2MDGA

Solution nmr structure of zinc finger protein 423 from homo sapiens, northeast structural genomics consortium (nesg) target hr7298f
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 423
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mdgA00
2EN8A 2EOMA 1ZAAC 2EMBA 2EM8A 5KL4A 4F6NA 2EPXA 5KL5A 2EMLA 1A1FA 1X6HA 2EOEA 2EMHA 1A1JA 1X3CA 4IJDA 2EN1A 3M99B 2DLQA 4F6MA 2MDGA 2YU5A 1UN6B 3MHHC 2EPAA 2EMFA 2EQ0A 2DGCA 1DGCA 2EM3A 2YRMA 2YTOA 2LV2A 2YTPA 1ZR9A 5KL3A 1WJPA 2D9HA 2CSHA 2EMZA 4R2SA 2EL5A 2EM9A 2EOQA 1YUJA 2M9AA 2YTEA 4R2PA 2J7JA 2JPAA 2RPCA 2E72A 1YUIA 1JK1A 2EM7A 2EN3A 2EOOA 1MEYC 2EOHA 2YTJA 2HGHA 2EPUA 2CT1A 2EM0A 5KL6A 1X6FA 2YTQA 2ENCA 1UBDC 2EOZA 2EOXA 2YRKA 2GHFA 2EPZA 2CTDA 4GZNC 2A25A 2NABA 2EMKA 2EN6A 1JK2A 2EORA 2YRHA 1BB8A 2EJ4A 4R2RA 2EPCA 2BB8A 2WCC3 2EOJA 2YTDA 4R2EA 1YSAC 4R2QA 2EPPA 2YTGA 1NCSA 2YTNA 2EM6A 2EMWA 2YSOA 2EM2A 1X5WA 5KL7A 1X6EA 4R2CA 4R2DA 1BBOA 2EQ1A 2LCEA 2LT7A 1TF6A 2GLIA 2WBUA 3EPHA 2EM4A 2DRPA 2EMXA 2WBSA 4IS1C 4FK5C 4R2AA 5KL2A 4M9VC 2EOYA 1RMDA 2EMGA 2EOIA 4F2JC 1AAYA 2LVHA 2EOFA 2EL4A 2PRTA 2EN7A 2MKDA 1G2DC 2ELYA 2I13A 3EPJA 2EMYA 3UK3C 1G2FC 2EMAA 2YTIA 1A1KA 1TF3A 2ENAA 1KJKA 2EMCA 2VRDA 2EP3A 2EM5A 2MKNA 2EE8A 3VHTB 2EQ3A 3MHSC 2ELZA 2YSPA 2EL6A 2EOSA 4X9JA 2DLKA 2EMIA 1F2IG 1B69A 2JP9A 3EPKA 2YU8A 2RSIA 2YTFA 1A1IA 2DMIA 1LLMC 1A1GA 1A1LA 2WBTA 1A1HA 1ZU1A 2EPRA 1P47A 1Z1BA 2ENHA 2LO3A 2ADRA 2EN4A 1TN9A 2R1FA 4WSGA 3EPLA 2EN2A
chains in the Genus database with same CATH superfamily
2EOMA 3AV0A 2EM8A 1YYKA 5KL4A 4N4RB 5KL5A 1A1FA 2FGGA 2EN1A 4F6MA 2YU5A 1UN6B 4BS9A 4P7DA 5IXMB 2YRMA 5KL3A 3BGHA 4R2SA 2EL5A 4O4KA 4DV6E 4WSPA 3VYXA 4YY3E 2UUBE 2JWOA 2J7JA 1UILA 4L5NC 4RH8A 3J81C 2YTJA 2EPNA 3TQMA 2CT1A 2EM0A 5KL6A 1UBDC 5AC5A 4X66E 2MC6A 4GKKE 1AH5A 3L00A 2M4IA 2ODRD 1X49A 4I8OA 2LUPB 1EKZA 2YTDA 4R2EA 2YTGA 4LF4E 2EPLX 5A6BA 2JR1A 1NCSA 2L2MA 3BBGA 5AE1A 3T1HE 2E5LE 2YSOA 4R8OA 4DV3E 