2MDGA

Solution nmr structure of zinc finger protein 423 from homo sapiens, northeast structural genomics consortium (nesg) target hr7298f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 423
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mdgA00
2EMGA 2YTQA 2EN2A 2EOIA 2MKDA 3EPKA 4F6MA 2EPAA 2EN8A 2EOMA 2EPRA 1A1HA 2RPCA 4R2PA 2EOZA 2YTPA 5KL7A 2EOEA 2EQ1A 2YRMA 4FK5C 1JK1A 1G2FC 1ZU1A 2EMFA 3VHTB 2EM3A 2YTNA 2ENCA 2YSOA 1A1LA 1WJPA 2EM0A 2MKNA 2EM7A 1A1IA 4IJDA 2EOXA 1JK2A 2BB8A 2EN4A 1X6FA 2EMIA 2ENHA 2RSIA 1BBOA 4R2CA 2YRKA 4R2SA 1DGCA 2CSHA 2YRHA 2EN7A 3UK3C 2CT1A 2JP9A 1YUJA 1NCSA 2EN3A 2EM4A 2EOOA 4R2AA 2LV2A 1P47A 2EORA 3M99B 1B69A 1X3CA 2EM5A 2EMCA 2E72A 2YSPA 2DRPA 2YTFA 1LLMC 2EOFA 4M9VC 2D9HA 2DLQA 2M9AA 2EM9A 1UN6B 2ADRA 5KL6A 2EE8A 2EN6A 1Z1BA 1YUIA 4X9JA 2I13A 1A1FA 2EOJA 4F2JC 2EMHA 4WSGA 2ENAA 1G2DC 4R2DA 2VRDA 4R2RA 1F2IG 1X5WA 2EPZA 1X6EA 2DMIA 2EMKA 2EL6A 2YTOA 5KL5A 1TF6A 3EPHA 1TN9A 4F6NA 2LO3A 2EPXA 2HGHA 2EPCA 2YTGA 2GLIA 2WCC3 1RMDA 1ZAAC 2EMXA 1X6HA 1ZR9A 2PRTA 1YSAC 2EM8A 2EPPA 2EQ0A 1TF3A 2YTDA 2EOQA 2EMZA 2EJ4A 2R1FA 1BB8A 2EMBA 2A25A 5KL2A 2EQ3A 2J7JA 2WBUA 2YTJA 1UBDC 2EP3A 2EMAA 2LT7A 2WBSA 2ELZA 1A1KA 2EN1A 1KJKA 2EL4A 2JPAA 3MHHC 2EOYA 2GHFA 2EM6A 2LVHA 2YU8A 2EM2A 1A1JA 2YU5A 2EPUA 3EPLA 4IS1C 2EOHA 2MDGA 5KL4A 4R2EA 3EPJA 2EMYA 2LCEA 1MEYC 2ELYA 1A1GA 2EL5A 2EMWA 1AAYA 2EMLA 3MHSC 2EOSA 2NABA 2YTIA 5KL3A 2DLKA 2CTDA 2YTEA 4R2QA 2WBTA 4GZNC 2DGCA
chains in the Genus database with same CATH superfamily
5FLXC 2YTQA 5IWAE 4DV1E 2EOMA 4Q35B 2Q8UA 3IWBA 3C4TA 2VQEE 5A6BA 4FK5C 4KHPE 1GTKA 4X65E 3VHTB 4F54A 2LTSA 1WJPA 2EM0A 1X48A 2JYAA 1A1IA 4IJDA 4LF6E 3T1YE 4DV3E 4L5NC 2B7TA 4LFAE 5A69A 1JK2A 2F8BA 5LLQA 3J80C 2I9IA 3C4BA 4WYQB 2ENHA 2DB2A 2YRKA 2L2NA 3BBGA 4O43A 2R76A 3UK3C 1XNRE 3P1XA 2L6MA 4BS9A 4R2AA 2K4VA 3ADLA 5IT9C 2NUGA 2LV2A 1P47A 4B3RE 4B3TE 2LTRA 2E72A 3LLHA 3H09A 3VYXA 1STUA 4M9VC 2D9HA 4J8ZA 