;  1N32 E;  1G2D C;  2V89 A;  4IJD A;  4NXM E;  4WXD A;  1STU A;  4DV2 E;  2L6M A;  4BCA A;  1QU6 A;  1TF3 A;  2DLK A;  3TQM A;  1IMU A;  5KL7 A;  2JP9 A;  5ADZ A;  2DB2 A;  2VQF E;  4R2A A;  1X47 A;  1TF6 A;  5AE2 A;  3IWD A;  4B3R E;  2DIX A;  2RQL A;  2GLI A;  4DR6 E;  3HPZ A;  4AQY E;  2L33 A;  1PJT A;  1NEI A;  1PDA A;  1NCS A;  4DV4 E;  2K7I A;  1WRJ A;  4LFB E;  4M30 A;  4BHC A;  4WPY A;  2EN7 A;  4BMJ A;  2KON A;  2JY9 A;  4ZYG A;  2N3G A;  2EQ0 A;  4M0V A;  1A1H A;  1P47 A;  4L8N A;  2HC5 A;  2ODR C;  2ZM6 E;  2UUC E;  2UU9 E;  4I8O A;  1IQO A;  5KL4 A;  1YSA C;  3LLH A;  2N8X A;  4GEQ B;  1XMQ E;  3J7A G;  3J80 C;  5LMN E;  4LF9 E;  1EH8 A;  1JK1 A;  4DV6 E;  5A69 A;  1JK2 A;  2WCC 3;  2EN6 A;  2CT1 A;  2M7Q A;  2EOE A;  2M9A A;  1HNX E;  2EZ6 A;  2G7H A;  2EOY A;  4Q35 B;  1EH7 A;  2B7V A;  4FK5 C;  2VF1 A;  5KL5 A;  2VRD A;  4DMI A;  2YTD A;  2YTJ A;  2NUG A;  1YZ9 A;  5LL6 R;  4Q28 A;  2LCE A;  2MKD A;  5A6B D;  4DR4 E;  2DMI A;  2FTX B;  1HNZ E;  4R8O A;  4ZYE A;  3JAM C;  2LBS B;  3KWR A;  1UBD C;  2R1F A;  4DR2 E;  3ADJ A;  4JI4 E;  3VYX A;  1ZR9 A;  2EPN A;  2EOR A;  4GKK E;  2DRP A;  4J8Z A;  4DR3 E;  2EMC A;  2F4V E;  3BF2 A;  2NUE A;  2EMF A;  2VE7 C;  1J26 A;  4DR7 E;  4O4K A;  2RPC A;  3ADI A;  2EQ1 A;  2PRT A;  4NHR A;  2WBS A;  2YRM A;  4NXN E;  5AC4 A;  4RHB B;  4LF4 E;  1A1J A;  2DLQ A;  5AE1 A;  2ELZ A;  1BB8 A;  2ENH A;  4R2Q A;  5IT9 C;  1T4N A;  1EH6 A;  3JU0 A;  3AV0 A;  5A6B A;  2JOX A;  3QG5 C;  2YU8 A;  1UHZ A;  4OOG C;  2LMZ A;  1GZ6 A;  4IS1 C;  1Z1B A;  1T39 A;  4JI5 E;  4N4R B;  5KL3 A;  2JPA A;  3THO B;  2CTD A;  2EOS A;  5FLX C;  3T1H E;  1MGT A;  2N3H A;  4F54 A;  2YTQ A;  2EMY A;  2EMW A;  2YTO A;  2EOF A;  5A6K A;  1X6E A;  4TUI A;  4BC7 A;  1ZU1 A;  2K4V A;  2EM5 A;  4DV0 E;  4MLV A;  1IBM E;  4M2Z A;  5IWA E;  2FV4 B;  1FKA E;  2EOZ A;  5DNY A;  2YTG A;  2ELY A;  2L2K B;  2D9H A;  2RS7 A;  1RC7 A;  4R03 A;  2EM8 A;  2LUQ A;  4R2S A;  4WSG A;  4JI0 E;  4JYA E;  4L5N C;  1GTK A;  4RH8 A;  2JXP A;  4JI6 E;  2L2M A;  1HNW E;  4O43 A;  4JV5 E;  2MKN A;  5CFF E;  4JI2 E;  2HJJ A;  2J7J A;  4BS9 A;  2EMK A;  4LFC E;  4JI7 E;  4ZYH A;  1XNQ E;  4R2P A;  3MSW A;  3RMP A;  1UIL A;  2ENA A;  1YUI A;  2YTI A;  2EN2 A;  1WHQ A;  1IBL E;  1UN6 B;  1A1G A;  3C6M A;  3VYY A;  2EP3 A;  5LLQ A;  1SFE A;  4X62 E;  4B3T E;  3K6Q A;  1X6H A;  1XMO E;  2EPP A;  2ADR A;  3BGH A;  4MLQ A;  3IWC A;  2IHR 1;  2EL5 A;  2YTE A;  2M4I A;  2I9I A; 