2EM2A 5IWAE 2EPKX 1X6EA 2LRSA 3VK6A 5TSEA 2LCEA 2NUEA 2VQFE 2FTXB 3EPHA 2Q8UA 5A6KA 1RC7A 4IS1C 2UXDE 2K4VA 4FK5C 1T39A 2EMGA 3F6HA 5IV8B 2EOFA 2EL4A 4JI2E 2RQLA 2ELYA 1N33E 2LMZA 1IBME 4X8WA 2MKNA 4WPYA 3VHTB 4WXCA 2EOSA 4BC9A 5T6JA 1XMOE 4X65E 3EPKA 1YZ9A 2YU8A 4DR6E 1T4LB 5LMUE 2V8QB 2RSIA 2YTFA 4JI0E 1A1GA 4P78A 3C4TA 2WBTA 1A1HA 1Z1BA 2ADRA 2EN4A 2B9DA 3ADJA 4DR5E 3EPLA 4DV4E 2EN2A 4NXNE 1ZAAC 1GTKA 2EPXA 5A6JA 1X6HA 2EMHA 1A1JA 4KWYA 1GQEA 4M0VA 3THNA 4BBYA 4GEQB 4BC7A 5AE3A 2K7IA 2EPAA 4F9BB 2JVAA 4K0KE 4F9CB 2DB2A 1PKPA 1X48A 2UXBE 2YTOA 4DV0E 2LV2A 2YTPA 1ZR9A 4DR3E 2EMZA 1DI2A 4R2PA 3ZOQB 3KZZA 2LJHA 3BIDA 4LTYA 2HHHE 2YZTA 1JK1A 2EOOA 4NHRA 2EPUA 3OMLA 2UUAE 1BBGA 1X6FA 4L8NA 2EOXA 2JY9A 2LJUA 3HPSA 2FV4B 2YRKA 4ZYHA 2GHFA 4TUGA 3JU0A 2NA2A 2CTDA 4GZNC 2L2KB 3C4BA 2BBGA 3P1XA 1JK2A 2EORA 2YRHA 4BHBA 1BB8A 4R2RA 5LMNE 2LTSA 4DV1E 3RMPA 1YSAC 5LLQA 3DJWA 4ZYGA 1SR9A 2EM6A 4LF8E 4B3RE 2L92A 1IQOA 2YT4A 4ZYDA 4HEIA 4R2CA 4F9AB 4DUZE 4MLQA 2LT7A 1TF6A 2KONA 5IT9C 4LFCE 2G7HA 3THOB 1YFHA 2EMXA 1PJTA 1QU6A 3HQ1A 4M2ZA 4M30A 4MLVA 2RS7A 4F2JC 1AAYA 4J8ZA 2M1SA 5DNYA 1N34E 1G2DC 3C6MA 2V87A 3EPJA 3UK3C 4JI5E 1J5EE 2V86A 2YTIA 2ENAA 1ZBQA 2M7QA 2EMCA 2VRDA 4JI4E 2L3CA 2JXPA 1MGTA 2EQ3A 2ELZA 2EL6A 2EMIA 1B69A 3KWRA 2L8TA 2UUCE 2F4VE 1I94E 1A1IA 4R03A 4JI8E 2HC5A 1A1LA 3OTOE 1IBLE 4BMJA 2LUQA 1TN9A 4BHCA 3IWDA 3JTZA 5AE2A 4JI6E 4O5GA 3BF2A 2EZ6A 4KHPE 4JI1E 1DQ3A 4LFAE 4O43A 3JAMC 1X3CA 1WXRA 2GPIA 1XMQE 4WYQB 4NZVA 2EMFA 2ODRC 5AASA 1HNZE 2EQ0A 1YYOA 4LF5E 4DR7E 1IMUA 4DV2E 3ECRA 4DV5E 3H09A 1WJPA 2MDRA 2R76A 2EM9A 4Q35B 3FIGA 1GZ6A 2V85A 2WZOA 1IQSA 2KHXA 2DIXA 1UHZA 1X47A 2JPAA 2E72A 1XNQE 1MEYC 2EOHA 2HGHA 2ENCA 1WHNA 2N8XA 2E1MA 1N3GA 2F8BA 2A25A 4JYAE 2L2NA 2EMKA 2EN6A 2V83A 2EJ4A 2EOJA 5A6BD 4WXDA 1QNTA 2YWQA 5A2QC 4B3TE 4GKJE 2L3JA 2RSMA 2YTNA 5KL7A 1X5WA 4R2DA 3J7Yp 1BBOA 2EQ1A 2H36X 3ADGA 2L33A 1N36E 2ZM6E 4RHBB 5KL2A 4M9VC 2LBSB 2EOYA 1RMDA 