1X47A 5AC5A 2ADRA 3QG5C 3ADGA 4LFBE 2EN6A 1EH8A 2RSMA 2B7VA 2JOXA 5A6BD 4WSGA 2ENAA 2UU9E 4WX9A 2VRDA 2FV4B 1X5WA 1X6EA 2DMIA 2EPZA 2RQLA 2YTOA 4LFCE 1PDAA 2VE7C 2VQFE 2YTGA 1FKAE 3EQ1A 1RMDA 2EMXA 2LBSB 2EPOA 3F6GA 1YSAC 5DNYA 5AC4A 1TF3A 2EWLA 2EJ4A 2R1FA 4HEIA 2EMBA 1BB8A 3THNA 2KOUA 2DSYA 4JI3E 3J7Yp 4DV6E 3ADJA 3ZOQB 2LT7A 5AASA 2LMZA 2EL4A 3MHHC 4KWYA 4N4RB 2LVHA 2F4VE 2LRSA 2V86A 5KL4A 4R2EA 4ZYEA 2LCEA 1DQ3A 2EL5A 4K0KE 3F6HA 2EMLA 1XNQE 2YTIA 2H36X 3ADIA 2IHR1 4I8OA 2DLKA 2WBTA 1YPNA 4LF9E 4KZSA 2LUPB 2EN2A 4ZYGA 2HC5A 1RC7A 2EOIA 1A1HA 4F6MA 3C6MA 2EPRA 2RPCA 3OMLA 4R2PA 3HXLA 4P7DA 3VK6A 4TUGA 5IV8B 1HNZE 2EMFA 4MLQA 1T4NA 2ENCA 2MKNA 1RQ0A 2EOXA 4F9AB 3OTOE 4DR7E 4JI6E 4B3SE 1T4OA 1BBGA 1YYOA 2RSIA 1T39A 2N3GA 4R2CA 4M2ZA 4R2SA 2YRHA 2M7QA 1WHQA 1ZBTA 4ZYHA 2NUFA 3FIGA 1O0WA 2EM4A 1EH7A 3DF6A 2EORA 3M99B 1UILA 1IBME 2UXCE 2EM5A 2ODRC 2YTFA 1LLMC 4WFTA 5LMUE 1IBKE 2HJJA 2DLQA 2JXPA 1EKZA 4GKKE 3J7AG 4JI0E 2L8TA 4LF8E 1YUIA 3KWRA 1A1FA 4ZYDA 1N32E 4R2DA 4R2RA 4TUIA 5KL5A 1TN9A 4DR3E 2HGHA 2LUQA 2EPLX 3JTZA 2WCC3 1ZAAC 1X6HA 5LL6R 4BMJA 1ZBQA 5F3WA 1DI2A 2EM8A 4X66E 2JVAA 2EQ0A 2YTDA 2EOQA 4L8NA 2LJUA 2YT4A 1N3GA 1IQSA 5CFFE 3JU0A 2MC6A 1UBDC 2KONA 4WPYA 4P78A 4OOGC 2NUEA 2EN1A 1QU6A 5LMNE 2JY9A 4DR1E 1N34E 2GHFA 2EM6A 2YU8A 2YU5A 2JOBA 4WXDA 2UXBE 4IS1C 3EPJA 2V87A 4DUZE 1N33E 4Q28A 1MEYC 2ELYA 2EMWA 2N8XA 1AAYA 2LE2A 2EOSA 4M30A 4DV0E 2NABA 3K6QA 2EPMX 1GQEA 4AQYE 2L3JA 2LJHA 3BF2A 4DV4E 4DKKA 4F9BB 3EPKA 2EPAA 2L92A 2YWQA 3L00A 4BHBA 2YZTA 2M1SA 2EOEA 5TSEA 1EH6A 1JK1A 4B3ME 4NXNE 3IWDA 1G2FC 3IWCA 1PJQA 4R03A 2YTNA 1A1LA 2RS6A 3DJWA 4O5GA 4RHBB 2EM7A 1WXRA 2V88A 4LF4E 3T1HE 2EN4A 2KHXA 4X8WA 2EMIA 1BBOA 2FGGA 1DGCA 5IXMB 2ZM6E 4JV5E 2EN7A 5A6JA 2CT1A 1NCSA 2EN3A 3JAMC 4R8OA 1B69A 1X3CA 2EMCA 2YSPA 2EOFA 3BGHA 4OX9E 1FJGE 5T6JA 1T4LB 2M9AA 2EPKX 4DR5E 1PKPA 2V85A 1UN6B 1UHZA 1YZ9A 5KL6A 4NHRA 2EE8A 4JI8E 4O4KA 2B3TB 4X9JA 4M0VA 1L4SA 2EOJA 