2MDGA

Solution nmr structure of zinc finger protein 423 from homo sapiens, northeast structural genomics consortium (nesg) target hr7298f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 423
publication title Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mdgA00
4M9VC 2RPCA 3VHTB 2YTDA 2ELYA 5KL3A 2YTQA 2EMWA 1A1IA 2EPZA 1A1LA 2WBTA 2A25A 1Z1BA 2EOMA 2YU8A 2LVHA 2EMAA 2EPCA 2YTGA 2D9HA 5KL5A 2ENHA 2YRMA 2EOJA 2EMHA 5KL6A 2LT7A 1B69A 2EP3A 2MKDA 1A1GA 2YRHA 2EMBA 2J7JA 2EN3A 2DLQA 2EQ1A 1MEYC 3EPHA 2EQ0A 1A1HA 4R2PA 4R2RA 4GZNC 2NABA 2EOZA 1WJPA 2R1FA 1G2DC 2YTFA 2YTNA 2EPPA 2DLKA 2EM0A 1UBDC 1NCSA 2CSHA 2ENCA 4R2QA 2YTIA 3MHSC 2EM6A 2LO3A 2YSOA 1TN9A 2MKNA 4F6NA 5KL7A 2EMKA 2EM4A 2ELZA 1A1FA 2GLIA 3M99B 4IJDA 2YRKA 2JP9A 1X6HA 2DRPA 1X5WA 3EPKA 2EN7A 1P47A 2EMXA 1X6FA 2MDGA 2EMGA 2EPRA 4R2SA 2EOSA 5KL4A 1X3CA 2EMLA 2BB8A 2VRDA 4X9JA 2E72A 2EN8A 2RSIA 5KL2A 2EORA 2EM3A 4R2DA 1DGCA 1AAYA 2EOFA 2YTOA 2DMIA 4WSGA 2EL4A 3MHHC 2ENAA 2EOIA 1RMDA 2ADRA 2EM2A 4FK5C 2EM9A 3EPLA 2PRTA 2EM7A 2EN2A 2EPXA 1A1KA 4R2CA 1UN6B 2EN4A 2EOXA 4R2AA 2WCC3 4F6MA 1LLMC 1ZR9A 2EOOA 2EOYA 2EN6A 4IS1C 2DGCA 2WBSA 2EL5A 4R2EA 2EE8A 1TF6A 1YUIA 4F2JC 1G2FC 1KJKA 2YTEA 1TF3A 2EMZA 2EM8A 2GHFA 2EOHA 3EPJA 2EPUA 2CT1A 1BB8A 1F2IG 2EQ3A 2HGHA 1JK1A 1YUJA 1X6EA 2CTDA 2LCEA 2I13A 2LV2A 2EOEA 1ZU1A 2JPAA 1A1JA 2EMFA 2YSPA 1YSAC 2WBUA 2M9AA 2EMYA 2EM5A 2EL6A 2EMIA 2EOQA 2YTPA 1ZAAC 2EN1A 2EPAA 2YTJA 3UK3C 2EJ4A 2YU5A 2EMCA 1JK2A 1BBOA
chains in the Genus database with same CATH superfamily
3C6MA 2RPCA 4J8ZA 2ELYA 1A1LA 5AE1A 2LJHA 3EQ1A 1DI2A 2A25A 2V88A 2EOMA 1XNRE 2VF1A 2YTGA 3JAMC 2ENHA 3BGHA 4K0KE 3F6GA 2JR1A 3LLHA 1B69A 2EPMX 4NXNE 3HTXA 1IQOA 3ADGA 1MEYC 2VQFE 1A1HA 4WFTA 2EOZA 1WJPA 3OTOE 3T1HE 4ZYHA 2DLKA 2R76A 2B3TB 2BBGA 4R2QA 2YTIA 4O24A 4DV0E 4AQYE 2EM6A 2MC5A 1TN9A 1A1FA 2ELZA 4NXME 2GLIA 3M99B 4IJDA 2JYAA 2LTSA 1X6HA 4F9AB 5A6KA 4DR4E 1X5WA 3EPKA 4WXDA 5LL6R 1N34E 