3HXLA 2EOIA 2UXCE 2EPMX 2PRTA 2EWLA 5A6AA 3LMLA 1FKAE 4DR4E 1HNWE 2EMAA 1A1KA 3MSWA 1KJKA 2EP3A 2V89A 2EE8A 4DR1E 2IHR1 3J7AG 2JP9A 1YPNA 4JI3E 4LFBE 3EQ1A 2V88A 1O0WA 2N3GA 1STUA 4LF9E 1ZU1A 1P47A 1EH8A 1EH6A 4WSGA 4LU9A 2EN8A 2RS6A 3AUZA 2EMBA 4F6NA 1J26A 4DUYE 2EMLA 2NUGA 2EOEA 1WHQA 1L4SA 2JYAA 1SFEA 2VQEE 4IJDA 5AC4A 2NUFA 4LF7E 3M99B 2DLQA 1IBKE 4X64E 2MDGA 3VYYA 3MHHC 2DMYA 2I9IA 2DGCA 3J80C 3T1YE 5ADZA 1DGCA 2EM3A 4F54A 5LL6R 3DF6A 4B3ME 2D9HA 2L6MA 2CSHA 4Q28A 2EOQA 1YUJA 2M9AA 3K6QA 2YTEA 2LTRA 4WFTA 2UU9E 4DMIA 4NXME 2RPCA 1YUIA 4OOGC 2B7VA 2EM7A 2EN3A 4HTGA 4ZYEA 2HJJA 2YTQA 3ADLA 2EOZA 2EPZA 2JOXA 1XNRE 3ADIA 2NABA 4OX9E 2BB8A 2EPCA 2WCC3 1ZBTA 2LE2A 3LLHA 3QG5C 4R2QA 1YYWA 2EPPA 4JI7E 4DR2E 1NEIA 4X62E 2EMWA 2EPOA 4TUIA 2KOUA 1HNXE 2GLIA 2WBUA 4DKKA 4WX9A 2EM4A 2DRPA 3KZYA 2WBSA 5A69A 1N32E 4R2AA 1T4NA 2B3TB 3F6GA 1HR0E 1FJGE 2LVHA 3IWCA 3IWBA 2EN7A 2MKDA 2VE7C 4BCAA 2RTXA 4KZSA 2I13A 3HTXA 2EMYA 1G2FC 1TF3A 1T38A 1PJSA 2JOBA 2EM5A 1WRJA 2MC5A 3MHSC 2YSPA 2YPNA 1T4OA 5FLXC 1PJQA 2B7TA 4X9JA 2DLKA 4AQYE 1F2IG 4LF6E 2VF1A 1KYQA 2DSYA 2N3HA 2DMIA 4B3SE 1LLMC 5BR8E 4YHHE 1RQ0A 2EPRA 1EH7A 4DV7E 4JV5E 2CPNA 2ENHA 2LO3A 3C6KA 3HPZA 2R1FA 4O24A 5F3WA 5CFFE 1PDAA
chains in the Genus database with same CATH topology
2EN8A 2EOMA 1ZAAC 2EMBA 2EM8A 5KL4A 4F6NA 2EPXA 5KL5A 2EMLA 1A1FA 1X6HA 2EOEA 2EMHA 1A1JA 1X3CA 4IJDA 2EN1A 3M99B 2DLQA 4F6MA 2MDGA 2YU5A 1UN6B 3MHHC 2EPAA 2EMFA 2EQ0A 2DGCA 1DGCA 2EM3A 2YRMA 2YTOA 2LV2A 2YTPA 1ZR9A 5KL3A 1WJPA 2D9HA 2CSHA 2EMZA 4R2SA 2EL5A 2EM9A 2EOQA 1YUJA 2M9AA 2YTEA 4R2PA 2J7JA 2JPAA 2RPCA 2E72A 1YUIA 1JK1A 2EM7A 2EN3A 2EOOA 1MEYC 2EOHA 2YTJA 2HGHA 2EPUA 2CT1A 2EM0A 5KL6A 1X6FA 2YTQA 2ENCA 1UBDC 2EOZA 2EOXA 2YRKA 2GHFA 2EPZA 2CTDA 4GZNC 2A25A 2NABA 2EMKA 2EN6A 1JK2A 2EORA 2YRHA 1BB8A 2EJ4A 4R2RA 2EPCA 2BB8A 2WCC3 2EOJA 2YTDA 4R2EA 1YSAC 4R2QA 2EPPA 2YTGA 1NCSA 2YTNA 2EM6A 2EMWA 2YSOA 2EM2A 1X5WA 5KL7A 1X6EA 