2ME6A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens in complex with the dna sequence cgactaattagtcg
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
b'SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 16
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me6A00
1BJZA 2DTZA 1GV5A 4DYQA 2LY9A 2FQ4A 4JX4A 4GFBA 2DMUA 3NAUA 4QIWN 4D7MA 3FISA 2E2IJ 2Y9ZA 2XGEA 4JYKA 2KDZA 1MH3A 5M3FJ 3OOUA 3BR0A 3BG5A 3LOCA 3JR9A 2HXIA 1W0UA 1Y1VJ 4A3FJ 2M2EA 4B4CA 1ETQA 1BA5A 1R9TJ 4CYCA 5HODA 2MG4A 1MBHA 2L7MP 1FTZA 2LFBA 2HQ5A 2WB1N 1A6IA 2DA2A 4D5CA 2WAQN 1WPKA 3ZQHA 2ME0A 2X48A 3MKLA 4V2FA 1GVDA 4AC0A 2JA7J 1IC8A 3VPRA 2Y0SN 1O4XA 1JT0A 2XPUA 2EZLA 4DW6A 3S1QJ 3PO3J 1ETXA 2R93J 2HOSA 1ZTRA 5GPAA 3M3YJ 2CQQA 1JJ8C 5EZHA 2CJJA 2KT0A 4A69C 3DEWA 4BKXA 4A3EJ 1RETA 2NOGA 1POGA 1U8BA 2W48A 2LTPA 3BR6A 4MIMA 4Y7NJ 1JJ6C 5E3NA 5K7ZA 5FJ8J 4BBSJ 2FD5A 3BTIA 1UMQA 3D1NI 1DU0A 3HOZJ 4MLOA 3JRFA 1TWCJ 2I10A 2DMTA 3BG3A 3BT9A 1JGGA 5F04A 3GTOJ 2JWTA 3S1NJ 2LVSA 3ZQFA 5FKMA 4FE4A 5IOYA 4A3MJ 3F0CA 3K2AA 4QTRA 3HGYA 5GP9A 3ZOBA 2MW8A 1T56A 1FEXA 2NVXJ 1F43A 4XRMA 2XRLA 5GPCA 1BW6A 1IDYA 1OCTC 3TP3A 5FLMJ 2QCOA 2E1OA 4XK4A 4XICA 3JREA 1GDTA 2IBDA 4M3GA 3HOWJ 2LD5A 4IHYA 1LFBA 2JMWA 1XG1A 3QPSA 1IV6A 3HOYJ 1BW5A 4C3IJ 2O9LA 1JUSA 3PO2J 2IAIA 1ZGWA 4JX6A 1YRNB 2TCTA 5EG0A 4UUSB 3FKIJ 1LFUP 2XGDA 2XB0X 2Y31A 2LK2A 2XPVA 2O8KA 5M3MJ 2N8GA 4IEJA 3S17J 1JT6A 5EF6A 1JKQC 1JUMA 3HKZN 4LOCA 2EH3A 3S15J 2X9DA 2HDDA 3A01A 1ZQ3P 2HOTA 2Y2ZA 1SANA 2XPWA 3IH2A 2K40A 3G1LA 5F0FA 1GUUA 1YRNA 2VI6A 1Z77A 4D5FA 3WHBA 2QF7A 3NARA 3RZOJ 3CDLA 2O7OA 1ZR4A 1X58A 1I3QJ 2EZKA 2NVTJ 1ETOA 1HDDC 3RKQA 1IG7A 3WHCA 2VKEA 1MBEA 2TRTA 1HLVA 4M3FA 1XC5A 1NK3P 2DA4A 4CYCB 3GBGA 2XGCA 4XRSA 3JRGA 1CQTA 1IGNA 5EZGA 4I6ZA 1FTTA 1MNMC 2M9HA 2ID3A 5FKNA 1FIAA 1LE8A 2FX0A 3BTCA 5F0HA 3G1MA 5E3OA 1JUPA 3ZQIA 1VNDA 3IH4A 2JA6J 1TWFJ 1JTYA 1WCMJ 1NTCA 2R92J 3OIOA 4MFEA 4B3AA 2LLKA 1ETWA 2R7ZJ 3BQYA 2DJNA 2VKVA 2L7FP 5DS9A 3FK6A 2LKXA 2DA7A 1OFCX 3SFIA 2ME6A 5E3MA 2B63J 1B72A 2GLOA 4DZPA 3MN2A 3IH3A 2MSYA 2DN0A 2GM4A 2K9NA 5C44J 1H88C 1WI3A 4M3DA 3LSRA 2CU7A 5C4JJ 1AU7A 3GTLJ 2FJ1A 1P7IA 1IUFA 2R5YA 4D7NA 1K83J 5FLVA 3BTLA 4AYBN 1JKRC 2R0QC 2VUMJ 5EEAA 4DYCA 5E3LA 1Z0XA 2L9RA 2D5VA 2EZHA 2HI3A 3C2BA 1RR7A 1AHDP 2DMQA 4IHWA 3Q0WA 2JN6A 2LP0A 3H0GJ 5IP7J 1ENHA 1S7EA 4A3JJ 5K7FA 3O8GA 5EG0B 2NVYJ 1EF4A 1QVTA 3Q3SA 1RKTA 3RZDJ 3BQZA 1MBFA 1MBJA 1QPIA 3MVPA 4BY7J 4XIDA 3HOUJ 2DMPA 2M0CA 1ZR2A 5M5YJ 1AKHA 3A01B 2HOAA 1ETKA 5F1JA 2NVQJ 2DA1A 3ZQGA 4A3IJ 1H8AC 3CQZJ 3G1OA 2CUEA 4I76A 3QPLA 1IRZA 2X6OA 5EGOA 3HDDA 2DA5A 2JK3A 2M34A 5FKOA 5K7HA 3LSPA 3GTMJ 3GTKJ 2XSDC 5M5XJ 3BR5A 4MO7A 5IYCJ 2L0KA 2EBIA 1H89C 1B8IA 4A3BJ 1ZKGA 4JX5A 3JRCA 3S2HJ 3L1PA 1RESA 4G12A 2K9SA 3FIWA 1BL0A 3HOVJ 1I50J 3S2DJ 3FK7A 1U9OA 4IHXA 1IJWC 2NS7A 2OF7A 3HBLA 3GTJJ 5J1UA 3S1RJ 1LE8B 2MGQA 1W0TA 1RKWA 1FIPA 1D5YA 1Q1VA 3LNQA 2ID6A 1FJLA 3BG9A 1VF9A 2LR8A 2GBYA 1A5JA 5FKKA 2DMNA 5J3LA 4BY1J 5DTDA 2RAEA 4V2GA 3LSGA 3B6AA 2E2HJ 4BXXJ 4ABZA 3DCFA 1PUFA 3E7LA 3UKGA 1OJLA 3TW7A 2JA5J 4A3DJ 3A03A 2R5ZA 3LSJA 1TWGJ 1VI0A 1B72B 4AUXA 2AHQA 4A3LJ 1RPWA 3TEDA 1JKOC 2IEKA 4L5EA 1HCRA 3GTQJ 2PMZN 4FE7A 1U9NA 5JLXA 4X6AJ 1APLC 1UG2A 1P7JA 4J19A 4C3JJ 2Y9YA 3S16J 4FTHA 9ANTA 5BNGA 3HOXJ 2R5YB 3TP0A 2YS9A 4DYRA 5JLWA 1X2NA 3GTPJ 2JJ7A 1I6HJ 2YUSA 5C4XJ 2CRGA 3BR3A 4A3KJ 2YU9J 1E3OC 3ZQLA 1MH4A 2EQRA 2K9QA 3Q0VA 3SJMA 1ZK8A 2HYJA 5F08A 3JRIA 4W1UA 2VPRA 1TWAJ 4RDUA 5F0CA 5IP6A 4A3GJ 2H1KA 2EZIA 1U78A 4FISA 4QSHA 3JRDA 2ZB9A 3PM1A 3BR2A 1T33A 2CUFA 4IHVA 1ITYA 4HNVA 1ORKA 1QVUA 2M8GX 3JRBA 1GV2A 3I4MJ 1MSFC 3OSGA 1K61A 2DA3A 1AKHB 1ETYA 2NS8A 3Q0UA 3SDGA 5EYRA 5IYBJ 3OSFA 2AO9A 1OCPA 5IPAA 2H8RA 1HDPA 1WH7A 4Y52J 2HXOA 2CQXA 5EGOB 2G0EA 3HB9A 1HF0A 2DA6A 3CCYA 4BBRJ 1MBKA 4RBOA 1ETVA 4S0HB 3JRAA 1B8IB 3IV5A 4MFDA 2WV1A 1IDZA 1DU6A 3HGGA 2E2JJ 1UHSA 2XB5A 1G2HA 5IYDJ 4M3BA 4C2MJ 3GTGJ 4W97A 3S1MJ 1HOMA 5J1YA 3JRHA 1X2MA 4A3CJ 2E19A 2JA8J 1XS9A 2COBA 4XRSG 3HEFA 2P81A 1NK2P 3ZQCA 5C3EJ 4B1RA 5F27A 3QQAA 4JP0A 3RQIA 4DZJA 1QRYA 1MBGA 3A02A 4C3HJ 5M5WJ 3B6CA 1VFCA 5J1RA 1TC3C 4M6VA 4M3EA 4X1EA 1PUFB 3BR1A 2OPTA 1WGXA 2ECBA 3O8HA 2R5ZB 1GT0C 1MSEC 5FKLA 5IOZA 4UUTA 3S14J 4UUSA 1Y1WJ 4FCYA 2ELKA 1WH5A 1SFOJ 3HM5A 2Y30A 3H3VK 3CMYA 3K7AJ 5IP9J 4A93J 1F36A 4NDLA 3I4NJ 3BTJA 3TW6A 1JKPC 4EEFG 2L7ZA 1TWHJ 1JTXA 2ECCA 3W6VA 3M4OJ 5EDNA
chains in the Genus database with same CATH superfamily