1X6FA 3J81C 3DJWA 1WRJA 4R2SA 2YT4A 2BB8A 2VRDA 4LF4E 1X49A 2EPNA 2ODRC 1AAYA 4JI5E 2DMIA 1J5EE 1RQ0A 3BIDA 1IBKE 5AC5A 2H36X 5LMUE 2EM9A 4BMJA 4ZYDA 1PJSA 2L8TA 4R2CA 4DV3E 4DMIA 4BHCA 3JU0A 2L92A 4LFBE 3KWRA 1FJGE 2M4IA 1EKZA 3HPSA 1G2FC 2F4VE 3EPJA 2CT1A 4Q35B 1F2IG 2HGHA 4DV7E 1YUJA 2CTDA 3VK6A 1ZU1A 4LF6E 4BC7A 2M9AA 1MGTA 4P7DA 5TSEA 2V86A 1IBLE 2EPAA 2YTJA 3IWCA 3J7Yp 3IWBA 2B7VA 3C4BA 3K6QA 4BBYA 1IBME 1HNWE 1BBOA 4NZVA 1YYWA 3VHTB 4HTGA 1BBGA 1A1IA 5KL3A 2EMWA 2UXBE 4YY3E 3HQ1A 2YU8A 2E1MA 2LVHA 2EMAA 2G7HA 5A6JA 2EPOA 4N4RB 2EPCA 3AV0A 1FKAE 2L2MA 4X65E 2DMYA 4M0VA 5AC4A 2J7JA 2EN3A 2EQ1A 4DKKA 3ZOQB 1N36E 1UILA 1GZ6A 4RHBB 4BS9A 5AE2A 4JV5E 4R2PA 4GZNC 4X66E 3ECRA 2YZTA 2V87A 2R1FA 2YTNA 2HC5A 4MLVA 2UXDE 2LUPB 3BF2A 3L00A 1IQSA 2ENCA 2LUQA 4MLQA 3MHSC 4DV2E 4LU9A 2MKNA 4BHBA 4F9CB 1I94E 5KL7A 1DQ3A 2EMKA 1WXRA 2EM4A 4GKJE 4M30A 1HR0E 3F6HA 5CFFE 2JP9A 2YRKA 2RS7A 4ZYEA 4DR7E 2EN7A 4WSPA 2EMXA 4GEQB 4JI0E 1N3GA 2MDGA 2EMGA 1T38A 3QG5C 4M2ZA 1KYQA 2MDRA 1X3CA 2DSYA 2EMLA 4X9JA 2JY9A 2L33A 1YYKA 2RSIA 1YFHA 4P78A 4RH8A 4B3SE 2EM2A 1EH6A 4FK5C 4B3ME 5LMNE 4I8OA 2N3HA 1UN6B 2I9IA 1J26A 5A6BA 2WCC3 4DV5E 2LE2A 1YYOA 5BR8E 3C4TA 2RTXA 2LMZA 5AE3A 1X48A 4IS1C 2WBSA 1XMQE 1IMUA 4R2EA 4DR2E 1TF6A 4F2JC 4OX9E 2YTEA 3P1XA 2Q8UA 1TF3A 3KZZA 2KONA 3KZYA 4DR5E 4LF5E 4NHRA 3VYXA 2UXCE 1JK1A 4R8OA 3H09A 2LCEA 5A6BD 2EOEA 2YSPA 2YWQA 1YSAC 3IWDA 3VYYA 4JI7E 4ZYGA 2WZOA 3DF6A 2EJ4A 4O5GA 2GPIA 1JK2A 4M9VC 1HNXE 4WX9A 1YPNA 2V89A 3T1YE 2YTQA 4LFCE 4O43A 4L5NC 4O4KA 1PJQA 1Z1BA 4DR3E 2L3CA 2DB2A 3C6KA 5KL5A 3ADJA 4X8WA 2EMHA 2LJUA 2MKDA 5A2QC 2YRHA 4JI8E 2DLQA 1L4SA 3ADLA 2EQ0A 4R2RA 4L8NA 2NABA 2EPPA 2LBSB 5IT9C 2KHXA 1EH8A 2EM0A 1UBDC 2V8QB 1T4OA 1WHQA 5IWAE 4F6NA 4TUGA 5F3WA 4X62E 1P47A 4KHPE 5A6AA 1SR9A 2EPRA 2EOSA 1GQEA 1PDAA 2UUCE 2E72A 2EN8A 3BBGA 4DUYE 2EM3A 2YTOA 4WSGA 2EL4A 5DNYA 4DV4E 3HXLA 2UU9E 2EOIA 1RMDA 2ADRA 2MC6A 1NEIA 2IHR1 2PRTA 2EM7A 2E5LE 