4R2CA 4R2DA 1BBOA 2EQ1A 2LCEA 2LT7A 1TF6A 2GLIA 2WBUA 3EPHA 2EM4A 2DRPA 2EMXA 2WBSA 4IS1C 4FK5C 4R2AA 5KL2A 4M9VC 2EOYA 1RMDA 2EMGA 2EOIA 4F2JC 1AAYA 2LVHA 2EOFA 2EL4A 2PRTA 2EN7A 2MKDA 1G2DC 2ELYA 2I13A 3EPJA 2EMYA 3UK3C 1G2FC 2EMAA 2YTIA 1A1KA 1TF3A 2ENAA 1KJKA 2EMCA 2VRDA 2EP3A 2EM5A 2MKNA 2EE8A 3VHTB 2EQ3A 3MHSC 2ELZA 2YSPA 2EL6A 2EOSA 4X9JA 2DLKA 2EMIA 1F2IG 1B69A 2JP9A 3EPKA 2YU8A 2RSIA 2YTFA 1A1IA 2DMIA 1LLMC 1A1GA 1A1LA 2WBTA 1A1HA 1ZU1A 2EPRA 1P47A 1Z1BA 2ENHA 2LO3A 2ADRA 2EN4A 1TN9A 2R1FA 4WSGA 3EPLA 2EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  2EOM A;  1ZAA C;  2EMB A;  2EM8 A;  5KL4 A;  4F6N A;  2EPX A;  5KL5 A;  2EML A;  1A1F A;  1X6H A;  2EOE A;  2EMH A;  1A1J A;  1X3C A;  4IJD A;  2EN1 A;  3M99 B;  2DLQ A;  4F6M A;  2MDG A;  2YU5 A;  1UN6 B;  3MHH C;  2EPA A;  2EMF A;  2EQ0 A;  2DGC A;  1DGC A;  2EM3 A;  2YRM A;  2YTO A;  2LV2 A;  2YTP A;  1ZR9 A;  5KL3 A;  1WJP A;  2D9H A;  2CSH A;  2EMZ A;  4R2S A;  2EL5 A;  2EM9 A;  2EOQ A;  1YUJ A;  2M9A A;  2YTE A;  4R2P A;  2J7J A;  2JPA A;  2RPC A;  2E72 A;  1YUI A;  1JK1 A;  2EM7 A;  2EN3 A;  2EOO A;  1MEY C;  2EOH A;  2YTJ A;  2HGH A;  2EPU A;  2CT1 A;  2EM0 A;  5KL6 A;  1X6F A;  2YTQ A;  2ENC A;  1UBD C;  2EOZ A;  2EOX A;  2YRK A;  2GHF A;  2EPZ A;  2CTD A;  4GZN C;  2A25 A;  2NAB A;  2EMK A;  2EN6 A;  1JK2 A;  2EOR A;  2YRH A;  1BB8 A;  2EJ4 A;  4R2R A;  2EPC A;  2BB8 A;  2WCC 3;  2EOJ A;  2YTD A;  4R2E A;  1YSA C;  4R2Q A;  2EPP A;  2YTG A;  1NCS A;  2YTN A;  2EM6 A;  2EMW A;  2YSO A;  2EM2 A;  1X5W A;  5KL7 A;  1X6E A;  4R2C A;  4R2D A;  1BBO A;  2EQ1 A;  2LCE A;  2LT7 A;  1TF6 A;  2GLI A;  2WBU A;  3EPH A;  2EM4 A;  2DRP A;  2EMX A;  2WBS A;  4IS1 C;  4FK5 C;  4R2A A;  5KL2 A;  4M9V C;  2EOY A;  1RMD A;  2EMG A;  2EOI A;  4F2J C;  1AAY A;  2LVH A;  2EOF A;  2EL4 A;  2PRT A;  2EN7 A;  2MKD A;  1G2D C;  2ELY A;  2I13 A;  3EPJ A;  2EMY A;  3UK3 C;  1G2F C;  2EMA A;  2YTI A;  1A1K