1BJZA 2DTZA 2QSFX 5LLQA 3HOTA 4UUVA 1W7PB 2PQ8A 1KA8A 4DYQA 1XX5A 1G6NA 4AIHA 1GXQA 2P6SA 3ESWB 5LRSA 2LY9A 3T5XA 2QBYB 4GFBA 2DMUA 1R4MB 1MNDA 3NAUA 2CYYA 1O3QA 4A0ZA 2LREA 2DBBA 3E6BA 3FISA 1WWXA 4PFPA 3K9TA 2BHYA 2Y9ZA 3OYFA 1IF1A 4ZC3A 2BW3A 5H6QA 1MH3A 1VTNC 5M3FJ 1MMNA 2VONA 3OOUA 4YIFA 1Z05A 3PQJA 4U87A 3MQ0A 1BJAA 2ZMEA 2D2WA 4GYGA 2D45A 3PNYA 3LL7A 4B4CA 1FOWA 3LMMA 1BA5A 1YOVB 2D1VA 5HODA 5E20A 3LSHA 2JRMA 1BI1A 1PP8F 4RM3A 2OU2A 4OU0A 2DA2A 2K85A 3E1SA 5TGTA 3ZQHA 3MKLA 4AC0A 4EATA 2MH2A 1FMVA 3HPGA 1IC8A 1OKRA 3BZ6A 4YIIA 3OYLA 1X4PA 2XPUA 1KU9A 1A6QA 4XOTA 1ULYA 2M45A 4DQ2A 3KZIC 4Y17A 4A69C 4A3EJ 2K02A 4LLNA 3BR6A 4MIMA 1JJ6C 2FD5A 4NQWA 1ZLJA 2KIQA 3D1NI 1Z9CA 3EDPA 3TMOA 4HX8A 1UG0A 1TWCJ 2I10A 1ZG3A 3BG3A 1F9NA 4UV8A 2DQRA 4R79A 3QYFA 1O3TA 3F0CA 4R8HA 4QTRA 4M9XA 5EEGA 2KIFA 5KVRA 2MW8A 3AFHA 3LSTA 2KZGA 2XRLA 4HV6A 1RUOA 2PN6A 3TP3A 5L3GA 5A2QK 2E1OA 4JOMA 4R1HA 2IBDA 5K5RA 3ZMUA 4P1WA 1LFBA 2CV2A 1HSTA 5BPDA 4N4OB 2DK8A 3HOYJ 1R23A 2DFIA 3I54A 2IAIA 2XAQA 2ZO4A 4HNTA 1W5CC 4XMYA 1ZGWA 2XUBA 4NC6A 3L2QA 5HVQC 3FBNB 5ED4A 1YRNB 3OR2C 5EG0A 4PGGA 4CCLA 1HC8A 2XB0X 3W6KB 3ASOH 2XPVA 3HUGB 2LKPA 1IN7A 4Z6YA 3R61A 4RB2C 3HKZN 4K2EA 5IT9K 1VQNI 1BI0A 1OPCA 4XRFA 1FOYA 2A6EF 2K40A 1O3SA 1G3TA 5F0FA 1Z77A 2R7DA 3RDIA 3WHBA 2TDXA 4MNUA 4HF1A 2QA4I 2O7OA 2R7SA 4C9YA 2F5DA 1KQ8A 5ICEA 2BHZA 4IRIA 2NVTJ 3T1BA 4HYEA 2EV5A 1QZYA 3IAS2 4LLLA 5J6XA 2LNBA 4E7HA 4IHSA 2K9LA 1YS6A 2QQAA 2ZCWA 4ZZDA 4CCOA 1JGSA 1V3FA 3F72A 3QWLA 1X4OA 3DKXA 3BZCA 3S93A 4Y4RA 4XR6A 5EZGA 5FD5A 4I6ZA 4KYWA 2VE9A 3E3VA 2MC4A 2M9HA 3E5UA 3DBHB 4B09A 2JQ7A 1SAUA 3G1MA 3GZ5A 5E3OA 2ELHA 2HZTA 1CGPA 3SHFA 2JA6J 4UY8I 1TWFJ 1CF7A 3VYTB 3PUBA 1X1CA 3OIOA 5LGTA 2ISZA 2AQFA 4BH9A 3A2KA 1QU3A 4MFEA 2HKXA 2DQLA 3G71I 4LFUA 3IWZA 1VQ8I 3S2WA 2PMZA 5DS9A 2E1MC 2IP2A 4L0ZB 1UAAA 2B7EA 1MJ9A 5E3MA 2L02A 2DO7A 2K9NA 4LGWA 4M3DA 3DWLE 3DKWA 3FX3A 1RUNA 4WWCA 2FJ1A 2MBFA 2QUFA 4D7NA 5J40A 1IXRC 2HDCA 3JAMK 3V4GA 4XLFA 4BE1A 3OS0A 1DDNA 2G7HA 1BC7C 4HAMA 3HOSA 1FMWA 2VBYA 2HQNA 1EV7A 3CJNA 2RQQA 5E3LA 3W6JB 2EZHA 2PI0A 3L2WA 1UB9A 3V7RA 3SQNA 2DTRA 4IHWA 2R3SA 3CJTB 2XIGA 3VB2A 2E7WA 3M1EA 4RB3C 2GIVA 4UB6C 4KISA 4A3JJ 2OD5A 1LNWA 3DEEA 4C30A 3GMEA 3BJOA 4M73A 1RKTA 4IPAA 4BS9A 2IGNA 4NUBA 1R4NB 3DP7A 2Q1ZB 3CJRB 2VODA 1FOXA 3QOPA 4G6TB 5M5YJ 3G73A 3WU2C 2F5CA 1XMAA 2CS3A 3LFUA 3C2HA 3RTRA 3KP5A 4HEA2 2NVQJ 4U88A 2ZJQF 2CQ7A 3G1OA 2NYXA 3H9GA 3KEQA 1TT0A 3WE3A 2JK3A 2M34A 2OZUA 3S3MA 2R7UA 4RA2A 2M30A 2COMA 2QZ8A 5CQGA 1YX5A 2STWA 2L0KA 4M71A 1B6AA 2W57A 4AWXB 1RIOH 1SC7A 1B8IA 2WY8Q 1KYWA 1R5ID 2E1MB 1ZKGA 4ZTJA 4XLHA 3SZPA 1RI7A 2EV0A 3DBRB 1B59A 4FETA 2XF7A 3KYLA 1ZLKA 3MMYB 4FASD 4WXDA 3S3OA 3BP8A 3S2DJ 1BN5A 3FXMA 2X6XA 2NS7A 3HBLA 4B43A 3GLXA 3GTJJ 3S1RJ 3E6MA 3U21A 1KONA 5D6EA 1FIPA 1Q1VA 2ID6A 4BHBA 2ESNA 1VF9A 4AVPA 2K4BA 1A5JA 4IHTA 3KLNA 1A31A 4BY1J 4L9NA 1KGSA 2W1OA 3GWZA 1XGSA 5AONA 2FNAA 1C0WA 4A12A 3ECHA 1R6RA 2LY1A 3BZKA 4IOCF 1FLIA 1VI0A 2EPFA 1B72B 3OY9A 1RPWA 2J5PA 1JKOC 5JHFA 3GTQJ 4GRIA 2PMZN 2K7LA 3HJEA 1U9NA 4FE7A 1TW3A 3H92A 3NEUA 3ECOA 3VDXA 1JHHA 2L54A 2R5YB 1K78B 1XMKA 3IUOA 4DYRA 4KMFA 4HF2A 2JJ7A 1I6HJ 3GYHX 4BAYA 1DP3A 2M7BA 2QBYA 2ZNZA 5AIQA 1MH4A 3DFGA 5LEKA 3AL0C 3GFLA 4BEHB 3SJMA 3MEXA 5F08A 4P96A 1JE8A 2E34A 2VPRA 4GXOA 3BCAA 3MCZA 4A5MA 5IP6A 3TQNA 3J7AY 2HR3A 1A35A 4UV9A 2FUG2 2PG4A 1WQ2A 3HIFA 5LFAA 4AIJA 1FPQA 4II3A 2DXIA 2WB1A 3PSFA 3ZMZA 1OCOH 3PM1A 4L5IA 1ITYA 5HDNA 2IS6A 1V4RA 3F8NA 1I27A 3KP7A 2GA1A 2Y0SA 4WK8F 1QA6A 2LDUA 5TISC 1ZGAA 4L18B 3I4MJ 2VBZA 2LY2A 1SAXA 2VLAA 2CUZA 1K4SA 1ETYA 1VQLI 1IW7F 2IS1A 2NS8A 5IYBJ 3H5NA 3OSFA 1OCPA 2RKHA 1Z21A 2A3SA 3HHGA 3F22A 2H8RA 1DPRA 1HSJA 4Y52J 1D8JA 2KP6A 2VQLA 2OQGA 5ILUA 2CQXA 2HS5A 3HB9A 2IXSA 3OL4A 4RBOA 2WADA 2W84A 3R0JA 4LB6B 2VJJA 2A69F 1QHGA 3KEYA 4M9ZA 2M87A 1DU6A 5CQEA 3FWEA 1UHSA 4XLAA 1NG7A 2F4MB 2ZXJA 3N97A 4CICA 2E1CA 5DUKA 4KIGA 5JVTA 2KIMA 1BM9A 4B44A 1W36D 4GDFA 3W3CA 1N77A 3S1MJ 3KCCA 4ENKA 4MEYF 3JRHA 2JA8J 1EJ9A 4IL6C 2DOFA 3HEFA 4PJLA 3A0BC 3BDDA 4B47A 2NNYA 2Z9OA 2MYSA 3ULQB 5FLXZ 4A0XA 1EA3A 3QPHA 4DOZA 4ZTFA 2GXGA 2PMUA 3QQAA 3ZN1A 1P9QC 4DZJA 4HOBA 3FXJA 4E70A 1IN4A 3KP4A 4M72A 2X1DA 4I0BA 4C3HJ 3FXRA 2EJRA 4KT6A 2EFQA 3SXYA 5K5QA 5LRRA 4M3EA 3RPUD 3CTAA 1PUFB 3SYTA 1N75A 3DTIA 3K2ZA 3SFZA 3H9JA 2QQBA 3O8HA 4XKBA 5CKTA 1IN5A 2R5ZB 1GT0C 4XSXF 1IAWA 4ZJZA 1FP1D 2L9SA 2VE8A 3HSFA 3HM5A 3ZGKA 2L3DA 2ZXHA 3HUGA 2Z1DA 1U5TC 2MLGA 4A93J 1F36A 4NDLA 2M4GA 3BTJA 4EEFG 3W2WA 2XAGA 4IQJA 4DNCA 1UFMA 3KEOA 3CO6C 2AXTC 2HPIA 4D9JA 1Y6IA 1ZYRF 4O5VA 2BBYA 3OYJA 2FQ4A 4JX4A 4QIWN 2I5UA 3LQQA 2DT7B 3JTGA 4JYKA 5KNLA 2P5VA 1VQMI 3OWTA 3BG5A 2YPRA 1SD7A 2CH0A 4PCQA 4G7HF 4E7LA 1V5FA 1S72I 2HXIA 2KMUA 1W0UA 4LG0B 1Y1VJ 1MKMA 3ONQA 3CUQC 4A3FJ 4UNOA 2ETHA 2A07F 4GGGA 2OTLI 1TQPA 1I5ZA 2A5WA 4LK1F 1R9TJ 1MBHA 5E1WA 2LFBA 5KCMA 1V5EA 3RI4A 2WB1N 4D5CA 2DPDA 1WPKA 2ME0A 3PFIA 4V2FA 4XN0A 1P4WA 3SEQA 2JA7J 5D4SA 1IRFA 2OUMA 4YFNF 2Y0SN 1O4XA 4BHCA 1XGMA 5DYMA 3HL2A 1ZARA 1HW2A 2IVMA 4RGXA 2L2OA 3S1QJ 2W85A 4LIVA 4BXUA 3PO3J 3CDIA 3P9IA 1KQ0A 4DBRA 2HOSA 1MJAA 2CFOA 4G6DA 3M3YJ 5EZHA 4BKXA 2NOGA 2MD5A 4I09A 4KDPA 1X3WB 5F6FA 1SMYF 5E3NA 2GXBA 2CGPA 1Z91A 4G94A 3GFJA 2XKOA 1Z7LA 3HOZJ 1XGNA 2OBPA 1ZN2A 1YX3A 1MZBA 2DMTA 3FM5A 4U0YA 2RQPA 5L3EA 3GTOJ 2JWTA 2LVSA 2NAZA 3ZQFA 5ICFA 3B02A 2VL8A 3GO5A 1VQ6I 3ZOBA 2OA4A 1T56A 1BR4A 1X3ZB 3GEZA 1FEXA 3I56I 3R4KA 1IV8A 4XRMA 4OINF 1TLHB 4LB5A 4Y13A 4F92B 3MKZA 5L3DA 2QCOA 3ML6A 4ON0A 5EEHA 5KAIC 2EIMH 2LD5A 2JMWA 4ASNA 3L00A 4NB5A 3DV8A 3CO7C 3TO9A 3FXUA 2HVQA 3F23A 3PO2J 1SFEA 4BL0B 