#chains in the Genus database with same CATH homology
 2EOR A;  2DRP A;  2LT7 A;  2WBU A;  2EMC A;  1F2I G;  2EMZ A;  1X3C A;  2NAB A;  4F6N A;  2EMF A;  2EPC A;  3MHS C;  2EM7 A;  2MDG A;  2EMI A;  2EMX A;  2EM6 A;  4GZN C;  2RPC A;  2EM3 A;  2EQ1 A;  2YTP A;  2WBS A;  2PRT A;  2YRM A;  2EL6 A;  3VHT B;  3M99 B;  1WJP A;  1TN9 A;  2EN3 A;  1A1J A;  2LV2 A;  2DLQ A;  2EMG A;  2YRH A;  2EMB A;  2ELZ A;  1BB8 A;  4R2R A;  2ENH A;  2EJ4 A;  4R2Q A;  1B69 A;  2EM2 A;  2EOJ A;  2EN4 A;  2YU8 A;  2EOH A;  1G2D C;  1Z1B A;  4IS1 C;  4IJD A;  1TF3 A;  5KL3 A;  2JPA A;  2DLK A;  2EML A;  2CTD A;  5KL7 A;  2JP9 A;  2EOS A;  2HGH A;  4R2A A;  1TF6 A;  2YTQ A;  2EMY A;  2YTF A;  2EMW A;  1KJK A;  2I13 A;  2YTO A;  2EN1 A;  1RMD A;  2EOF A;  5KL6 A;  2ENC A;  1X6E A;  2GLI A;  2EOI A;  1YUJ A;  1ZU1 A;  2YTN A;  1LLM C;  2EM5 A;  3EPK A;  1X6F A;  2E72 A;  1NCS A;  1A1F A;  2EOO A;  1A1I A;  2EOZ A;  2EQ3 A;  2YTG A;  2ELY A;  2EN7 A;  2YSP A;  2D9H A;  4F6M A;  2EOQ A;  2EQ0 A;  2EPX A;  1A1H A;  2EM8 A;  4R2S A;  1P47 A;  4WSG A;  5KL2 A;  4R2E A;  5KL4 A;  1YSA C;  2GHF A;  2EM4 A;  3EPJ A;  2RSI A;  1G2F C;  1ZAA C;  2EOX A;  2MKN A;  2EE8 A;  2J7J A;  2EMK A;  1JK1 A;  4X9J A;  1JK2 A;  2EPZ A;  2WBT A;  2WCC 3;  2EN6 A;  2CT1 A;  2EOM A;  2EOE A;  2M9A A;  2DGC A;  4R2P A;  1X5W A;  3EPL A;  2EPA A;  2EOY A;  1DGC A;  2ENA A;  1YUI A;  2EPU A;  2EN8 A;  2YTI A;  3MHH C;  2EN2 A;  2YU5 A;  2EL4 A;  2LO3 A;  4FK5 C;  2A25 A;  3EPH A;  4M9V C;  5KL5 A;  2VRD A;  4F2J C;  2LVH A;  1A1G A;  2YRK A;  2YTD A;  4R2C A;  1UN6 B;  2YTJ A;  2CSH A;  1A1K A;  2BB8 A;  2EM9 A;  2EP3 A;  1AAY A;  2LCE A;  2MKD A;  2EM0 A;  1BBO A;  2DMI A;  1X6H A;  2YSO A;  2EPP A;  2EMA A;  1UBD C;  2ADR A;  4R2D A;  1MEY C;  2EMH A;  2R1F A;  2EL5 A;  3UK3 C;  2YTE A;  1ZR9 A;  2EPR A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...