A;  1TF3 A;  2ENA A;  1KJK A;  2EMC A;  2VRD A;  2EP3 A;  2EM5 A;  2MKN A;  2EE8 A;  3VHT B;  2EQ3 A;  3MHS C;  2ELZ A;  2YSP A;  2EL6 A;  2EOS A;  4X9J A;  2DLK A;  2EMI A;  1F2I G;  1B69 A;  2JP9 A;  3EPK A;  2YU8 A;  2RSI A;  2YTF A;  1A1I A;  2DMI A;  1LLM C;  1A1G A;  1A1L A;  2WBT A;  1A1H A;  1ZU1 A;  2EPR A;  1P47 A;  1Z1B A;  2ENH A;  2LO3 A;  2ADR A;  2EN4 A;  1TN9 A;  2R1F A;  4WSG A;  3EPL A;  2EN2 A; 
#chains in the Genus database with same CATH topology
 2EOM A;  3AV0 A;  2EM8 A;  1YYK A;  5KL4 A;  4N4R B;  5KL5 A;  1A1F A;  2FGG A;  2EN1 A;  4F6M A;  2YU5 A;  1UN6 B;  4BS9 A;  4P7D A;  5IXM B;  2YRM A;  5KL3 A;  3BGH A;  4R2S A;  2EL5 A;  4O4K A;  4DV6 E;  4WSP A;  3VYX A;  4YY3 E;  2UUB E;  2JWO A;  2J7J A;  1UIL A;  4L5N C;  4RH8 A;  3J81 C;  2YTJ A;  2EPN A;  3TQM A;  2CT1 A;  2EM0 A;  5KL6 A;  1UBD C;  5AC5 A;  4X66 E;  2MC6 A;  4GKK E;  1AH5 A;  3L00 A;  2M4I A;  2ODR D;  1X49 A;  4I8O A;  2LUP B;  1EKZ A;  2YTD A;  4R2E A;  2YTG A;  4LF4 E;  2EPL X;  5A6B A;  2JR1 A;  1NCS A;  2L2M A;  3BBG A;  5AE1 A;  3T1H E;  2E5L E;  2YSO A;  4R8O A;  4DV3 E;  2EM2 A;  5IWA E;  2EPK X;  1X6E A;  2LRS A;  3VK6 A;  5TSE A;  2LCE A;  2NUE A;  2VQF E;  2FTX B;  3EPH A;  2Q8U A;  5A6K A;  1RC7 A;  4IS1 C;  2UXD E;  2K4V A;  4FK5 C;  1T39 A;  2EMG A;  3F6H A;  5IV8 B;  2EOF A;  2EL4 A;  4JI2 E;  2RQL A;  2ELY A;  1N33 E;  2LMZ A;  1IBM E;  4X8W A;  2MKN A;  4WPY A;  3VHT B;  4WXC A;  2EOS A;  4BC9 A;  5T6J A;  1XMO E;  4X65 E;  3EPK A;  1YZ9 A;  2YU8 A;  4DR6 E;  1T4L B;  5LMU E;  2V8Q B;  2RSI A;  2YTF A;  4JI0 E;  1A1G A;  4P78 A;  3C4T A;  2WBT A;  1A1H A;  1Z1B A;  2ADR A;  2EN4 A;  2B9D A;  3ADJ A;  4DR5 E;  3EPL A;  4DV4 E;  2EN2 A;  4NXN E;  1ZAA C;  1GTK A;  2EPX A;  5A6J A;  1X6H A;  2EMH A;  1A1J A;  4KWY A;  1GQE A;  4M0V A;  3THN A;  4BBY A;  4GEQ B;  4BC7 A;  5AE3 A;  2K7I A;  2EPA A;  4F9B B;  2JVA A;  4K0K E;  4F9C B;  2DB2 A;  1PKP