2V89A 3KZZA 1YYWA 1SFEA 1G2DC 2EMKA 2EL6A 3EPHA 2ODRD 4F6NA 4WSPA 3BIDA 4JYAE 2GLIA 4BC9A 5AE1A 1HNXE 1ZR9A 2E5LE 4BCAA 1WHNA 1MGTA 4RH8A 1XMOE 2WBUA 5A2QC 4DR4E 2YTJA 3THOB 3RMPA 1I94E 2WBSA 1KJKA 2FTXB 2L33A 2EOYA 1HR0E 4DR2E 1A1JA 2EM2A 4BBYA 2EPUA 3VYYA 1A1GA 2N3HA 3MHSC 4LF5E 2VF1A 3AV0A 2YTEA 4GZNC 2DGCA 2JR1A 2EMGA 4YHHE 2MKDA 2L2KB 2EN8A 2NA2A 4JI5E 2EOZA 4X62E 5BR8E 5A6AA 2UUBE 2YTPA 5KL7A 2UXDE 1IQOA 2EQ1A 2YRMA 4X64E 1ZU1A 3LMLA 2EM3A 1IBLE 2M4IA 2YSOA 2CPNA 1HNWE 1NEIA 2MC5A 2GPIA 5AE2A 5ADZA 3HPSA 4MLVA 2BB8A 2EZ6A 4O24A 4JI2E 1X6FA 4JI4E 2RS7A 2DMYA 4LTYA 4F9CB 4NZVA 2CSHA 2BBGA 4GEQB 2L3CA 2JP9A 1X49A 3HTXA 1YUJA 2EOOA 3TQMA 2UUAE 2G7HA 3ECRA 2DRPA 4DV5E 1PJSA 2V83A 2UUCE 2HHHE 1PJTA 2EM9A 1IMUA 3AUZA 1QNTA 2K7IA 1Z1BA 2I13A 3MSWA 2E1MA 2JWOA 4F2JC 2EMHA 3KZYA 1F2IG 2V8QB 1TF6A 3C6KA 4WXCA 4YY3E 1AH5A 4BC7A 2LO3A 2YPNA 2EPXA 2EPCA 4BHCA 1WRJA 1J5EE 1J26A 2L2MA 4DUYE 4DV7E 2PRTA 1SR9A 2EPPA 2EMZA 2A25A 5KL2A 2EQ3A 2J7JA 1T38A 2MDRA 2B9DA 2EPNA 4JI1E 2EP3A 2EMAA 4LF7E 4DMIA 2ELZA 2RTXA 5A6KA 1XMQE 4JI7E 1A1KA 2JPAA 4GKJE 4DR6E 1YFHA 3HPZA 3EPLA 2EOHA 2MDGA 4HTGA 2WZOA 2EMYA 1KYQA 1YYKA 1GZ6A 4NXME 3HQ1A 4LU9A 5KL3A 1N36E 2CTDA 4R2QA 4DV2E 3J81C 2DIXA 5AE3A
chains in the Genus database with same CATH topology
2EMGA 2YTQA 2EN2A 2EOIA 2MKDA 3EPKA 4F6MA 2EPAA 2EN8A 2EOMA 2EPRA 1A1HA 2RPCA 4R2PA 2EOZA 2YTPA 5KL7A 2EOEA 2EQ1A 2YRMA 4FK5C 1JK1A 1G2FC 1ZU1A 2EMFA 3VHTB 2EM3A 2YTNA 2ENCA 2YSOA 1A1LA 1WJPA 2EM0A 2MKNA 2EM7A 1A1IA 4IJDA 2EOXA 1JK2A 2BB8A 2EN4A 1X6FA 2EMIA 2ENHA 2RSIA 1BBOA 4R2CA 2YRKA 4R2SA 1DGCA 2CSHA 2YRHA 2EN7A 3UK3C 2CT1A 2JP9A 1YUJA 1NCSA 2EN3A 2EM4A 2EOOA 4R2AA 2LV2A 1P47A 2EORA 3M99B 1B69A 1X3CA 2EM5A 2EMCA 2E72A 2YSPA 2DRPA 2YTFA 1LLMC 2EOFA 4M9VC 2D9HA 2DLQA 2M9AA 2EM9A 1UN6B 2ADRA 5KL6A 2EE8A 2EN6A 1Z1BA 1YUIA 4X9JA 2I13A 1A1FA 2EOJA 4F2JC 2EMHA 4WSGA 2ENAA 1G2DC 4R2DA 2VRDA 4R2RA 1F2IG 1X5WA 2EPZA 1X6EA 2DMIA 2EMKA 2EL6A 