2EPXA 3ADIA 2N8XA 2EOXA 3FIGA 3MSWA 4R2AA 1LLMC 1ZR9A 2YPNA 2EOOA 2K7IA 1EH7A 2EOYA 2EN6A 2ODRD 5ADZA 2DGCA 2EL5A 2V83A 1GTKA 3J7AG 4WYQB 4LF8E 1YUIA 1KJKA 3THNA 4R03A 2L3JA 2GHFA 4YHHE 1N33E 4JYAE 2EPUA 2UUAE 3JTZA 2FTXB 1XMOE 1X6EA 4WPYA 2I13A 2LV2A 2NA2A 4KZSA 4BC9A 2L2NA 2JPAA 4X64E 1A1JA 2F8BA 2WBUA 2NUGA 2V85A 2EMYA 3HPZA 2EM5A 2EPKX 3OMLA 1WHNA 2L6MA 2EOQA 2M7QA 3UK3C 3AUZA 2YU5A 2RQLA 2UUBE 4LF9E 1YZ9A 1T39A 2YTDA 2FGGA 1QNTA 2EPZA 2WBTA 2M1SA 4WXCA 4HEIA 2L2KB 2D9HA 1O0WA 2RSMA 2YRMA 2EOJA 1ZBQA 5KL6A 2LT7A 2JVAA 2LRSA 2EP3A 1A1GA 2NUFA 2EMBA 2EPLX 1X47A 2CPNA 2N3GA 1HNZE 3EPHA 2ZM6E 4KWYA 4B3RE 4DUZE 5AASA 2YTFA 1G2DC 2KOUA 4BCAA 1NCSA 2CSHA 4B3TE 2LO3A 2YSOA 2DIXA 1T4NA 2HJJA 4DR1E 2DRPA 5A69A 4LF7E 4LFAE 2LTRA 2VE7C 4F54A 1SFEA 5KL4A 5IXMB 2FV4B 2JOXA 5KL2A 2K4VA 2EORA 4R2DA 4DR6E 1DGCA 1QU6A 2JOBA 2EOFA 1XNQE 3MHHC 3THOB 2NUEA 1N32E 2ENAA 1UHZA 3LMLA 4JI1E 5LLQA 3EPLA 2EN2A 4DV1E 1A1KA 4JI4E 2EN4A 4F9BB 4GKKE 4F6MA 2B9DA 4DV6E 3TQMA 1AH5A 2EZ6A 2EE8A 2HHHE 2EMZA 1ZBTA 4JI2E 2EM8A 2EOHA 2B7TA 2VQEE 1BB8A 2EQ3A 2EWLA 4OOGC 1PJTA 2JWOA 1STUA 5FLXC 5IV8B 4Q28A 2EMFA 3RMPA 4JI3E 2EL6A 2EMIA 3J80C 2YTPA 4LTYA 1ZAAC 2EN1A 1PKPA 1T4LB 1RC7A 2JXPA 4TUIA 4JI6E 2EMCA 2RS6A 5T6JA
chains in the Genus database with same CATH topology
4M9VC 2RPCA 3VHTB 2YTDA 2ELYA 5KL3A 2YTQA 2EMWA 1A1IA 2EPZA 1A1LA 2WBTA 2A25A 1Z1BA 2EOMA 2YU8A 2LVHA 2EMAA 2EPCA 2YTGA 2D9HA 5KL5A 2ENHA 2YRMA 2EOJA 2EMHA 5KL6A 2LT7A 1B69A 2EP3A 2MKDA 1A1GA 2YRHA 2EMBA 2J7JA 2EN3A 2DLQA 2EQ1A 1MEYC 3EPHA 2EQ0A 1A1HA 4R2PA 4R2RA 4GZNC 2NABA 2EOZA 1WJPA 2R1FA 1G2DC 2YTFA 2YTNA 2EPPA 2DLKA 2EM0A 1UBDC 1NCSA 2CSHA 2ENCA 4R2QA 2YTIA 3MHSC 2EM6A 2LO3A 2YSOA 1TN9A 2MKNA 4F6NA 5KL7A 2EMKA 2EM4A 2ELZA 1A1FA 2GLIA 3M99B 4IJDA 2YRKA 2JP9A 1X6HA 2DRPA 1X5WA 3EPKA 2EN7A 1P47A 2EMXA 1X6FA 2MDGA 2EMGA 2EPRA 4R2SA 2EOSA 5KL4A 1X3CA 2EMLA 2BB8A 2VRDA 4X9JA 2E72A 2EN8A 2RSIA 5KL2A 2EORA 2EM3A 4R2DA 1DGCA 1AAYA 