2Y0MA 1D0YA 2ACJA 3CUQB 3CCSI 3O6BB 4EJTA 1W36C 3FKIJ 1LFUP 2XGDA 4WF2A 3PUFA 2V6CA 2LK2A 4YFKF 1WZ2A 3OYAA 1W5SA 1ZGJA 2N8GA 2VT3A 4IEJA 3E6CC 1R5GA 4YG2F 3S17J 3K6GA 3NWTA 2EH3A 5HLIA 4CO8A 2XASA 1J0RA 2X9DA 3H3ZA 2DT6A 2G9WA 3RYRA 3I5UA 1VZ0A 2FSWA 4FQGA 2XPWA 2EA4A 2IPQX 5DD4A 4XNFA 3LAPA 3KP6A 2DCEA 4H0EA 4I2OA 2VI6A 4M9SA 4YFXF 5LD2C 2KZVA 2DDBA 2EV6A 2QWWA 2HFHA 3CDLA 4XLCA 4UVBA 2VT2A 3IL2A 2X1EA 3EYIA 2JVHA 4B8XA 4XL9A 5DDGA 2K86A 2VKEA 2BXYA 2FF4A 2DPUA 1MBEA 3BG6A 3FMSA 2HOEA 4G6QA 2VB6A 1O57A 3GBGA 2XGCA 4XRSA 3FXLA 1IGNA 4GYIA 5TJJA 1DPUA 4X0GA 1MNMC 3BY6A 2V79A 1FIAA 2FX0A 3IKVA 4XSZF 5F0HA 1J09A 3ZR8X 1O3RA 5KHDA 2HGCA 1E3PA 3TKYA 2NVUB 1OQYA 3G4SI 4F3QA 1WCMJ 2R4GA 3V8JA 5JFRA 2PEXA 4V19K 1ETWA 4EJVA 3BQYA 4G7OF 4DGWB 2DJNA 2FOKA 2KLOA 3X2QH 1OR7A 2L7FP 2IGKA 2LKXA 1FY7A 4LK0F 1OFCX 1I39A 1B72A 1HBXG 5IY5H 4IX7A 2GLOA 3CCVI 4OMZA 1XCVA 2MSYA 2DN0A 3IH3A 2GM4A 4HQMA 3R60A 1H88C 1WI3A 2W7NA 1FNNA 4D1QA 2K5CA 5C4JJ 3OYCA 1FWZA 3IRRA 3GUDA 2KKOA 1WJBA 3K69A 5DV5A 2R5YA 1K78A 1K83J 3BLYA 4I02A 3BTLA 2BY2A 1OCCH 2B0LA 2BZTA 4IRHA 3QRFF 1Z7UA 3U1KA 4DYCA 4HLXA 4BEHA 3CCRI 2VQCA 1RR7A 2WC2A 1KYZA 2XAHA 3KZZA 1J2XA 2DU9A 2IJLA 2DMQA 3BWGA 4ZYGA 4BQQA 3H0GJ 3ISPA 5IP7J 1E17A 3MKWB 1FOKA 3O8GA 2NVYJ 3WTYC 1EF4A 3F8BA 4BU2A 4KFCA 2VASA 3BQZA 2DJIA 4BACA 4YRVA 1QPIA 2FQ3A 3IAM2 2JRTA 2DMPA 1KZHA 1UZCA 1ZR2A 1XDSA 1A36A 5D5XB 1FSEA 3A01B 2O61A 3HC7A 3RQ4A 5F1JA 2E35A 3BG7A 3CCEI 3DPTA 1GVJA 3ZQGA 2DW4A 3MWMA 4EV0A 2X6OA 3GTMJ 1HQCA 2DA5A 2KRFA 2FBIA 2XAFA 5FKOA 3BC8A 5K7HA 4L0YB 3GW2A 3BR5A 1UHWA 5IYCJ 2GOMA 2Z33A 4OIQF 1BIAA 2EBIA 1H89C 2PBIA 2F4OB 1KU3A 1TBXA 2L5QA 2Y75A 4Q5SF 2Q0OA 3FIWA 1BL0A 4C2TA 2FXAA 3BROA 3CD6I 1X1PA 1QO0D 2AQEA 1U9OA 4OMYA 2Z3YA 1IJWC 1YS7A 2P5KA 2MFZA 5FROA 5J1UA 4MQVA 4E4HA 1LE8B 3P9CA 1FBQA 3VSKA 6PAXA 3OYGA 3KFWX 3K70D 3LNQA 2YX4A 4ZDPA 1LDDA 1T95A 2DFEA 4I7HA 1TNSA 2LR8A 2CFXA 4AIKA 2DMNA 2HNHA 5J3LA 1VQ4I 3WTWC 5FLXK 3CMMA 4LG3A 2JUGA 2RAEA 4Q48A 5JR3A 2AS5F 2BY1A 4BXXJ 4ABZA 1PUFA 3E7LA 1LKXA 1TQIA 2AXLA 2GXAA 2JA5J 4OIOF 5HDKA 2R5ZA 1QHHD 3JTHA 4CCKA 3I64A 1D1BA 1SD5A 5JVGF 1YIOA 1Y0UA 2IEKA 1HCRA 1S3JA 1ZRDA 3OS1A 4S04A 2BOLA 2WBMA 3OR1C 1P7JA 3PNTA 5J4VA 1RZ4A 4FTHA 5BNGA 2LF7A 3HOXJ 1J75A 4XN3A 2RC4A 2XF5A 1XDUA 3KYDB 4M74A 2YS9A 2P8TA 2GIZA 3TP0A 1YI2I 4A0YA 5C4XJ 3K1NA 3BR3A 4OIPF 3GCMA 1SFUA 3P7NA 1E3OC 2EIKH 2L01A 1MNEA 4A6DA 5HS7A 1GXPA 2K9QA 2CW8A 3DBLB 3K10A 4AIDA 3L09A 2FE3A 1R00A 3T0YA 4A3GJ 2CW0F 1WRJA 1P6RA 1K4TA 2V9KA 3CCLI 2H1KA 3WTZA 1BOAA 4LG0A 5HS8A 2VQGA 3O3KA 4QSHA 2PJRB 3IHUA 3JRDA 5E1ZB 2WAQA 1T33A 2LOOA 5LBQA 2Z16A 4ZYEA 4HNVA 1ORKA 1XGOA 2M8GX 3JRBA 5FRNA 2CQNA 3M8EA 4CA0A 4XLPF 2WWYA 1MSFC 3RKWA 1T0FA 4G9YA 4PUSA 3OSGA 2D1HA 2A6HF 2E7XA 2Z2SB 1AKHB 2E71A 2HWVA 2XAJA 5EYRA 5F1RA 3ASNH 1X19A 3C1DA 5IPAA 3R0AA 3OYIA 3VYUB 1T38A 3WGHA 2NXNB 4FX0A 5F64A 4S0HB 3JRAA 3QODA 4IVNA 2VC1A 4Q47A 5FD6A 3ABKH 4E7IA 4MFDA 2WV1A 1NH3A 4CHUA 3AAFA 1YLFA 4ENMA 4BJTA 2V1DA 5BPIA 1S9HA 1SEUA 4W97A 4II2A 2QVOA 3GTGJ 4WX9A 1S7AA 2CO5A 2EWNA 2R7XA 1MMAA 1X2MA 1USSA 3H9QA 2QKMB 3KYCB 4ZYHA 2COBA 3JSOA 2K27A 2HPMA 3LSKA 4XLNF 3AKZA 2Z99A 4RB1A 1I1SA 1HKSA 4O3MA 4HZFA 1J59A 3QU6A 3E97A 3WTXC 5J47A 5ILSA 2JPCA 4B3XA 1PVEA 1MBGA 3A02A 2VQHA 3M07A 1VFCA 2A68F 1KU2A 3DEUA 3OIQA 4NNJA 4M6VA 1YJWI 2XV4S 4LITA 2F2EA 2KFDA 4X1EA 3L2UA 2OPTA 3RKYA 3N4MA 2ECBA 1PYVA 4XM3A 5IOZA 3CUQA 3S14J 2O0YA 3CF2A 1MIJA 1G3WA 2ELKA 2XVCA 3K4MA 2JSCA 2LRDA 3HXLA 4KITB 3EPZA 4RLFA 5L3CA 2QQ8A 3I4NJ 1JKPC 1AWCA 2VIXA 2KPMA 1JTXA 2MC3A 4EGYA 3M4OJ 1R1TA 4HPQA 1ZRFA 4P55A 1I1GA 1D3YA 3IRQA 3ABLH 3DTEA 2DYRH 1YITI 1ODDA 4MQ9F 4D7MA 5FO5A 1LEBA 5D6FA 3EQLF 1XSDA 3OYBA 2WTEA 3V7CA 2XGEA 1WSUA 2KDZA 3EUHA 1ACIA 3QPTA 4DIQA 4KNYA 3J7YJ 1WJEA 1GLNA 1W7PA 4U7BA 1AA7A 4BJ5C 3S3NA 1FBUA 2EFNA 1MMGA 1J9IA 1RRJA 3OIPA 2VKDA 1R1VA 2WA0A 2CV0A 2HQ5A 2WAEA 1A04A 4BQOA 2HQAA 2WAQN 4HRIA 3K4LA 3AG1H 3ZCOA 4WCGA 3WGIA 4CGZA 1IN8A 1DUXC 1Y8QB 3PJRA 1Y0NA 4A2UA 1JT0A 3KP3A 4DW6A 2R7OA 5DD8A 3I55I 3HTSB 1ETXA 2R93J 1SVOA 3HRMA 1N25A 1ZTRA 5GPAA 2CQQA 5CLSA 3DEWA 3RJPA 2QENA 2QGUA 1OYWA 2LTPA 4Y7NJ 3ZRGA 3DPUA 5FJ8J 4BBSJ 2EB7A 1B9NA 3BTIA 1RNLA 1UMQA 1XCBA 4LMYA 1DU0A 1HXDA 4NHJA 3TDUC 4MLOA 1XTAA 2DAOA 4ZYAA 1W5TA 1W4MA 4QLCU 2G7UA 5LEJA 3JRFA 2XF6A 5L3BA 3GX4X 1YTYA 5F04A 1N78A 2MH9A 3S1NJ 2R7TA 4AYBA 2XGXA 3GZNB 4FE4A 5IOYA 2ZC2A 2KDOA 2FMLA 2V7FA 3HGYA 5DCFA 4HDVA 5GP9A 1TP4A 1BI3A 1LVAA 1G4DA 2NVXJ 1Z6RA 1F43A 4E7KA 2VBWA 3HYIA 3CLOA 3KX2A 5D8KB 3SDBA 5GPCA 2PJPA 2QEXI 2VXZA 1MDMB 4MHGA 5FLMJ 4XK4A 4MEXF 3JREA 1GDTA 3ABUA 2Q2EB 5J8FA 2X0LA 2B9SA 1D0XA 3IWFA 1J7KA 4FT8A 1XG1A 1R36A 3D5SC 1WFXA 2F5VA 1IV6A 2QKLB 4EM0B 1BW5A 2O9LA 1WJ5A 3H5AA 1V54H 3ZN0A 4JX6A 1QNTA 2A05A 4UHTA 5CVVA 2MLKA 2TCTA 1K6OA 4I0AA 4IRGA 3AL0B 1R22A 4CZZA 1Y56A 5M3MJ 4NBQA 4ZDOA 2XROA 2BY0A 5EF6A 1V5GA 1FYLA 1JUMA 4LOCA 4RGRA 1FZPB 2VOPA 3S15J 4XLEA 4OAYA 3A01A 1Z6TA 2K3FA 1ZQ3P 2Y2ZA 2HOTA 1XPXA 3GZ6A 3G1LA 5FFXA 1YRNA 3CLQA 4UXNA 5LGUA 1U8RA 3RCOA 4E7SA 4RAFA 