2YTOA 5KL5A 1TF6A 3EPHA 1TN9A 4F6NA 2LO3A 2EPXA 2HGHA 2EPCA 2YTGA 2GLIA 2WCC3 1RMDA 1ZAAC 2EMXA 1X6HA 1ZR9A 2PRTA 1YSAC 2EM8A 2EPPA 2EQ0A 1TF3A 2YTDA 2EOQA 2EMZA 2EJ4A 2R1FA 1BB8A 2EMBA 2A25A 5KL2A 2EQ3A 2J7JA 2WBUA 2YTJA 1UBDC 2EP3A 2EMAA 2LT7A 2WBSA 2ELZA 1A1KA 2EN1A 1KJKA 2EL4A 2JPAA 3MHHC 2EOYA 2GHFA 2EM6A 2LVHA 2YU8A 2EM2A 1A1JA 2YU5A 2EPUA 3EPLA 4IS1C 2EOHA 2MDGA 5KL4A 4R2EA 3EPJA 2EMYA 2LCEA 1MEYC 2ELYA 1A1GA 2EL5A 2EMWA 1AAYA 2EMLA 3MHSC 2EOSA 2NABA 2YTIA 5KL3A 2DLKA 2CTDA 2YTEA 4R2QA 2WBTA 4GZNC 2DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMG A;  2YTQ A;  2EN2 A;  2EOI A;  2MKD A;  3EPK A;  4F6M A;  2EPA A;  2EN8 A;  2EOM A;  2EPR A;  1A1H A;  2RPC A;  4R2P A;  2EOZ A;  2YTP A;  5KL7 A;  2EOE A;  2EQ1 A;  2YRM A;  4FK5 C;  1JK1 A;  1G2F C;  1ZU1 A;  2EMF A;  3VHT B;  2EM3 A;  2YTN A;  2ENC A;  2YSO A;  1A1L A;  1WJP A;  2EM0 A;  2MKN A;  2EM7 A;  1A1I A;  4IJD A;  2EOX A;  1JK2 A;  2BB8 A;  2EN4 A;  1X6F A;  2EMI A;  2ENH A;  2RSI A;  1BBO A;  4R2C A;  2YRK A;  4R2S A;  1DGC A;  2CSH A;  2YRH A;  2EN7 A;  3UK3 C;  2CT1 A;  2JP9 A;  1YUJ A;  1NCS A;  2EN3 A;  2EM4 A;  2EOO A;  4R2A A;  2LV2 A;  1P47 A;  2EOR A;  3M99 B;  1B69 A;  1X3C A;  2EM5 A;  2EMC A;  2E72 A;  2YSP A;  2DRP A;  2YTF A;  1LLM C;  2EOF A;  4M9V C;  2D9H A;  2DLQ A;  2M9A A;  2EM9 A;  1UN6 B;  2ADR A;  5KL6 A;  2EE8 A;  2EN6 A;  1Z1B A;  1YUI A;  4X9J A;  2I13 A;  1A1F A;  2EOJ A;  4F2J C;  2EMH A;  4WSG A;  2ENA A;  1G2D C;  4R2D A;  2VRD A;  4R2R A;  1F2I G;  1X5W A;  2EPZ A;  1X6E A;  2DMI A;  2EMK A;  2EL6 A;  2YTO A;  5KL5 A;  1TF6 A;  3EPH A;  1TN9 A;  4F6N A;  2LO3 A;  2EPX A;  2HGH A;  2EPC A;  2YTG A;  2GLI A;  2WCC 3;  1RMD A;  1ZAA C;  2EMX A;  1X6H A;  1ZR9 A;  2PRT A;  1YSA C;  2EM8 A;  2EPP A;  2EQ0 A;  1TF3 A;  2YTD A;  2EOQ A;  2EMZ A;  2EJ4 A;  2R1F A;  1BB8 A;  2EMB A;  2A25 A;  5KL2 A;  2EQ3 A;  2J7J A;  2WBU A;  2YTJ A;  1UBD C;  2EP3 A;  