2EOFA 2YTOA 2DMIA 4WSGA 2EL4A 3MHHC 2ENAA 2EOIA 1RMDA 2ADRA 2EM2A 4FK5C 2EM9A 3EPLA 2PRTA 2EM7A 2EN2A 2EPXA 1A1KA 4R2CA 1UN6B 2EN4A 2EOXA 4R2AA 2WCC3 4F6MA 1LLMC 1ZR9A 2EOOA 2EOYA 2EN6A 4IS1C 2DGCA 2WBSA 2EL5A 4R2EA 2EE8A 1TF6A 1YUIA 4F2JC 1G2FC 1KJKA 2YTEA 1TF3A 2EMZA 2EM8A 2GHFA 2EOHA 3EPJA 2EPUA 2CT1A 1BB8A 1F2IG 2EQ3A 2HGHA 1JK1A 1YUJA 1X6EA 2CTDA 2LCEA 2I13A 2LV2A 2EOEA 1ZU1A 2JPAA 1A1JA 2EMFA 2YSPA 1YSAC 2WBUA 2M9AA 2EMYA 2EM5A 2EL6A 2EMIA 2EOQA 2YTPA 1ZAAC 2EN1A 2EPAA 2YTJA 3UK3C 2EJ4A 2YU5A 2EMCA 1JK2A 1BBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9V C;  2RPC A;  3VHT B;  2YTD A;  2ELY A;  5KL3 A;  2YTQ A;  2EMW A;  1A1I A;  2EPZ A;  1A1L A;  2WBT A;  2A25 A;  1Z1B A;  2EOM A;  2YU8 A;  2LVH A;  2EMA A;  2EPC A;  2YTG A;  2D9H A;  5KL5 A;  2ENH A;  2YRM A;  2EOJ A;  2EMH A;  5KL6 A;  2LT7 A;  1B69 A;  2EP3 A;  2MKD A;  1A1G A;  2YRH A;  2EMB A;  2J7J A;  2EN3 A;  2DLQ A;  2EQ1 A;  1MEY C;  3EPH A;  2EQ0 A;  1A1H A;  4R2P A;  4R2R A;  4GZN C;  2NAB A;  2EOZ A;  1WJP A;  2R1F A;  1G2D C;  2YTF A;  2YTN A;  2EPP A;  2DLK A;  2EM0 A;  1UBD C;  1NCS A;  2CSH A;  2ENC A;  4R2Q A;  2YTI A;  3MHS C;  2EM6 A;  2LO3 A;  2YSO A;  1TN9 A;  2MKN A;  4F6N A;  5KL7 A;  2EMK A;  2EM4 A;  2ELZ A;  1A1F A;  2GLI A;  3M99 B;  4IJD A;  2YRK A;  2JP9 A;  1X6H A;  2DRP A;  1X5W A;  3EPK A;  2EN7 A;  1P47 A;  2EMX A;  1X6F A;  2MDG A;  2EMG A;  2EPR A;  4R2S A;  2EOS A;  5KL4 A;  1X3C A;  2EML A;  2BB8 A;  2VRD A;  4X9J A;  2E72 A;  2EN8 A;  2RSI A;  5KL2 A;  2EOR A;  2EM3 A;  4R2D A;  1DGC A;  1AAY A;  2EOF A;  2YTO A;  2DMI A;  4WSG A;  2EL4 A;  3MHH C;  2ENA A;  2EOI A;  1RMD A;  2ADR A;  2EM2 A;  4FK5 C;  2EM9 A;  3EPL A;  2PRT A;  2EM7 A;  2EN2 A;  2EPX A;  1A1K A;  4R2C A;  1UN6 B;  2EN4 A;  2EOX A;  4R2A A;  2WCC 3;  4F6M A;  1LLM C;  1ZR9 A;  2EOO A;  2EOY A;  2EN6 A;  4IS1 C;  2DGC A;  2WBS A;  2EL5 A;  4R2E A;  2EE8 A;  1TF6 A;  1YUI A;  4F2J C;  