2QF7A 3NARA 1LQ1A 1U0JA 3RZOJ 4XORA 2EILH 3MFKA 1OLTA 1X58A 5FFZA 4A5NA 2ZJRF 4OWRB 2HVRA 1IO2A 2F48A 4HX4A 5EJCA 4IZZA 1ZG1A 1G3SA 4XQFA 4RGSA 3VWBA 3RKQA 1IG7A 2KRHA 2EFOA 5DM7F 1Y39A 1QZZA 2TRTA 1BBYA 2OCCH 3I0TA 2LC2A 4M3FA 1XC5A 1NK3P 2CWEA 3ZMDA 1IUYA 2DA4A 4XKCA 4CYCB 4Y33A 4EVIA 2ZFWA 1MW7A 3CC7I 5FKNA 1MMSA 4HG2A 2JVGA 2ISYA 4ESFA 3U1DA 3NRVA 3WTTC 1BI2A 2FOWA 3K1PA 5DCMB 1LE8A 2MA3A 1JUPA 3GFMA 1SMTA 3LA3A 1MD0A 2X51A 2GZWA 3IH4A 3M7GA 4ITVA 2V1XA 3CESA 2R7RA 2PFBA 3OS2A 1NTCA 3I3LA 3WG9A 2LLKA 3CCJI 4EJUA 2V1UA 3LSIA 1R58A 2OAZA 2M3AA 2VKVA 2DA7A 2ZXWH 4PDKA 4LIUA 2LG4A 3SFIA 2GWRA 1D1CA 1STZA 3KLOA 2B63J 2ELJA 2ESHA 1DQUA 1XSVA 2KJBA 3QP6A 1PUEE 3FF5A 2UWMA 3PFYA 1WJDA 3BJ6A 3GTLJ 1D1AA 2BE5F 3UR3C 3ZQ7A 3CUOA 1P7IA 2V9PA 1IUFA 3FXQA 5IT3A 2EFWA 1X1DA 5E18F 5FLVA 4AYBN 2H94A 3HSRA 1JKRC 2E5ZA 2R0QC 1U5TB 3C2GA 5CVRA 2L9RA 2D5VA 3Q9SA 3C2BA 2H09A 5BS6A 4BQAA 1AHDP 4BQNA 1IRGA 3PIOF 1SVLA 1ZH5A 1NG6A 3C3WA 3Q0WA 2JN6A 3CC2I 4Y3OA 2IA1A 5JI6A 2PJRA 4KIFA 2DFHA 5K7FA 5GADJ 2L4MA 2V4JC 3FMQA 3Q9VA 3REOA 4CYDA 5BOXA 5HDGA 3RZDJ 2UXXA 2M7AA 2M8EA 1MBJA 2QM3A 3M8FA 4EM2A 5E17F 2HTSA 4KN7X 2JT1A 4BY7J 3H3UA 2R7QA 5K1YA 1AKHA 3ZQQA 2HOAA 4PGHA 3LWFA 4RAYA 2ZBKA 1F1ZA 2R7WA 2XKPA 2XC7A 2DA1A 2FRHA 2L9NA 4BYYA 2A5YB 1VQ7I 3PNVA 2EFPA 2CUEA 4I76A 2HVSA 3QPLA 3H36A 4KT5C 5DEQA 1IRZA 2KL4A 1TW2A 5B3SH 1LFPA 3LSPA 1WI9A 2XSDC 1YIJI 2HEOA 1REPC 2ZSHB 3HRTA 3K4JA 3O2PE 5DUIA 3J7ZI 4F7ZA 5GTIC 3A1YA 3WTUC 1B9MA 2VJIA 4A3BJ 1R71A 1YE9A 4D0PA 4EM1A 3S2HJ 2BGCA 1RESA 3N05A 1HW5A 3K4KA 3GFIA 1I50J 2CMPA 2XHKA 2IGOA 3TOBA 1WVRA 3SEZA 3BOQA 2FA5A 3ROUA 2MGQA 4M6XA 5E8GA 3AG2H 3J80Z 2HDWA 1BR2A 3TO7A 4L9JA 4HSRA 2M4KA 3RIRA 1BOBA 1LEAA 2OC6A 3BPXA 2GBYA 3VODA 3I4PA 5FKKA 4L5JA 1XD7A 5CVIA 2VC0A 3CZ6A 2Y69H 4V2GA 3LSGA 3B6AA 2IA0A 4HDUA 4S05A 2E2HJ 3C18A 3UKGA 2JA2A 1H0MA 4CH7A 1OJLA 3QYBA 3TW7A 4A3DJ 2W24A 3HSEA 2HZDA 3A0HC 3LA2A 3LSJA 3CDHA 3OYKA 1TZLA 4MTDA 2KISA 2GAUA 4AUXA 2AHQA 3U2RA 4HBLA 4IOAF 3TEDA 1DGRM 4AU7A 4L5EA 5LHGA 1P4AA 1E3HA 2ZXIA 5JLXA 4FHTA 4RS8A 3RSNA 1APLC 3OL3A 3A4CA 3ELKA 4J19A 1FYMA 3S16J 3DQVC 2ZFUA 1IZ1A 1OYIA 4AVZA 2OJED 9ANTA 4C2UA 3E5XA 5JLWA 3GTPJ 2H8WA 2YUSA 2BXZA 3DU5A 3VYSB 2CRGA 2X1CA 4A3KJ 4AM3A 2CQKA 3D5LA 2DYSH 3PL8A 2EQRA 5ICCA 3Q0VA 1ZK8A 2WAFA 2BY3A 4OAZA 4W1UA 1T39A 4KIBA 3KETA 4RDUA 5F0CA 2GQQA 2FMYA 2JSPA 5AIPA 1EH8A 3H35A 4F91B 2HU9A 2M0MA 3L2CA 1ERDA 2EZIA 4FISA 2LSOA 3J81Z 1E2XA 2VKHA 5GAGJ 2E60A 4ZZLA 2CUFA 4IHVA 4BDZA 4E7JA 3ZPLA 1O7FA 1TQMA 3K4BA 3LSMA 1ON1A 2UUZA 4J00A 3CMEI 1Z3YA 3CP8A 2RNJA 3Q0UA 3SDGA 5HS9A 1D5VA 2AO9A 2XSJC 5HLHA 2P7VB 1HDPA 1WH7A 1MJBA 2HXOA 4RAZA 5EGOB 1Z3XA 5J4YA 2DDAA 1BC8C 1BIBA 2DA6A 3CCYA 3MZ8A 4BBRJ 4BE0A 5HLTA 2VOOA 2DLLA 3DPLC 3L7WA 1X3UA 2HYFA 5B66C 5D5UB 3FKJA 1K7AA 3HGGA 4ZH4F 1DP7P 4E7ZA 2E2JJ 2XB5A 4YEJA 2PX9A 4HX7A 2W25A 4BXFA 2STTA 1YJ9I 1PJRA 4KJZA 1U3EM 3HPHA 3ERMA 2IS4A 5J1YA 1UCRA 1XS9A 5HOOA 4XRSG 4P9FA 3IC7A 1NK2P 2KHMA 4BUPA 1YW7A 3F9KA 5C3EJ 1Q1HA 1T98A 4B1RA 5F27A 2KIUA 1VQOI 3H0DA 1MDMA 1QRYA 4NC8A 5M5WJ 3B6CA 4OIRF 3CMAI 2Q2EA 2Z5UA 1R49A 4TV7A 5K5OA 4GCVA 4UVAA 4HW0A 4PJMA 2OCEA 4XKVA 1WGXA 3W2AA 1MSEC 4UUTA 2IGMA 2IA2A 4FCYA 1WH5A 1SFOJ 4ESJA 3H3VK 3QP5A 4JK1X 3ZXSA 3CMYA 4PK4A 2UXNA 3NQOA 4E6KG 1KU7A 3OOPA 4Q4ZF 1QPMA 3TW6A 3FXOA 1TWHJ 2LKSA 4YELA 2ECCA 3W6VA 1OYYA 4U0WA 1TNTA 2ADUA 2HYGD 3ZMSA 3CF5F 1GV5A 1W1WE 2VXDA 5DM6F 1ZREA 1IRXA 3ZP5A 2RV8A 2NOJB 5HNFA 2NNNA 1LUJB 1UHMA 4YIRX 2UZKA 4HLYA 2E2IJ 4BE2A 2YX7A 3BJAA 3E5QA 2LBFB 5H20A 3CCQI 3H1CA 1ZHFA 3BR0A 3LOCA 4LD5A 2HTJA 1I3AA 3S32A 1XB4A 3QAHA 4XKWA 3JR9A 2VPLA 2HQRA 4MTEA 3BPVA 2IW5A 4IXAA 2M2EA 1G59A 4BGDA 2LYCA 1ETQA 1ZRCA 3JCUC 2BEOA 2MG4A 2L7MP 4CYCA 1FTZA 4P9UA 4I99C 4FX4A 4PJNA 2JZYA 1MGTA 3G2BA 4PSWA 1S29A 3BCBA 4RAGA 2E5NA 2DOEA 4HSTA 1A6IA 2X48A 4ZYDA 5DCMA 1GVDA 4L9VA 5B1BH 5GAEJ 4KA4A 2ICWG 2V1NA 3VPRA 5LHHA 1S5LC 1I6XA 2EZLA 4Y15A 1D8KA 1T08B 2RDPA 3CCMI 5H6RA 1P4XA 3WGGA 1S7OA 2ZKZA 1JJ8C 1F4KA 2CJJA 2KT0A 2A61A 4OOIA 1RETA 5D8LB 1POGA 1JI8A 1S8NA 1U8BA 2W48A 3H5RA 4ESBA 1Y8RB 5FGMA 5K7ZA 1ZG5A 3JW4A 2BVLA 2ZMEC 2K4JA 1SFKA 3OYEA 2QLZA 3LFKA 5L3FA 4N9HA 2FNPA 5ILVA 3BT9A 1JGGA 1D0ZA 3E0JB 1B4AA 3IP4B 4J01A 1QBJA 4IKFA 5FKMA 2M1BA 4QWQA 3K2AA 4A3MJ 1TL8A 2W4SA 5E79C 3VEPA 3QOEA 2XRNA 1OR7C 3ZMVA 2EINH 1LPQA 4KMUX 4RMNA 2NS0A 4PZJA 1BW6A 1IDYA 3L2VA 1OCTC 2DK5A 2E1NA 3F6VA 1ZELA 1G8XA 1QGPA 2CG4A 2M5WA 3I59B 2F6CA 3F8MA 4XICA 3S8PA 1U5TA 3OMYA 4M3GA 3AG3H 5CYVA 3HOWJ 1SFXA 2RGVA 4IHYA 2YR2A 3RPQA 1YQAA 3QPSA 4P5OA 4RM2A 1IXSB 4N0BA 1JUSA 3L9FA 4C3IJ 4XBFA 1L0OC 4ZDLA 5LGNA 3FDYA 4UUSB 3MZHA 5B1AH 1XN7A 2Y31A 4NC7A 3VOEA 2O8KA 3VFZA 2R7VA 2HKOA 1JT6A 1JKQC 3QU3A 1YO5C 3HTUA 2HDDA 5CVJA 1SANA 3IH2A 1GUUA 4U7DA 4L9TA 4D5FA 3F6OA 1FT9A 4CSWA 2O6GE 3Q5FA 5H2FC 3KE2A 1ZR4A 1T8IA 2BV6A 1I3QJ 2W82A 2BW3B 2EZKA 3OV8A 4CDGA 1ETOA 1HDDC 3K70C 3P9KA 4F52A 1JXSA 4IJAA 1LJ9A 3WHCA 3WU0A 2QSHX 2ZMEB 1HLVA 3P5JA 3V42A 5D5VB 4DBQA 5E1XA 5BMZA 2Y48A 3JRGA 1CQTA 4HNUA 1FTTA 1WJCA 2ID3A 3L2RA 