2EMA A;  2LT7 A;  2WBS A;  2ELZ A;  1A1K A;  2EN1 A;  1KJK A;  2EL4 A;  2JPA A;  3MHH C;  2EOY A;  2GHF A;  2EM6 A;  2LVH A;  2YU8 A;  2EM2 A;  1A1J A;  2YU5 A;  2EPU A;  3EPL A;  4IS1 C;  2EOH A;  2MDG A;  5KL4 A;  4R2E A;  3EPJ A;  2EMY A;  2LCE A;  1MEY C;  2ELY A;  1A1G A;  2EL5 A;  2EMW A;  1AAY A;  2EML A;  3MHS C;  2EOS A;  2NAB A;  2YTI A;  5KL3 A;  2DLK A;  2CTD A;  2YTE A;  4R2Q A;  2WBT A;  4GZN C;  2DGC A; 
#chains in the Genus database with same CATH topology
 5FLX C;  2YTQ A;  5IWA E;  4DV1 E;  2EOM A;  4Q35 B;  2Q8U A;  3IWB A;  3C4T A;  2VQE E;  5A6B A;  4FK5 C;  4KHP E;  1GTK A;  4X65 E;  3VHT B;  4F54 A;  2LTS A;  1WJP A;  2EM0 A;  1X48 A;  2JYA A;  1A1I A;  4IJD A;  4LF6 E;  3T1Y E;  4DV3 E;  4L5N C;  2B7T A;  4LFA E;  5A69 A;  1JK2 A;  2F8B A;  5LLQ A;  3J80 C;  2I9I A;  3C4B A;  4WYQ B;  2ENH A;  2DB2 A;  2YRK A;  2L2N A;  3BBG A;  4O43 A;  2R76 A;  3UK3 C;  1XNR E;  3P1X A;  2L6M A;  4BS9 A;  4R2A A;  2K4V A;  3ADL A;  5IT9 C;  2NUG A;  2LV2 A;  1P47 A;  4B3R E;  4B3T E;  2LTR A;  2E72 A;  3LLH A;  3H09 A;  3VYX A;  1STU A;  4M9V C;  2D9H A;  4J8Z A;  1X47 A;  5AC5 A;  2ADR A;  3QG5 C;  3ADG A;  4LFB E;  2EN6 A;  1EH8 A;  2RSM A;  2B7V A;  2JOX A;  5A6B D;  4WSG A;  2ENA A;  2UU9 E;  4WX9 A;  2VRD A;  2FV4 B;  1X5W A;  1X6E A;  2DMI A;  2EPZ A;  2RQL A;  2YTO A;  4LFC E;  1PDA A;  2VE7 C;  2VQF E;  2YTG A;  1FKA E;  3EQ1 A;  1RMD A;  2EMX A;  2LBS B;  2EPO A;  3F6G A;  1YSA C;  5DNY A;  5AC4 A;  1TF3 A;  2EWL A;  2EJ4 A;  2R1F A;  4HEI A;  2EMB A;  1BB8 A;  3THN A;  2KOU A;  2DSY A;  4JI3 E;  3J7Y p;  4DV6 E;  3ADJ A;  3ZOQ B;  2LT7 A;  5AAS A;  2LMZ A;  2EL4 A;  3MHH C;  4KWY A;  4N4R B;  2LVH A;  2F4V E;  2LRS A;  2V86 A;  5KL4 A;  4R2E A;  4ZYE A;  2LCE A;  1DQ3 A;  2EL5 A;  4K0K E;  3F6H A;  2EML A;  1XNQ E;  2YTI A;  2H36 X;  3ADI A;  2IHR 1;  4I8O A;  2DLK A;  2WBT A;  1YPN A;  4LF9 E;  4KZS A;  2LUP B;  2EN2 A;  4ZYG A;  