1G2F C;  1KJK A;  2YTE A;  1TF3 A;  2EMZ A;  2EM8 A;  2GHF A;  2EOH A;  3EPJ A;  2EPU A;  2CT1 A;  1BB8 A;  1F2I G;  2EQ3 A;  2HGH A;  1JK1 A;  1YUJ A;  1X6E A;  2CTD A;  2LCE A;  2I13 A;  2LV2 A;  2EOE A;  1ZU1 A;  2JPA A;  1A1J A;  2EMF A;  2YSP A;  1YSA C;  2WBU A;  2M9A A;  2EMY A;  2EM5 A;  2EL6 A;  2EMI A;  2EOQ A;  2YTP A;  1ZAA C;  2EN1 A;  2EPA A;  2YTJ A;  3UK3 C;  2EJ4 A;  2YU5 A;  2EMC A;  1JK2 A;  1BBO A; 
#chains in the Genus database with same CATH topology
 3C6M A;  2RPC A;  4J8Z A;  2ELY A;  1A1L A;  5AE1 A;  2LJH A;  3EQ1 A;  1DI2 A;  2A25 A;  2V88 A;  2EOM A;  1XNR E;  2VF1 A;  2YTG A;  3JAM C;  2ENH A;  3BGH A;  4K0K E;  3F6G A;  2JR1 A;  3LLH A;  1B69 A;  2EPM X;  4NXN E;  3HTX A;  1IQO A;  3ADG A;  1MEY C;  2VQF E;  1A1H A;  4WFT A;  2EOZ A;  1WJP A;  3OTO E;  3T1H E;  4ZYH A;  2DLK A;  2R76 A;  2B3T B;  2BBG A;  4R2Q A;  2YTI A;  4O24 A;  4DV0 E;  4AQY E;  2EM6 A;  2MC5 A;  1TN9 A;  1A1F A;  2ELZ A;  4NXM E;  2GLI A;  3M99 B;  4IJD A;  2JYA A;  2LTS A;  1X6H A;  4F9A B;  5A6K A;  4DR4 E;  1X5W A;  3EPK A;  4WXD A;  5LL6 R;  1N34 E;  1X6F A;  3J81 C;  3DJW A;  1WRJ A;  4R2S A;  2YT4 A;  2BB8 A;  2VRD A;  4LF4 E;  1X49 A;  2EPN A;  2ODR C;  1AAY A;  4JI5 E;  2DMI A;  1J5E E;  1RQ0 A;  3BID A;  1IBK E;  5AC5 A;  2H36 X;  5LMU E;  2EM9 A;  4BMJ A;  4ZYD A;  1PJS A;  2L8T A;  4R2C A;  4DV3 E;  4DMI A;  4BHC A;  3JU0 A;  2L92 A;  4LFB E;  3KWR A;  1FJG E;  2M4I A;  1EKZ A;  3HPS A;  1G2F C;  2F4V E;  3EPJ A;  2CT1 A;  4Q35 B;  1F2I G;  2HGH A;  4DV7 E;  1YUJ A;  2CTD A;  3VK6 A;  1ZU1 A;  4LF6 E;  4BC7 A;  2M9A A;  1MGT A;  4P7D A;  5TSE A;  2V86 A;  1IBL E;  2EPA A;  2YTJ A;  3IWC A;  3J7Y p;  3IWB A;  2B7V A;  3C4B A;  3K6Q A;  4BBY A;  1IBM E;  1HNW E;  1BBO A;  4NZV A;  1YYW A;  3VHT B;  4HTG A;  1BBG A;  1A1I A;  5KL3 A;  2EMW A;  2UXB E;  4YY3 E;  3HQ1 A;  2YU8 A;  2E1M A;  2LVH A;  2EMA A;  2G7H A;  5A6J A;  2EPO A;  4N4R B;  2EPC