2KJCA 2WY7Q 3IKTA 3W2VA 1U6GA 2OZ6A 1K6YA 3BTCA 2GOXB 3NWSA 2K9MA 3F8CA 4CCJA 3ZQIA 1VNDA 3DLAA 3V8LA 2OQRA 3E6DA 1FP2A 2P6TA 2RNGA 2X4HA 3U9GA 4EQQA 3J80K 1JTYA 1L3LA 3VYRB 3GF2A 2R92J 1HKQA 4ENNA 1ZAOA 4B3AA 4IQ4A 1H9TA 2R7ZJ 4WXCA 1KQ9A 2V9VA 4GO1A 4NQWB 3FK6A 3B73A 3T8TA 4CCMA 4UB8C 1SD6A 3AG4H 2ME6A 1FBSA 5KAFC 3FM3A 2EK5A 2GA2A 2ZJPF 4DZPA 3MN2A 4CUGA 4QPQA 4ETSA 3DTKA 5C44J 2L9VA 2H1LA 3OYDA 1OISA 2L7KA 5FB2A 3LSRA 2CU7A 1YFHA 1AU7A 4BNCA 1WHUA 2BYVE 1T2KA 3M1CA 2CW7A 2Q8KA 1X1BA 1USTA 1RC9A 5A2QZ 3GXOA 3MKYB 2JTVA 1R5HA 4AD9A 3RYPA 1W7PD 1PDNC 1G3YA 3HRSA 5CJ9A 4BDYA 2VUMJ 5EEAA 1XSXA 1Z0XA 2LF8A 2VBXA 3I53A 2IT0A 2HI3A 4EJOA 3ABMH 3OYHA 3HHHA 1EKEA 1FYKA 2YSRA 1OCZH 3TL4X 2F5FA 2FBHA 3F3XA 2LP0A 4XOPA 2KRCA 1ENHA 4EJWA 4KN4X 1S7EA 4G8XA 5GAHJ 4JBAA 5EG0B 4N4NB 3M9AA 3TO6A 1QVTA 3Q3SA 5IT9Z 2W00A 3FHZA 2ZNYA 3FZVA 3PSIA 1MBFA 1FX7A 3J81K 3PIPF 3F8FA 3D0SA 3MVPA 3RPUA 4EMSA 3FXKA 4XIDA 3HOUJ 2DFFA 4CZCA 4U0VA 2DODA 2M0CA 1U2WA 5KK1A 3KPHA 3TGNA 2VJ4A 4EGZA 1ETKA 2V26A 2P7CB 5HNHA 1B1BA 1R1UA 2DI3A 1OMIA 1IN6A 4A3IJ 3COAC 3CQZJ 4BJ6C 1H8AC 3ZMTA 3CC4I 2RN7A 5EGOA 3HDDA 1E0EA 3C7JA 2H6BA 4ENJA 2LMDA 3GTKJ 3K1MA 5M5XJ 2QSGX 1P2FA 2BVMA 1T0FC 2JPBA 4MO7A 1UELB 2MABA 2YU3A 3J7AO 4O6JA 2F5EA 4LJZF 2EIJH 2UV1A 3K4NA 2A6TA 3G6EI 4WXHA 4JX5A 3JRCA 4PJ0C 3L1PA 3PQKA 4G12A 4RGUA 2O3FA 1YG2A 2K9SA 2EA2A 3WE2A 3HOVJ 3K4CA 3FK7A 3R6SA 1F5TA 4QPOA 3TBIA 4IHXA 3OYMA 2XAUA 3DXJF 1SVMA 2OF7A 3KP2A 5B5EC 3EYYA 1W0TA 1VQPI 1RKWA 5TRDA 4F55A 2X85A 3HG9A 3UNGC 3F21A 1D5YA 2K3PA 2H27A 1FJLA 3BG9A 1MMDA 3FBIB 4F93B 4KICA 1CF7B 1HKTA 2P0WA 3KZYA 1AOYA 1DGWY 1P92A 5LHIA 3DU6A 5DTDA 1S6LA 1H9GA 3DCFA 3EUAA 3LQRA 2PMHA 2X6YA 3FMRA 4KUMA 5J8CA 3DLLF 3A03A 3I71A 1WJFA 1EH6A 2WV0A 5CVUA 1TWGJ 2R7FA 2CV1A 4A3LJ 1VQ5I 4HV5A 4PFOA 2C6YA 4DJAA 5D4RA 3GLLA 4HA8A 3JAMZ 4X6AJ 1UG2A 1IXCA 4LLGF 2RREA 3HRUA 4C3JJ 2Y9YA 2H6CA 2F4IA 1HA8A 1YYVA 3MAJA 1X2NA 4BHPA 2CSOA 2E36A 1TT5B 1SD4A 3I58A 2YU9J 3ZQLA 2O03A 2O8XA 4RB0A 1J5YA 2HYJA 5BQTA 3JRIA 1R7JA 2LBFA 2ZSIB 5JHUA 1LVKA 1OCRH 1TWAJ 5ICGA 3HZJA 4IF4A 1QZEA 4B48A 3ERED 2NRAC 3LA7A 3SZGA 4XONA 5GTHC 1U78A 2XDVA 2ZB9A 3BR2A 1V55H 1UJ8A 2PLYA 5HLGA 2QQ9A 4RLQA 3WODF 1QVUA 3WG7H 1GV2A 5CPRB 1WKMA 2CUJA 3M8JA 2IRFG 1K61A 2DA3A 2J5OA 3EUHC 1YW9A 1BR1A 2JUCA 5FRMA 4I98B 4PSXA 3CCUI 2KQRA 1PP7U 1JHFA 4IO9F 4HQEA 1O7LA 3TDZC 2LH9A 4JQFA 1YHQI 3ABTA 3DKYA 4HF0A 1Z1DA 2G0EA 1HF0A 1LDKB 3K0LA 3RKXA 1MBKA 2I8DA 1RR8C 1ETVA 2OV7A 4CCNA 1VQ9I 3DF8A 4CXFA 1B8IB 3IV5A 1Z67A 3CP2A 2OTJI 1IDZA 3MD2A 4ANJA 3LAJA 3EUKL 3V7SA 1EH7A 2IS2A 1G2HA 1NHAA 2VJ5A 3I9V2 4M3BA 4C2MJ 5IYDJ 3WU1B 1HOMA 4A3CJ 2E19A 4PJJA 4M6YA 2FEZA 3VSLA 3G3ZA 3D5RC 2DOAA 4I01A 1XMXA 2P81A 2DT5A 3ZQCA 3TOAA 5E8IA 3JSPA 1TTYA 2FU4A 1K79A 2ZJ2A 1T6SA 3GVAA 4JP0A 3RQIA 3I59A 4A6EA 2FBKA 1ON2A 1WJAA 5J1RA 2P4WA 1YW8A 2P5LC 2L4AA 2RVCA 2X6WA 1TC3C 4Z2YA 4G7ZF 3KIOA 3WTVC 2MD0A 4MGRA 1LB2A 4H4KC 1ONVA 3BR1A 3V8KA 3EETA 3QYEA 1LDJA 3HKZA 5FKLA 3WTSC 1YJNI 3SZTA 3FHNA 4UVCA 4UUSA 1Y1WJ 3OYNA 1FC3A 2Y30A 1HW1A 5ERIA 1FSHA 3CJQB 1GHCA 3K7AJ 5IP9J 3T8RA 1VQKI 3MZYA 2QYOA 5D5WB 2V6EA 2VN2A 1X1AA 4N9IA 2L7ZA 1M1EB 1QQIA 2O5RA 5EDNA
chains in the Genus database with same CATH topology
1BJZA 2DTZA 1GV5A 4DYQA 2LY9A 2FQ4A 4JX4A 4GFBA 2DMUA 3NAUA 4QIWN 4D7MA 3FISA 2E2IJ 2Y9ZA 2XGEA 4JYKA 2KDZA 1MH3A 5M3FJ 3OOUA 3BR0A 3BG5A 3LOCA 3JR9A 2HXIA 1W0UA 1Y1VJ 4A3FJ 2M2EA 4B4CA 1ETQA 1BA5A 1R9TJ 4CYCA 5HODA 2MG4A 1MBHA 2L7MP 1FTZA 2LFBA 2HQ5A 2WB1N 1A6IA 2DA2A 4D5CA 2WAQN 1WPKA 3ZQHA 2ME0A 2X48A 3MKLA 4V2FA 1GVDA 4AC0A 2JA7J 1IC8A 3VPRA 2Y0SN 1O4XA 1JT0A 2XPUA 2EZLA 4DW6A 3S1QJ 3PO3J 1ETXA 2R93J 2HOSA 1ZTRA 5GPAA 3M3YJ 2CQQA 1JJ8C 5EZHA 2CJJA 2KT0A 4A69C 3DEWA 4BKXA 4A3EJ 1RETA 2NOGA 1POGA 1U8BA 2W48A 2LTPA 3BR6A 4MIMA 4Y7NJ 1JJ6C 5E3NA 5K7ZA 5FJ8J 4BBSJ 2FD5A 3BTIA 1UMQA 3D1NI 1DU0A 3HOZJ 4MLOA 3JRFA 1TWCJ 2I10A 2DMTA 3BG3A 3BT9A 1JGGA 5F04A 3GTOJ 2JWTA 3S1NJ 2LVSA 3ZQFA 5FKMA 4FE4A 5IOYA 4A3MJ 3F0CA 3K2AA 4QTRA 3HGYA 5GP9A 3ZOBA 2MW8A 1T56A 1FEXA 2NVXJ 1F43A 4XRMA 2XRLA 5GPCA 1BW6A 1IDYA 1OCTC 3TP3A 5FLMJ 2QCOA 2E1OA 4XK4A 4XICA 3JREA 1GDTA 2IBDA 4M3GA 3HOWJ 2LD5A 4IHYA 1LFBA 2JMWA 1XG1A 3QPSA 1IV6A 3HOYJ 1BW5A 4C3IJ 2O9LA 1JUSA 3PO2J 2IAIA 1ZGWA 4JX6A 1YRNB 2TCTA 5EG0A 4UUSB 3FKIJ 1LFUP 2XGDA 2XB0X 2Y31A 2LK2A 2XPVA 2O8KA 5M3MJ 2N8GA 4IEJA 3S17J 1JT6A 5EF6A 1JKQC 1JUMA 3HKZN 4LOCA 2EH3A 3S15J 2X9DA 2HDDA 3A01A 1ZQ3P 2HOTA 2Y2ZA 1SANA 2XPWA 3IH2A 2K40A 3G1LA 5F0FA 1GUUA 1YRNA 2VI6A 1Z77A 4D5FA 3WHBA 2QF7A 3NARA 3RZOJ 3CDLA 2O7OA 1ZR4A 1X58A 1I3QJ 2EZKA 2NVTJ 1ETOA 1HDDC 3RKQA 1IG7A 3WHCA 2VKEA 1MBEA 2TRTA 1HLVA 4M3FA 1XC5A 1NK3P 2DA4A 4CYCB 3GBGA 2XGCA 4XRSA 3JRGA 1CQTA 1IGNA 5EZGA 4I6ZA 1FTTA 1MNMC 2M9HA 2ID3A 5FKNA 1FIAA 1LE8A 2FX0A 3BTCA 5F0HA 3G1MA 5E3OA 1JUPA 3ZQIA 1VNDA 3IH4A 2JA6J 1TWFJ 1JTYA 1WCMJ 1NTCA 2R92J 3OIOA 4MFEA 4B3AA 2LLKA 1ETWA 2R7ZJ 3BQYA 2DJNA 2VKVA 2L7FP 5DS9A 3FK6A 2LKXA 2DA7A 1OFCX 3SFIA 2ME6A 5E3MA 2B63J 1B72A 2GLOA 4DZPA 3MN2A 3IH3A 2MSYA 2DN0A 2GM4A 2K9NA 5C44J 