2HC5 A;  1RC7 A;  2EOI A;  1A1H A;  4F6M A;  3C6M A;  2EPR A;  2RPC A;  3OML A;  4R2P A;  3HXL A;  4P7D A;  3VK6 A;  4TUG A;  5IV8 B;  1HNZ E;  2EMF A;  4MLQ A;  1T4N A;  2ENC A;  2MKN A;  1RQ0 A;  2EOX A;  4F9A B;  3OTO E;  4DR7 E;  4JI6 E;  4B3S E;  1T4O A;  1BBG A;  1YYO A;  2RSI A;  1T39 A;  2N3G A;  4R2C A;  4M2Z A;  4R2S A;  2YRH A;  2M7Q A;  1WHQ A;  1ZBT A;  4ZYH A;  2NUF A;  3FIG A;  1O0W A;  2EM4 A;  1EH7 A;  3DF6 A;  2EOR A;  3M99 B;  1UIL A;  1IBM E;  2UXC E;  2EM5 A;  2ODR C;  2YTF A;  1LLM C;  4WFT A;  5LMU E;  1IBK E;  2HJJ A;  2DLQ A;  2JXP A;  1EKZ A;  4GKK E;  3J7A G;  4JI0 E;  2L8T A;  4LF8 E;  1YUI A;  3KWR A;  1A1F A;  4ZYD A;  1N32 E;  4R2D A;  4R2R A;  4TUI A;  5KL5 A;  1TN9 A;  4DR3 E;  2HGH A;  2LUQ A;  2EPL X;  3JTZ A;  2WCC 3;  1ZAA C;  1X6H A;  5LL6 R;  4BMJ A;  1ZBQ A;  5F3W A;  1DI2 A;  2EM8 A;  4X66 E;  2JVA A;  2EQ0 A;  2YTD A;  2EOQ A;  4L8N A;  2LJU A;  2YT4 A;  1N3G A;  1IQS A;  5CFF E;  3JU0 A;  2MC6 A;  1UBD C;  2KON A;  4WPY A;  4P78 A;  4OOG C;  2NUE A;  2EN1 A;  1QU6 A;  5LMN E;  2JY9 A;  4DR1 E;  1N34 E;  2GHF A;  2EM6 A;  2YU8 A;  2YU5 A;  2JOB A;  4WXD A;  2UXB E;  4IS1 C;  3EPJ A;  2V87 A;  4DUZ E;  1N33 E;  4Q28 A;  1MEY C;  2ELY A;  2EMW A;  2N8X A;  1AAY A;  2LE2 A;  2EOS A;  4M30 A;  4DV0 E;  2NAB A;  3K6Q A;  2EPM X;  1GQE A;  4AQY E;  2L3J A;  2LJH A;  3BF2 A;  4DV4 E;  4DKK A;  4F9B B;  3EPK A;  2EPA A;  2L92 A;  2YWQ A;  3L00 A;  4BHB A;  2YZT A;  2M1S A;  2EOE A;  5TSE A;  1EH6 A;  1JK1 A;  4B3M E;  4NXN E;  3IWD A;  1G2F C;  3IWC A;  1PJQ A;  4R03 A;  2YTN A;  1A1L A;  2RS6 A;  3DJW A;  4O5G A;  4RHB B;  2EM7 A;  1WXR A;  2V88 A;  4LF4 E;  3T1H E;  2EN4 A;  2KHX A;  4X8W A;  2EMI A;  1BBO A;  2FGG A;  1DGC A;  5IXM B;  2ZM6 E;  4JV5 E;  2EN7 A;  5A6J A;  2CT1 A;  1NCS A;  2EN3 A;  3JAM C;  4R8O A;  1B69 A;  1X3C A;  2EMC A;  2YSP A;  2EOF A;  3BGH A;  4OX9 E;  1FJG E;  5T6J A;  1T4L B;  2M9A A;  