A;  3AV0 A;  1FKA E;  2L2M A;  4X65 E;  2DMY A;  4M0V A;  5AC4 A;  2J7J A;  2EN3 A;  2EQ1 A;  4DKK A;  3ZOQ B;  1N36 E;  1UIL A;  1GZ6 A;  4RHB B;  4BS9 A;  5AE2 A;  4JV5 E;  4R2P A;  4GZN C;  4X66 E;  3ECR A;  2YZT A;  2V87 A;  2R1F A;  2YTN A;  2HC5 A;  4MLV A;  2UXD E;  2LUP B;  3BF2 A;  3L00 A;  1IQS A;  2ENC A;  2LUQ A;  4MLQ A;  3MHS C;  4DV2 E;  4LU9 A;  2MKN A;  4BHB A;  4F9C B;  1I94 E;  5KL7 A;  1DQ3 A;  2EMK A;  1WXR A;  2EM4 A;  4GKJ E;  4M30 A;  1HR0 E;  3F6H A;  5CFF E;  2JP9 A;  2YRK A;  2RS7 A;  4ZYE A;  4DR7 E;  2EN7 A;  4WSP A;  2EMX A;  4GEQ B;  4JI0 E;  1N3G A;  2MDG A;  2EMG A;  1T38 A;  3QG5 C;  4M2Z A;  1KYQ A;  2MDR A;  1X3C A;  2DSY A;  2EML A;  4X9J A;  2JY9 A;  2L33 A;  1YYK A;  2RSI A;  1YFH A;  4P78 A;  4RH8 A;  4B3S E;  2EM2 A;  1EH6 A;  4FK5 C;  4B3M E;  5LMN E;  4I8O A;  2N3H A;  1UN6 B;  2I9I A;  1J26 A;  5A6B A;  2WCC 3;  4DV5 E;  2LE2 A;  1YYO A;  5BR8 E;  3C4T A;  2RTX A;  2LMZ A;  5AE3 A;  1X48 A;  4IS1 C;  2WBS A;  1XMQ E;  1IMU A;  4R2E A;  4DR2 E;  1TF6 A;  4F2J C;  4OX9 E;  2YTE A;  3P1X A;  2Q8U A;  1TF3 A;  3KZZ A;  2KON A;  3KZY A;  4DR5 E;  4LF5 E;  4NHR A;  3VYX A;  2UXC E;  1JK1 A;  4R8O A;  3H09 A;  2LCE A;  5A6B D;  2EOE A;  2YSP A;  2YWQ A;  1YSA C;  3IWD A;  3VYY A;  4JI7 E;  4ZYG A;  2WZO A;  3DF6 A;  2EJ4 A;  4O5G A;  2GPI A;  1JK2 A;  4M9V C;  1HNX E;  4WX9 A;  1YPN A;  2V89 A;  3T1Y E;  2YTQ A;  4LFC E;  4O43 A;  4L5N C;  4O4K A;  1PJQ A;  1Z1B A;  4DR3 E;  2L3C A;  2DB2 A;  3C6K A;  5KL5 A;  3ADJ A;  4X8W A;  2EMH A;  2LJU A;  2MKD A;  5A2Q C;  2YRH A;  4JI8 E;  2DLQ A;  1L4S A;  3ADL A;  2EQ0 A;  4R2R A;  4L8N A;  2NAB A;  2EPP A;  2LBS B;  5IT9 C;  2KHX A;  1EH8 A;  2EM0 A;  1UBD C;  2V8Q B;  1T4O A;  1WHQ A;  5IWA E;  4F6N A;  4TUG A;  5F3W A;  4X62 E;  1P47 A;  4KHP E;  5A6A A;  1SR9 A;  2EPR A;  2EOS A;  1GQE A;  1PDA A;  2UUC E;  2E72 A;  2EN8 A;  3BBG A;  4DUY E;  2EM3 A;  2YTO A;  4WSG