1H88C 1WI3A 4M3DA 3LSRA 2CU7A 5C4JJ 1AU7A 3GTLJ 2FJ1A 1P7IA 1IUFA 2R5YA 4D7NA 1K83J 5FLVA 3BTLA 4AYBN 1JKRC 2R0QC 2VUMJ 5EEAA 4DYCA 5E3LA 1Z0XA 2L9RA 2D5VA 2EZHA 2HI3A 3C2BA 1RR7A 1AHDP 2DMQA 4IHWA 3Q0WA 2JN6A 2LP0A 3H0GJ 5IP7J 1ENHA 1S7EA 4A3JJ 5K7FA 3O8GA 5EG0B 2NVYJ 1EF4A 1QVTA 3Q3SA 1RKTA 3RZDJ 3BQZA 1MBFA 1MBJA 1QPIA 3MVPA 4BY7J 4XIDA 3HOUJ 2DMPA 2M0CA 1ZR2A 5M5YJ 1AKHA 3A01B 2HOAA 1ETKA 5F1JA 2NVQJ 2DA1A 3ZQGA 4A3IJ 1H8AC 3CQZJ 3G1OA 2CUEA 4I76A 3QPLA 1IRZA 2X6OA 5EGOA 3HDDA 2DA5A 2JK3A 2M34A 5FKOA 5K7HA 3LSPA 3GTMJ 3GTKJ 2XSDC 5M5XJ 3BR5A 4MO7A 5IYCJ 2L0KA 2EBIA 1H89C 1B8IA 4A3BJ 1ZKGA 4JX5A 3JRCA 3S2HJ 3L1PA 1RESA 4G12A 2K9SA 3FIWA 1BL0A 3HOVJ 1I50J 3S2DJ 3FK7A 1U9OA 4IHXA 1IJWC 2NS7A 2OF7A 3HBLA 3GTJJ 5J1UA 3S1RJ 1LE8B 2MGQA 1W0TA 1RKWA 1FIPA 1D5YA 1Q1VA 3LNQA 2ID6A 1FJLA 3BG9A 1VF9A 2LR8A 2GBYA 1A5JA 5FKKA 2DMNA 5J3LA 4BY1J 5DTDA 2RAEA 4V2GA 3LSGA 3B6AA 2E2HJ 4BXXJ 4ABZA 3DCFA 1PUFA 3E7LA 3UKGA 1OJLA 3TW7A 2JA5J 4A3DJ 3A03A 2R5ZA 3LSJA 1TWGJ 1VI0A 1B72B 4AUXA 2AHQA 4A3LJ 1RPWA 3TEDA 1JKOC 2IEKA 4L5EA 1HCRA 3GTQJ 2PMZN 4FE7A 1U9NA 5JLXA 4X6AJ 1APLC 1UG2A 1P7JA 4J19A 4C3JJ 2Y9YA 3S16J 4FTHA 9ANTA 5BNGA 3HOXJ 2R5YB 3TP0A 2YS9A 4DYRA 5JLWA 1X2NA 3GTPJ 2JJ7A 1I6HJ 2YUSA 5C4XJ 2CRGA 3BR3A 4A3KJ 2YU9J 1E3OC 3ZQLA 1MH4A 2EQRA 2K9QA 3Q0VA 3SJMA 1ZK8A 2HYJA 5F08A 3JRIA 4W1UA 2VPRA 1TWAJ 4RDUA 5F0CA 5IP6A 4A3GJ 2H1KA 2EZIA 1U78A 4FISA 4QSHA 3JRDA 2ZB9A 3PM1A 3BR2A 1T33A 2CUFA 4IHVA 1ITYA 4HNVA 1ORKA 1QVUA 2M8GX 3JRBA 1GV2A 3I4MJ 1MSFC 3OSGA 1K61A 2DA3A 1AKHB 1ETYA 2NS8A 3Q0UA 3SDGA 5EYRA 5IYBJ 3OSFA 2AO9A 1OCPA 5IPAA 2H8RA 1HDPA 1WH7A 4Y52J 2HXOA 2CQXA 5EGOB 2G0EA 3HB9A 1HF0A 2DA6A 3CCYA 4BBRJ 1MBKA 4RBOA 1ETVA 4S0HB 3JRAA 1B8IB 3IV5A 4MFDA 2WV1A 1IDZA 1DU6A 3HGGA 2E2JJ 1UHSA 2XB5A 1G2HA 5IYDJ 4M3BA 4C2MJ 3GTGJ 4W97A 3S1MJ 1HOMA 5J1YA 3JRHA 1X2MA 4A3CJ 2E19A 2JA8J 1XS9A 2COBA 4XRSG 3HEFA 2P81A 1NK2P 3ZQCA 5C3EJ 4B1RA 5F27A 3QQAA 4JP0A 3RQIA 4DZJA 1QRYA 1MBGA 3A02A 4C3HJ 5M5WJ 3B6CA 1VFCA 5J1RA 1TC3C 4M6VA 4M3EA 4X1EA 1PUFB 3BR1A 2OPTA 1WGXA 2ECBA 3O8HA 2R5ZB 1GT0C 1MSEC 5FKLA 5IOZA 4UUTA 3S14J 4UUSA 1Y1WJ 4FCYA 2ELKA 1WH5A 1SFOJ 3HM5A 2Y30A 3H3VK 3CMYA 3K7AJ 5IP9J 4A93J 1F36A 4NDLA 3I4NJ 3BTJA 3TW6A 1JKPC 4EEFG 2L7ZA 1TWHJ 1JTXA 2ECCA 3W6VA 3M4OJ 5EDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJZ A;  2DTZ A;  1GV5 A;  4DYQ A;  2LY9 A;  2FQ4 A;  4JX4 A;  4GFB A;  2DMU A;  3NAU A;  4QIW N;  4D7M A;  3FIS A;  2E2I J;  2Y9Z A;  2XGE A;  4JYK A;  2KDZ A;  1MH3 A;  5M3F J;  3OOU A;  3BR0 A;  3BG5 A;  3LOC A;  3JR9 A;  2HXI A;  1W0U A;  1Y1V J;  4A3F J;  2M2E A;  4B4C A;  1ETQ A;  1BA5 A;  1R9T J;  4CYC A;  5HOD A;  2MG4 A;  1MBH A;  2L7M P;  1FTZ A;  2LFB A;  2HQ5 A;  2WB1 N;  1A6I A;  2DA2 A;  4D5C A;  2WAQ N;  1WPK A;  3ZQH A;  2ME0 A;  2X48 A;  3MKL A;  4V2F A;  1GVD A;  4AC0 A;  2JA7 J;  1IC8 A;  3VPR A;  2Y0S N;  1O4X A;  1JT0 A;  2XPU A;  2EZL A;  4DW6 A;  3S1Q J;  3PO3 J;  1ETX A;  2R93 J;  2HOS A;  1ZTR A;  5GPA A;  3M3Y J;  2CQQ A;  1JJ8 C;  5EZH A;  2CJJ A;  2KT0 A;  4A69 C;  3DEW A;  4BKX A;  4A3E J;  1RET A;  2NOG A;  1POG A;  1U8B A;  2W48 A;  2LTP A;  3BR6 A;  4MIM A;  4Y7N J;  1JJ6 C;  5E3N A;  5K7Z A;  5FJ8 J;  4BBS J;  2FD5 A;  3BTI A;  1UMQ A;  3D1N I;  1DU0 A;  3HOZ J;  4MLO A;  3JRF A;  1TWC J;  2I10 A;  2DMT A;  3BG3 A;  3BT9 A;  1JGG A;  5F04 A;  3GTO J;  2JWT A;  3S1N J;  2LVS A;  3ZQF A;  5FKM A;  4FE4 A;  5IOY A;  4A3M J;  3F0C A;  3K2A A;  4QTR A;  3HGY A;  5GP9 A;  3ZOB A;  2MW8 A;  1T56 A;  1FEX A;  2NVX J;  1F43 A;  4XRM A;  2XRL A;  5GPC A;  1BW6 A;  1IDY A;  1OCT C;  3TP3 A;  5FLM J;  2QCO A;  2E1O A;  4XK4 A;  4XIC A;  3JRE A;  1GDT A;  2IBD A;  4M3G A;  3HOW J;  2LD5 A;  4IHY A;  1LFB A;  2JMW A;  1XG1 A;  3QPS A;  1IV6 A;  3HOY J;  1BW5 A;  4C3I J;  2O9L A;  1JUS A;  3PO2 J;  2IAI A;  1ZGW A;  4JX6 A;  1YRN B;  2TCT A;  5EG0 A;  4UUS B;  3FKI J;  1LFU P;  2XGD A;  2XB0 X;  2Y31 A;  2LK2 A;  2XPV A;  2O8K A;  5M3M J;  2N8G A;  4IEJ A;  3S17 J;  1JT6 A;  5EF6 A;  1JKQ C;  1JUM A;  3HKZ N;  4LOC A;  2EH3 A;  3S15 J;  2X9D A;  2HDD A;  3A01 A;  1ZQ3 P;  2HOT A;  2Y2Z A;  1SAN A;  2XPW A;  3IH2 A;  2K40 A;  3G1L A;  5F0F A;  1GUU A;  1YRN A;  2VI6 A;  1Z77 A;  4D5F A;  3WHB A;  2QF7 A;  3NAR A;  3RZO J;  3CDL A;  2O7O A;  1ZR4 A;  1X58 A;  1I3Q J;  2EZK A;  2NVT J;  1ETO A;  1HDD C;  3RKQ A;  1IG7 A;  3WHC A;  2VKE A;  1MBE A;  2TRT A;  1HLV A;  4M3F A;  1XC5 A;  1NK3 P;  2DA4 A;  4CYC B;  3GBG A;  2XGC A;  4XRS A;  3JRG A;  1CQT A;  1IGN A;  5EZG A;  4I6Z A;  1FTT A;  1MNM C;  2M9H A;  2ID3 A;  5FKN A;  1FIA A;  1LE8 A;  2FX0 A;  3BTC A;  5F0H A;  3G1M A;  5E3O A;  1JUP A;  3ZQI A;  1VND A;  3IH4 A;  2JA6 J;  1TWF J;  1JTY A;  1WCM J;  1NTC A;  2R92 J;  3OIO A;  4MFE A;  4B3A A;  2LLK A;  1ETW A;  2R7Z J;  3BQY A;  2DJN A;  2VKV A;  2L7F P;  5DS9 A;  3FK6 A;  2LKX A;  2DA7 A;  1OFC X;  3SFI A;  2ME6 A;  5E3M A;  2B63 J;  1B72 A;  2GLO A;  4DZP A;  3MN2 A;  3IH3 A;  2MSY A;  2DN0 A;  2GM4 A;  2K9N