2EPK X;  4DR5 E;  1PKP A;  2V85 A;  1UN6 B;  1UHZ A;  1YZ9 A;  5KL6 A;  4NHR A;  2EE8 A;  4JI8 E;  4O4K A;  2B3T B;  4X9J A;  4M0V A;  1L4S A;  2EOJ A;  2V89 A;  3KZZ A;  1YYW A;  1SFE A;  1G2D C;  2EMK A;  2EL6 A;  3EPH A;  2ODR D;  4F6N A;  4WSP A;  3BID A;  4JYA E;  2GLI A;  4BC9 A;  5AE1 A;  1HNX E;  1ZR9 A;  2E5L E;  4BCA A;  1WHN A;  1MGT A;  4RH8 A;  1XMO E;  2WBU A;  5A2Q C;  4DR4 E;  2YTJ A;  3THO B;  3RMP A;  1I94 E;  2WBS A;  1KJK A;  2FTX B;  2L33 A;  2EOY A;  1HR0 E;  4DR2 E;  1A1J A;  2EM2 A;  4BBY A;  2EPU A;  3VYY A;  1A1G A;  2N3H A;  3MHS C;  4LF5 E;  2VF1 A;  3AV0 A;  2YTE A;  4GZN C;  2DGC A;  2JR1 A;  2EMG A;  4YHH E;  2MKD A;  2L2K B;  2EN8 A;  2NA2 A;  4JI5 E;  2EOZ A;  4X62 E;  5BR8 E;  5A6A A;  2UUB E;  2YTP A;  5KL7 A;  2UXD E;  1IQO A;  2EQ1 A;  2YRM A;  4X64 E;  1ZU1 A;  3LML A;  2EM3 A;  1IBL E;  2M4I A;  2YSO A;  2CPN A;  1HNW E;  1NEI A;  2MC5 A;  2GPI A;  5AE2 A;  5ADZ A;  3HPS A;  4MLV A;  2BB8 A;  2EZ6 A;  4O24 A;  4JI2 E;  1X6F A;  4JI4 E;  2RS7 A;  2DMY A;  4LTY A;  4F9C B;  4NZV A;  2CSH A;  2BBG A;  4GEQ B;  2L3C A;  2JP9 A;  1X49 A;  3HTX A;  1YUJ A;  2EOO A;  3TQM A;  2UUA E;  2G7H A;  3ECR A;  2DRP A;  4DV5 E;  1PJS A;  2V83 A;  2UUC E;  2HHH E;  1PJT A;  2EM9 A;  1IMU A;  3AUZ A;  1QNT A;  2K7I A;  1Z1B A;  2I13 A;  3MSW A;  2E1M A;  2JWO A;  4F2J C;  2EMH A;  3KZY A;  1F2I G;  2V8Q B;  1TF6 A;  3C6K A;  4WXC A;  4YY3 E;  1AH5 A;  4BC7 A;  2LO3 A;  2YPN A;  2EPX A;  2EPC A;  4BHC A;  1WRJ A;  1J5E E;  1J26 A;  2L2M A;  4DUY E;  4DV7 E;  2PRT A;  1SR9 A;  2EPP A;  2EMZ A;  2A25 A;  5KL2 A;  2EQ3 A;  2J7J A;  1T38 A;  2MDR A;  2B9D A;  2EPN A;  4JI1 E;  2EP3 A;  2EMA A;  4LF7 E;  4DMI A;  2ELZ A;  2RTX A;  5A6K A;  1XMQ E;  4JI7 E;  1A1K A;  2JPA A;  4GKJ E;  4DR6 E;  1YFH A;  3HPZ A;  3EPL A;  2EOH A;  2MDG A;  4HTG A;  2WZO A;  2EMY A;  1KYQ A;  1YYK A;  1GZ6 A;  4NXM E;  3HQ1 A;  4LU9 A;  5KL3 A;  1N36 E;  