A;  2EL4 A;  5DNY A;  4DV4 E;  3HXL A;  2UU9 E;  2EOI A;  1RMD A;  2ADR A;  2MC6 A;  1NEI A;  2IHR 1;  2PRT A;  2EM7 A;  2E5L E;  2EPX A;  3ADI A;  2N8X A;  2EOX A;  3FIG A;  3MSW A;  4R2A A;  1LLM C;  1ZR9 A;  2YPN A;  2EOO A;  2K7I A;  1EH7 A;  2EOY A;  2EN6 A;  2ODR D;  5ADZ A;  2DGC A;  2EL5 A;  2V83 A;  1GTK A;  3J7A G;  4WYQ B;  4LF8 E;  1YUI A;  1KJK A;  3THN A;  4R03 A;  2L3J A;  2GHF A;  4YHH E;  1N33 E;  4JYA E;  2EPU A;  2UUA E;  3JTZ A;  2FTX B;  1XMO E;  1X6E A;  4WPY A;  2I13 A;  2LV2 A;  2NA2 A;  4KZS A;  4BC9 A;  2L2N A;  2JPA A;  4X64 E;  1A1J A;  2F8B A;  2WBU A;  2NUG A;  2V85 A;  2EMY A;  3HPZ A;  2EM5 A;  2EPK X;  3OML A;  1WHN A;  2L6M A;  2EOQ A;  2M7Q A;  3UK3 C;  3AUZ A;  2YU5 A;  2RQL A;  2UUB E;  4LF9 E;  1YZ9 A;  1T39 A;  2YTD A;  2FGG A;  1QNT A;  2EPZ A;  2WBT A;  2M1S A;  4WXC A;  4HEI A;  2L2K B;  2D9H A;  1O0W A;  2RSM A;  2YRM A;  2EOJ A;  1ZBQ A;  5KL6 A;  2LT7 A;  2JVA A;  2LRS A;  2EP3 A;  1A1G A;  2NUF A;  2EMB A;  2EPL X;  1X47 A;  2CPN A;  2N3G A;  1HNZ E;  3EPH A;  2ZM6 E;  4KWY A;  4B3R E;  4DUZ E;  5AAS A;  2YTF A;  1G2D C;  2KOU A;  4BCA A;  1NCS A;  2CSH A;  4B3T E;  2LO3 A;  2YSO A;  2DIX A;  1T4N A;  2HJJ A;  4DR1 E;  2DRP A;  5A69 A;  4LF7 E;  4LFA E;  2LTR A;  2VE7 C;  4F54 A;  1SFE A;  5KL4 A;  5IXM B;  2FV4 B;  2JOX A;  5KL2 A;  2K4V A;  2EOR A;  4R2D A;  4DR6 E;  1DGC A;  1QU6 A;  2JOB A;  2EOF A;  1XNQ E;  3MHH C;  3THO B;  2NUE A;  1N32 E;  2ENA A;  1UHZ A;  3LML A;  4JI1 E;  5LLQ A;  3EPL A;  2EN2 A;  4DV1 E;  1A1K A;  4JI4 E;  2EN4 A;  4F9B B;  4GKK E;  4F6M A;  2B9D A;  4DV6 E;  3TQM A;  1AH5 A;  2EZ6 A;  2EE8 A;  2HHH E;  2EMZ A;  1ZBT A;  4JI2 E;  2EM8 A;  2EOH A;  2B7T A;  2VQE E;  1BB8 A;  2EQ3 A;  2EWL A;  4OOG C;  1PJT A;  2JWO A;  1STU A;  5FLX C;  5IV8 B;  4Q28 A;  2EMF A;  3RMP A;  4JI3 E;  2EL6 A;  2EMI A;  3J80 C;  2YTP A;  4LTY A;  1ZAA C;  2EN1 A;  1PKP A;  1T4L B;  1RC7 A;  2JXP A;  4TUI A;  4JI6 E;  2EMC A;  2RS6 A;  5T6J A; 