A;  5C44 J;  1H88 C;  1WI3 A;  4M3D A;  3LSR A;  2CU7 A;  5C4J J;  1AU7 A;  3GTL J;  2FJ1 A;  1P7I A;  1IUF A;  2R5Y A;  4D7N A;  1K83 J;  5FLV A;  3BTL A;  4AYB N;  1JKR C;  2R0Q C;  2VUM J;  5EEA A;  4DYC A;  5E3L A;  1Z0X A;  2L9R A;  2D5V A;  2EZH A;  2HI3 A;  3C2B A;  1RR7 A;  1AHD P;  2DMQ A;  4IHW A;  3Q0W A;  2JN6 A;  2LP0 A;  3H0G J;  5IP7 J;  1ENH A;  1S7E A;  4A3J J;  5K7F A;  3O8G A;  5EG0 B;  2NVY J;  1EF4 A;  1QVT A;  3Q3S A;  1RKT A;  3RZD J;  3BQZ A;  1MBF A;  1MBJ A;  1QPI A;  3MVP A;  4BY7 J;  4XID A;  3HOU J;  2DMP A;  2M0C A;  1ZR2 A;  5M5Y J;  1AKH A;  3A01 B;  2HOA A;  1ETK A;  5F1J A;  2NVQ J;  2DA1 A;  3ZQG A;  4A3I J;  1H8A C;  3CQZ J;  3G1O A;  2CUE A;  4I76 A;  3QPL A;  1IRZ A;  2X6O A;  5EGO A;  3HDD A;  2DA5 A;  2JK3 A;  2M34 A;  5FKO A;  5K7H A;  3LSP A;  3GTM J;  3GTK J;  2XSD C;  5M5X J;  3BR5 A;  4MO7 A;  5IYC J;  2L0K A;  2EBI A;  1H89 C;  1B8I A;  4A3B J;  1ZKG A;  4JX5 A;  3JRC A;  3S2H J;  3L1P A;  1RES A;  4G12 A;  2K9S A;  3FIW A;  1BL0 A;  3HOV J;  1I50 J;  3S2D J;  3FK7 A;  1U9O A;  4IHX A;  1IJW C;  2NS7 A;  2OF7 A;  3HBL A;  3GTJ J;  5J1U A;  3S1R J;  1LE8 B;  2MGQ A;  1W0T A;  1RKW A;  1FIP A;  1D5Y A;  1Q1V A;  3LNQ A;  2ID6 A;  1FJL A;  3BG9 A;  1VF9 A;  2LR8 A;  2GBY A;  1A5J A;  5FKK A;  2DMN A;  5J3L A;  4BY1 J;  5DTD A;  2RAE A;  4V2G A;  3LSG A;  3B6A A;  2E2H J;  4BXX J;  4ABZ A;  3DCF A;  1PUF A;  3E7L A;  3UKG A;  1OJL A;  3TW7 A;  2JA5 J;  4A3D J;  3A03 A;  2R5Z A;  3LSJ A;  1TWG J;  1VI0 A;  1B72 B;  4AUX A;  2AHQ A;  4A3L J;  1RPW A;  3TED A;  1JKO C;  2IEK A;  4L5E A;  1HCR A;  3GTQ J;  2PMZ N;  4FE7 A;  1U9N A;  5JLX A;  4X6A J;  1APL C;  1UG2 A;  1P7J A;  4J19 A;  4C3J J;  2Y9Y A;  3S16 J;  4FTH A;  9ANT A;  5BNG A;  3HOX J;  2R5Y B;  3TP0 A;  2YS9 A;  4DYR A;  5JLW A;  1X2N A;  3GTP J;  2JJ7 A;  1I6H J;  2YUS A;  5C4X J;  2CRG A;  3BR3 A;  4A3K J;  2YU9 J;  1E3O C;  3ZQL A;  1MH4 A;  2EQR A;  2K9Q A;  3Q0V A;  3SJM A;  1ZK8 A;  2HYJ A;  5F08 A;  3JRI A;  4W1U A;  2VPR A;  1TWA J;  4RDU A;  5F0C A;  5IP6 A;  4A3G J;  2H1K A;  2EZI A;  1U78 A;  4FIS A;  4QSH A;  3JRD A;  2ZB9 A;  3PM1 A;  3BR2 A;  1T33 A;  2CUF A;  4IHV A;  1ITY A;  4HNV A;  1ORK A;  1QVU A;  2M8G X;  3JRB A;  1GV2 A;  3I4M J;  1MSF C;  3OSG A;  1K61 A;  2DA3 A;  1AKH B;  1ETY A;  2NS8 A;  3Q0U A;  3SDG A;  5EYR A;  5IYB J;  3OSF A;  2AO9 A;  1OCP A;  5IPA A;  2H8R A;  1HDP A;  1WH7 A;  4Y52 J;  2HXO A;  2CQX A;  5EGO B;  2G0E A;  3HB9 A;  1HF0 A;  2DA6 A;  3CCY A;  4BBR J;  1MBK A;  4RBO A;  1ETV A;  4S0H B;  3JRA A;  1B8I B;  3IV5 A;  4MFD A;  2WV1 A;  1IDZ A;  1DU6 A;  3HGG A;  2E2J J;  1UHS A;  2XB5 A;  1G2H A;  5IYD J;  4M3B A;  4C2M J;  3GTG J;  4W97 A;  3S1M J;  1HOM A;  5J1Y A;  3JRH A;  1X2M A;  4A3C J;  2E19 A;  2JA8 J;  1XS9 A;  2COB A;  4XRS G;  3HEF A;  2P81 A;  1NK2 P;  3ZQC A;  5C3E J;  4B1R A;  5F27 A;  3QQA A;  4JP0 A;  3RQI A;  4DZJ A;  1QRY A;  1MBG A;  3A02 A;  4C3H J;  5M5W J;  3B6C A;  1VFC A;  5J1R A;  1TC3 C;  4M6V A;  4M3E A;  4X1E A;  1PUF B;  3BR1 A;  2OPT A;  1WGX A;  2ECB A;  3O8H A;  2R5Z B;  1GT0 C;  1MSE C;  5FKL A;  5IOZ A;  4UUT A;  3S14 J;  4UUS A;  1Y1W J;  4FCY A;  2ELK A;  1WH5 A;  1SFO J;  3HM5 A;  2Y30 A;  3H3V K;  3CMY A;  3K7A J;  5IP9 J;  4A93 J;  1F36 A;  4NDL A;  3I4N J;  3BTJ A;  3TW6 A;  1JKP C;  4EEF G;  2L7Z A;  1TWH J;  1JTX A;  2ECC A;  3W6V A;  3M4O J;  5EDN A; 
#chains in the Genus database with same CATH topology
 1BJZ A;  2DTZ A;  2QSF X;  5LLQ A;  3HOT A;  4UUV A;  1W7P B;  2PQ8 A;  1KA8 A;  4DYQ A;  1XX5 A;  1G6N A;  4AIH A;  1GXQ A;  2P6S A;  3ESW B;  5LRS A;  2LY9 A;  3T5X A;  2QBY B;  4GFB A;  2DMU A;  1R4M B;  1MND A;  3NAU A;  2CYY A;  1O3Q A;  4A0Z A;  2LRE A;  2DBB A;  3E6B A;  3FIS A;  1WWX A;  4PFP A;  3K9T A;  2BHY A;  2Y9Z A;  3OYF A;  1IF1 A;  4ZC3 A;  2BW3 A;  5H6Q A;  1MH3 A;  1VTN C;  5M3F J;  1MMN A;  2VON A;  3OOU A;  4YIF A;  1Z05 A;  3PQJ A;  4U87 A;  3MQ0 A;  1BJA A;  2ZME A;  2D2W A;  4GYG A;  2D45 A;  3PNY A;  3LL7 A;  4B4C A;  1FOW A;  3LMM A;  1BA5 A;  1YOV B;  2D1V A;  5HOD A;  5E20 A;  3LSH A;  2JRM A;  1BI1 A;  1PP8 F;  4RM3 A;  2OU2 A;  4OU0 A;  2DA2 A;  2K85 A;  3E1S A;  5TGT A;  3ZQH A;  3MKL A;  4AC0 A;  4EAT A;  2MH2 A;  1FMV A;  3HPG A;  1IC8 A;  1OKR A;  3BZ6 A;  4YII A;  3OYL A;  1X4P A;  2XPU A;  1KU9 A;  1A6Q A;  4XOT A;  1ULY A;  2M45 A;  4DQ2 A;  3KZI C;  4Y17 A;  4A69 C;  4A3E J;  2K02 A;  4LLN A;  3BR6 A;  4MIM A;  1JJ6 C;  2FD5 A;  4NQW A;  1ZLJ A;  2KIQ A;  3D1N I;  1Z9C A;  3EDP A;  3TMO A;  4HX8 A;  1UG0 A;  1TWC J;  2I10 A;  1ZG3 A;  3BG3 A;  1F9N A;  4UV8 A;  2DQR A;  4R79 A;  3QYF A;  1O3T A;  3F0C A;  4R8H A;  4QTR A;  4M9X A;  5EEG A;  2KIF A;  5KVR A;  2MW8 A;  3AFH A;  3LST A;  2KZG A;  2XRL A;  4HV6 A;  1RUO A;  2PN6 A;  3TP3 A;  5L3G A;  5A2Q K;  2E1O A;  4JOM A;  4R1H A;  2IBD A;  5K5R A;  3ZMU A;  4P1W A;  1LFB A;  2CV2 A;  1HST A;  5BPD A;  4N4O B;  2DK8 A;  3HOY J;  1R23 A;  2DFI A;  3I54 