A;  1X48 A;  2UXB E;  2YTO A;  4DV0 E;  2LV2 A;  2YTP A;  1ZR9 A;  4DR3 E;  2EMZ A;  1DI2 A;  4R2P A;  3ZOQ B;  3KZZ A;  2LJH A;  3BID A;  4LTY A;  2HHH E;  2YZT A;  1JK1 A;  2EOO A;  4NHR A;  2EPU A;  3OML A;  2UUA E;  1BBG A;  1X6F A;  4L8N A;  2EOX A;  2JY9 A;  2LJU A;  3HPS A;  2FV4 B;  2YRK A;  4ZYH A;  2GHF A;  4TUG A;  3JU0 A;  2NA2 A;  2CTD A;  4GZN C;  2L2K B;  3C4B A;  2BBG A;  3P1X A;  1JK2 A;  2EOR A;  2YRH A;  4BHB A;  1BB8 A;  4R2R A;  5LMN E;  2LTS A;  4DV1 E;  3RMP A;  1YSA C;  5LLQ A;  3DJW A;  4ZYG A;  1SR9 A;  2EM6 A;  4LF8 E;  4B3R E;  2L92 A;  1IQO A;  2YT4 A;  4ZYD A;  4HEI A;  4R2C A;  4F9A B;  4DUZ E;  4MLQ A;  2LT7 A;  1TF6 A;  2KON A;  5IT9 C;  4LFC E;  2G7H A;  3THO B;  1YFH A;  2EMX A;  1PJT A;  1QU6 A;  3HQ1 A;  4M2Z A;  4M30 A;  4MLV A;  2RS7 A;  4F2J C;  1AAY A;  4J8Z A;  2M1S A;  5DNY A;  1N34 E;  1G2D C;  3C6M A;  2V87 A;  3EPJ A;  3UK3 C;  4JI5 E;  1J5E E;  2V86 A;  2YTI A;  2ENA A;  1ZBQ A;  2M7Q A;  2EMC A;  2VRD A;  4JI4 E;  2L3C A;  2JXP A;  1MGT A;  2EQ3 A;  2ELZ A;  2EL6 A;  2EMI A;  1B69 A;  3KWR A;  2L8T A;  2UUC E;  2F4V E;  1I94 E;  1A1I A;  4R03 A;  4JI8 E;  2HC5 A;  1A1L A;  3OTO E;  1IBL E;  4BMJ A;  2LUQ A;  1TN9 A;  4BHC A;  3IWD A;  3JTZ A;  5AE2 A;  4JI6 E;  4O5G A;  3BF2 A;  2EZ6 A;  4KHP E;  4JI1 E;  1DQ3 A;  4LFA E;  4O43 A;  3JAM C;  1X3C A;  1WXR A;  2GPI A;  1XMQ E;  4WYQ B;  4NZV A;  2EMF A;  2ODR C;  5AAS A;  1HNZ E;  2EQ0 A;  1YYO A;  4LF5 E;  4DR7 E;  1IMU A;  4DV2 E;  3ECR A;  4DV5 E;  3H09 A;  1WJP A;  2MDR A;  2R76 A;  2EM9 A;  4Q35 B;  3FIG A;  1GZ6 A;  2V85 A;  2WZO A;  1IQS A;  2KHX A;  2DIX A;  1UHZ A;  1X47 A;  2JPA A;  2E72 A;  1XNQ E;  1MEY C;  2EOH A;  2HGH A;  2ENC A;  1WHN A;  2N8X A;  2E1M A;  1N3G A;  2F8B A;  2A25 A;  4JYA E;  2L2N A;  2EMK A;  2EN6 A;  2V83 A;  2EJ4 A;  2EOJ A;  5A6B D;  4WXD A;  1QNT A;  2YWQ A;  5A2Q C;  4B3T E;  4GKJ E;  2L3J A;  2RSM A;  2YTN A;  5KL7 