#chains in the Genus database with same CATH homology
 4M9V C;  2RPC A;  3VHT B;  2YTD A;  2ELY A;  5KL3 A;  2YTQ A;  2EMW A;  1A1I A;  2EPZ A;  1A1L A;  2WBT A;  2A25 A;  1Z1B A;  2EOM A;  2YU8 A;  2LVH A;  2EMA A;  2EPC A;  2YTG A;  2D9H A;  5KL5 A;  2ENH A;  2YRM A;  2EOJ A;  2EMH A;  5KL6 A;  2LT7 A;  1B69 A;  2EP3 A;  2MKD A;  1A1G A;  2YRH A;  2EMB A;  2J7J A;  2EN3 A;  2DLQ A;  2EQ1 A;  1MEY C;  3EPH A;  2EQ0 A;  1A1H A;  4R2P A;  4R2R A;  4GZN C;  2NAB A;  2EOZ A;  1WJP A;  2R1F A;  1G2D C;  2YTF A;  2YTN A;  2EPP A;  2DLK A;  2EM0 A;  1UBD C;  1NCS A;  2CSH A;  2ENC A;  4R2Q A;  2YTI A;  3MHS C;  2EM6 A;  2LO3 A;  2YSO A;  1TN9 A;  2MKN A;  4F6N A;  5KL7 A;  2EMK A;  2EM4 A;  2ELZ A;  1A1F A;  2GLI A;  3M99 B;  4IJD A;  2YRK A;  2JP9 A;  1X6H A;  2DRP A;  1X5W A;  3EPK A;  2EN7 A;  1P47 A;  2EMX A;  1X6F A;  2MDG A;  2EMG A;  2EPR A;  4R2S A;  2EOS A;  5KL4 A;  1X3C A;  2EML A;  2BB8 A;  2VRD A;  4X9J A;  2E72 A;  2EN8 A;  2RSI A;  5KL2 A;  2EOR A;  2EM3 A;  4R2D A;  1DGC A;  1AAY A;  2EOF A;  2YTO A;  2DMI A;  4WSG A;  2EL4 A;  3MHH C;  2ENA A;  2EOI A;  1RMD A;  2ADR A;  2EM2 A;  4FK5 C;  2EM9 A;  3EPL A;  2PRT A;  2EM7 A;  2EN2 A;  2EPX A;  1A1K A;  4R2C A;  1UN6 B;  2EN4 A;  2EOX A;  4R2A A;  2WCC 3;  4F6M A;  1LLM C;  1ZR9 A;  2EOO A;  2EOY A;  2EN6 A;  4IS1 C;  2DGC A;  2WBS A;  2EL5 A;  4R2E A;  2EE8 A;  1TF6 A;  1YUI A;  4F2J C;  1G2F C;  1KJK A;  2YTE A;  1TF3 A;  2EMZ A;  2EM8 A;  2GHF A;  2EOH A;  3EPJ A;  2EPU A;  2CT1 A;  1BB8 A;  1F2I G;  2EQ3 A;  2HGH A;  1JK1 A;  1YUJ A;  1X6E A;  2CTD A;  2LCE A;  2I13 A;  2LV2 A;  2EOE A;  1ZU1 A;  2JPA A;  1A1J A;  2EMF A;  2YSP A;  1YSA C;  2WBU A;  2M9A A;  2EMY A;  2EM5 A;  2EL6 A;  2EMI A;  2EOQ A;  2YTP A;  1ZAA C;  2EN1 A;  2EPA A;  2YTJ A;  3UK3 C;  2EJ4 A;  2YU5 A;  2EMC A;  1JK2 A;  1BBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...