2CTD A;  4R2Q A;  4DV2 E;  3J81 C;  2DIX A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 2EMG A;  2YTQ A;  2EN2 A;  2EOI A;  2MKD A;  3EPK A;  4F6M A;  2EPA A;  2EN8 A;  2EOM A;  2EPR A;  1A1H A;  2RPC A;  4R2P A;  2EOZ A;  2YTP A;  5KL7 A;  2EOE A;  2EQ1 A;  2YRM A;  4FK5 C;  1JK1 A;  1G2F C;  1ZU1 A;  2EMF A;  3VHT B;  2EM3 A;  2YTN A;  2ENC A;  2YSO A;  1A1L A;  1WJP A;  2EM0 A;  2MKN A;  2EM7 A;  1A1I A;  4IJD A;  2EOX A;  1JK2 A;  2BB8 A;  2EN4 A;  1X6F A;  2EMI A;  2ENH A;  2RSI A;  1BBO A;  4R2C A;  2YRK A;  4R2S A;  1DGC A;  2CSH A;  2YRH A;  2EN7 A;  3UK3 C;  2CT1 A;  2JP9 A;  1YUJ A;  1NCS A;  2EN3 A;  2EM4 A;  2EOO A;  4R2A A;  2LV2 A;  1P47 A;  2EOR A;  3M99 B;  1B69 A;  1X3C A;  2EM5 A;  2EMC A;  2E72 A;  2YSP A;  2DRP A;  2YTF A;  1LLM C;  2EOF A;  4M9V C;  2D9H A;  2DLQ A;  2M9A A;  2EM9 A;  1UN6 B;  2ADR A;  5KL6 A;  2EE8 A;  2EN6 A;  1Z1B A;  1YUI A;  4X9J A;  2I13 A;  1A1F A;  2EOJ A;  4F2J C;  2EMH A;  4WSG A;  2ENA A;  1G2D C;  4R2D A;  2VRD A;  4R2R A;  1F2I G;  1X5W A;  2EPZ A;  1X6E A;  2DMI A;  2EMK A;  2EL6 A;  2YTO A;  5KL5 A;  1TF6 A;  3EPH A;  1TN9 A;  4F6N A;  2LO3 A;  2EPX A;  2HGH A;  2EPC A;  2YTG A;  2GLI A;  2WCC 3;  1RMD A;  1ZAA C;  2EMX A;  1X6H A;  1ZR9 A;  2PRT A;  1YSA C;  2EM8 A;  2EPP A;  2EQ0 A;  1TF3 A;  2YTD A;  2EOQ A;  2EMZ A;  2EJ4 A;  2R1F A;  1BB8 A;  2EMB A;  2A25 A;  5KL2 A;  2EQ3 A;  2J7J A;  2WBU A;  2YTJ A;  1UBD C;  2EP3 A;  2EMA A;  2LT7 A;  2WBS A;  2ELZ A;  1A1K A;  2EN1 A;  1KJK A;  2EL4 A;  2JPA A;  3MHH C;  2EOY A;  2GHF A;  2EM6 A;  2LVH A;  2YU8 A;  2EM2 A;  1A1J A;  2YU5 A;  2EPU A;  3EPL A;  4IS1 C;  2EOH A;  2MDG A;  5KL4 A;  4R2E A;  3EPJ A;  2EMY A;  2LCE A;  1MEY C;  2ELY A;  1A1G A;  2EL5 A;  2EMW A;  1AAY A;  2EML A;  3MHS C;  2EOS A;  2NAB A;  2YTI A;  5KL3 A;  2DLK A;  2CTD A;  2YTE A;  4R2Q A;  2WBT A;  4GZN C;  2DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...