A;  1X5W A;  4R2D A;  3J7Y p;  1BBO A;  2EQ1 A;  2H36 X;  3ADG A;  2L33 A;  1N36 E;  2ZM6 E;  4RHB B;  5KL2 A;  4M9V C;  2LBS B;  2EOY A;  1RMD A;  3HXL A;  2EOI A;  2UXC E;  2EPM X;  2PRT A;  2EWL A;  5A6A A;  3LML A;  1FKA E;  4DR4 E;  1HNW E;  2EMA A;  1A1K A;  3MSW A;  1KJK A;  2EP3 A;  2V89 A;  2EE8 A;  4DR1 E;  2IHR 1;  3J7A G;  2JP9 A;  1YPN A;  4JI3 E;  4LFB E;  3EQ1 A;  2V88 A;  1O0W A;  2N3G A;  1STU A;  4LF9 E;  1ZU1 A;  1P47 A;  1EH8 A;  1EH6 A;  4WSG A;  4LU9 A;  2EN8 A;  2RS6 A;  3AUZ A;  2EMB A;  4F6N A;  1J26 A;  4DUY E;  2EML A;  2NUG A;  2EOE A;  1WHQ A;  1L4S A;  2JYA A;  1SFE A;  2VQE E;  4IJD A;  5AC4 A;  2NUF A;  4LF7 E;  3M99 B;  2DLQ A;  1IBK E;  4X64 E;  2MDG A;  3VYY A;  3MHH C;  2DMY A;  2I9I A;  2DGC A;  3J80 C;  3T1Y E;  5ADZ A;  1DGC A;  2EM3 A;  4F54 A;  5LL6 R;  3DF6 A;  4B3M E;  2D9H A;  2L6M A;  2CSH A;  4Q28 A;  2EOQ A;  1YUJ A;  2M9A A;  3K6Q A;  2YTE A;  2LTR A;  4WFT A;  2UU9 E;  4DMI A;  4NXM E;  2RPC A;  1YUI A;  4OOG C;  2B7V A;  2EM7 A;  2EN3 A;  4HTG A;  4ZYE A;  2HJJ A;  2YTQ A;  3ADL A;  2EOZ A;  2EPZ A;  2JOX A;  1XNR E;  3ADI A;  2NAB A;  4OX9 E;  2BB8 A;  2EPC A;  2WCC 3;  1ZBT A;  2LE2 A;  3LLH A;  3QG5 C;  4R2Q A;  1YYW A;  2EPP A;  4JI7 E;  4DR2 E;  1NEI A;  4X62 E;  2EMW A;  2EPO A;  4TUI A;  2KOU A;  1HNX E;  2GLI A;  2WBU A;  4DKK A;  4WX9 A;  2EM4 A;  2DRP A;  3KZY A;  2WBS A;  5A69 A;  1N32 E;  4R2A A;  1T4N A;  2B3T B;  3F6G A;  1HR0 E;  1FJG E;  2LVH A;  3IWC A;  3IWB A;  2EN7 A;  2MKD A;  2VE7 C;  4BCA A;  2RTX A;  4KZS A;  2I13 A;  3HTX A;  2EMY A;  1G2F C;  1TF3 A;  1T38 A;  1PJS A;  2JOB A;  2EM5 A;  1WRJ A;  2MC5 A;  3MHS C;  2YSP A;  2YPN A;  1T4O A;  5FLX C;  1PJQ A;  2B7T A;  4X9J A;  2DLK A;  4AQY E;  1F2I G;  4LF6 E;  2VF1 A;  1KYQ A;  2DSY A;  2N3H A;  2DMI A;  4B3S E;  1LLM C;  5BR8 E;  4YHH E;  1RQ0 A;  2EPR A;  1EH7 A;  4DV7 E;  4JV5 E;  2CPN A;  2ENH A;  2LO3 A;  3C6K A;  3HPZ A;  2R1F A;  4O24 A;  5F3W A;  5CFF E;  1PDA A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  2EOM A;  1ZAA C;  2EMB A;  2EM8 A;  5KL4 A;  4F6N A;  2EPX A;  5KL5 A;  2EML A;  1A1F A;  1X6H A;  2EOE A;  2EMH A;  1A1J A;  1X3C A;  4IJD A;  2EN1 A;  3M99 B;  2DLQ A;  4F6M A;  2MDG A;  2YU5 A;  1UN6 B;  3MHH C;  2EPA A;  2EMF A;  2EQ0 A;  2DGC A;  1DGC A;  2EM3 A;  2YRM A;  2YTO A;  2LV2 A;  2YTP A;  1ZR9 A;  5KL3 A;  1WJP A;  2D9H A;  2CSH A;  2EMZ A;  4R2S A;  2EL5 A;  2EM9 A;  2EOQ A;  1YUJ A;  2M9A A;  2YTE A;  4R2P A;  2J7J A;  2JPA A;  2RPC A;  2E72 A;  1YUI A;  1JK1 A;  2EM7 A;  2EN3 A;  2EOO A;  1MEY C;  2EOH A;  2YTJ A;  2HGH A;  2EPU A;  2CT1 A;  2EM0 A;  5KL6 A;  1X6F A;  2YTQ A;  2ENC A;  1UBD C;  2EOZ A;  2EOX A;  2YRK A;  2GHF A;  2EPZ A;  2CTD A;  4GZN C;  2A25 A;  2NAB A;  2EMK A;  2EN6 A;  1JK2 A;  2EOR A;  2YRH A;  1BB8 A;  2EJ4 A;  4R2R A;  2EPC A;  2BB8 A;  2WCC 3;  2EOJ A;  2YTD A;  4R2E A;  1YSA C;  4R2Q A;  2EPP A;  2YTG A;  1NCS A;  2YTN A;  2EM6 A;  2EMW A;  2YSO A;  2EM2 A;  1X5W A;  5KL7 A;  1X6E A;  4R2C A;  4R2D A;  1BBO A;  2EQ1 A;  2LCE A;  2LT7 A;  1TF6 A;  2GLI A;  2WBU A;  3EPH A;  2EM4 A;  2DRP A;  2EMX A;  2WBS A;  4IS1 C;  4FK5 C;  4R2A A;  5KL2 A;  4M9V C;  2EOY A;  1RMD A;  2EMG A;  2EOI A;  4F2J C;  1AAY A;  2LVH A;  2EOF A;  2EL4 A;  2PRT A;  2EN7 A;  2MKD A;  1G2D C;  2ELY A;  2I13 A;  3EPJ A;  2EMY A;  3UK3 C;  1G2F C;  2EMA A;  2YTI A;  1A1K A;  1TF3 A;  2ENA A;  1KJK A;  2EMC A;  2VRD A;  2EP3 A;  2EM5 A;  2MKN A;  2EE8 A;  3VHT B;  2EQ3 A;  3MHS C;  2ELZ A;  2YSP A;  2EL6 A;  2EOS A;  4X9J A;  2DLK A;  2EMI A;  1F2I G;  1B69 A;  2JP9 A;  3EPK A;  2YU8 A;  2RSI A;  2YTF A;  1A1I A;  2DMI A;  1LLM C;  1A1G A;  1A1L A;  2WBT A;  1A1H A;  1ZU1 A;  2EPR A;  1P47 A;  1Z1B A;  2ENH A;  2LO3 A;  2ADR A;  2EN4 A;  1TN9 A;  2R1F A;  4WSG A;  3EPL A;  2EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...