A;  2IAI A;  2XAQ A;  2ZO4 A;  4HNT A;  1W5C C;  4XMY A;  1ZGW A;  2XUB A;  4NC6 A;  3L2Q A;  5HVQ C;  3FBN B;  5ED4 A;  1YRN B;  3OR2 C;  5EG0 A;  4PGG A;  4CCL A;  1HC8 A;  2XB0 X;  3W6K B;  3ASO H;  2XPV A;  3HUG B;  2LKP A;  1IN7 A;  4Z6Y A;  3R61 A;  4RB2 C;  3HKZ N;  4K2E A;  5IT9 K;  1VQN I;  1BI0 A;  1OPC A;  4XRF A;  1FOY A;  2A6E F;  2K40 A;  1O3S A;  1G3T A;  5F0F A;  1Z77 A;  2R7D A;  3RDI A;  3WHB A;  2TDX A;  4MNU A;  4HF1 A;  2QA4 I;  2O7O A;  2R7S A;  4C9Y A;  2F5D A;  1KQ8 A;  5ICE A;  2BHZ A;  4IRI A;  2NVT J;  3T1B A;  4HYE A;  2EV5 A;  1QZY A;  3IAS 2;  4LLL A;  5J6X A;  2LNB A;  4E7H A;  4IHS A;  2K9L A;  1YS6 A;  2QQA A;  2ZCW A;  4ZZD A;  4CCO A;  1JGS A;  1V3F A;  3F72 A;  3QWL A;  1X4O A;  3DKX A;  3BZC A;  3S93 A;  4Y4R A;  4XR6 A;  5EZG A;  5FD5 A;  4I6Z A;  4KYW A;  2VE9 A;  3E3V A;  2MC4 A;  2M9H A;  3E5U A;  3DBH B;  4B09 A;  2JQ7 A;  1SAU A;  3G1M A;  3GZ5 A;  5E3O A;  2ELH A;  2HZT A;  1CGP A;  3SHF A;  2JA6 J;  4UY8 I;  1TWF J;  1CF7 A;  3VYT B;  3PUB A;  1X1C A;  3OIO A;  5LGT A;  2ISZ A;  2AQF A;  4BH9 A;  3A2K A;  1QU3 A;  4MFE A;  2HKX A;  2DQL A;  3G71 I;  4LFU A;  3IWZ A;  1VQ8 I;  3S2W A;  2PMZ A;  5DS9 A;  2E1M C;  2IP2 A;  4L0Z B;  1UAA A;  2B7E A;  1MJ9 A;  5E3M A;  2L02 A;  2DO7 A;  2K9N A;  4LGW A;  4M3D A;  3DWL E;  3DKW A;  3FX3 A;  1RUN A;  4WWC A;  2FJ1 A;  2MBF A;  2QUF A;  4D7N A;  5J40 A;  1IXR C;  2HDC A;  3JAM K;  3V4G A;  4XLF A;  4BE1 A;  3OS0 A;  1DDN A;  2G7H A;  1BC7 C;  4HAM A;  3HOS A;  1FMW A;  2VBY A;  2HQN A;  1EV7 A;  3CJN A;  2RQQ A;  5E3L A;  3W6J B;  2EZH A;  2PI0 A;  3L2W A;  1UB9 A;  3V7R A;  3SQN A;  2DTR A;  4IHW A;  2R3S A;  3CJT B;  2XIG A;  3VB2 A;  2E7W A;  3M1E A;  4RB3 C;  2GIV A;  4UB6 C;  4KIS A;  4A3J J;  2OD5 A;  1LNW A;  3DEE A;  4C30 A;  3GME A;  3BJO A;  4M73 A;  1RKT A;  4IPA A;  4BS9 A;  2IGN A;  4NUB A;  1R4N B;  3DP7 A;  2Q1Z B;  3CJR B;  2VOD A;  1FOX A;  3QOP A;  4G6T B;  5M5Y J;  3G73 A;  3WU2 C;  2F5C A;  1XMA A;  2CS3 A;  3LFU A;  3C2H A;  3RTR A;  3KP5 A;  4HEA 2;  2NVQ J;  4U88 A;  2ZJQ F;  2CQ7 A;  3G1O A;  2NYX A;  3H9G A;  3KEQ A;  1TT0 A;  3WE3 A;  2JK3 A;  2M34 A;  2OZU A;  3S3M A;  2R7U A;  4RA2 A;  2M30 A;  2COM A;  2QZ8 A;  5CQG A;  1YX5 A;  2STW A;  2L0K A;  4M71 A;  1B6A A;  2W57 A;  4AWX B;  1RIO H;  1SC7 A;  1B8I A;  2WY8 Q;  1KYW A;  1R5I D;  2E1M B;  1ZKG A;  4ZTJ A;  4XLH A;  3SZP A;  1RI7 A;  2EV0 A;  3DBR B;  1B59 A;  4FET A;  2XF7 A;  3KYL A;  1ZLK A;  3MMY B;  4FAS D;  4WXD A;  3S3O A;  3BP8 A;  3S2D J;  1BN5 A;  3FXM A;  2X6X A;  2NS7 A;  3HBL A;  4B43 A;  3GLX A;  3GTJ J;  3S1R J;  3E6M A;  3U21 A;  1KON A;  5D6E A;  1FIP A;  1Q1V A;  2ID6 A;  4BHB A;  2ESN A;  1VF9 A;  4AVP A;  2K4B A;  1A5J A;  4IHT A;  3KLN A;  1A31 A;  4BY1 J;  4L9N A;  1KGS A;  2W1O A;  3GWZ A;  1XGS A;  5AON A;  2FNA A;  1C0W A;  4A12 A;  3ECH A;  1R6R A;  2LY1 A;  3BZK A;  4IOC F;  1FLI A;  1VI0 A;  2EPF A;  1B72 B;  3OY9 A;  1RPW A;  2J5P A;  1JKO C;  5JHF A;  3GTQ J;  4GRI A;  2PMZ N;  2K7L A;  3HJE A;  1U9N A;  4FE7 A;  1TW3 A;  3H92 A;  3NEU A;  3ECO A;  3VDX A;  1JHH A;  2L54 A;  2R5Y B;  1K78 B;  1XMK A;  3IUO A;  4DYR A;  4KMF A;  4HF2 A;  2JJ7 A;  1I6H J;  3GYH X;  4BAY A;  1DP3 A;  2M7B A;  2QBY A;  2ZNZ A;  5AIQ A;  1MH4 A;  3DFG A;  5LEK A;  3AL0 C;  3GFL A;  4BEH B;  3SJM A;  3MEX A;  5F08 A;  4P96 A;  1JE8 A;  2E34 A;  2VPR A;  4GXO A;  3BCA A;  3MCZ A;  4A5M A;  5IP6 A;  3TQN A;  3J7A Y;  2HR3 A;  1A35 A;  4UV9 A;  2FUG 2;  2PG4 A;  1WQ2 A;  3HIF A;  5LFA A;  4AIJ A;  1FPQ A;  4II3 A;  2DXI A;  2WB1 A;  3PSF A;  3ZMZ A;  1OCO H;  3PM1 A;  4L5I A;  1ITY A;  5HDN A;  2IS6 A;  1V4R A;  3F8N A;  1I27 A;  3KP7 A;  2GA1 A;  2Y0S A;  4WK8 F;  1QA6 A;  2LDU A;  5TIS C;  1ZGA A;  4L18 B;  3I4M J;  2VBZ A;  2LY2 A;  1SAX A;  2VLA A;  2CUZ A;  1K4S A;  1ETY A;  1VQL I;  1IW7 F;  2IS1 A;  2NS8 A;  5IYB J;  3H5N A;  3OSF A;  1OCP A;  2RKH A;  1Z21 A;  2A3S A;  3HHG A;  3F22 A;  2H8R A;  1DPR A;  1HSJ A;  4Y52 J;  1D8J A;  2KP6 A;  2VQL A;  2OQG A;  5ILU A;  2CQX A;  2HS5 A;  3HB9 A;  2IXS A;  3OL4 A;  4RBO A;  2WAD A;  2W84 A;  3R0J A;  4LB6 B;  2VJJ A;  2A69 F;  1QHG A;  3KEY A;  4M9Z A;  2M87 A;  1DU6 A;  5CQE A;  3FWE A;  1UHS A;  4XLA A;  1NG7 A;  2F4M B;  2ZXJ A;  3N97 A;  4CIC A;  2E1C A;  5DUK A;  4KIG A;  5JVT A;  2KIM A;  1BM9 A;  4B44 A;  1W36 D;  4GDF A;  3W3C A;  1N77 A;  3S1M J;  3KCC A;  4ENK A;  4MEY F;  3JRH A;  2JA8 J;  1EJ9 A;  4IL6 C;  2DOF A;  3HEF A;  4PJL A;  3A0B C;  3BDD A;  4B47 A;  2NNY A;  2Z9O A;  2MYS A;  3ULQ B;  5FLX Z;  4A0X A;  1EA3 A;  3QPH A;  4DOZ A;  4ZTF A;  2GXG A;  2PMU A;  3QQA A;  3ZN1 A;  1P9Q C;  4DZJ A;  4HOB A;  3FXJ A;  4E70 A;  1IN4 A;  3KP4 A;  4M72 A;  2X1D A;  4I0B A;  4C3H J;  3FXR A;  2EJR A;  4KT6 A;  2EFQ A;  3SXY A;  5K5Q A;  5LRR A;  4M3E A;  3RPU D;  3CTA A;  1PUF B;  3SYT A;  1N75 A;  3DTI A;  3K2Z A;  3SFZ A;  3H9J A;  2QQB A;  3O8H A;  4XKB A;  5CKT A;  1IN5 A;  2R5Z B;  1GT0 C;  4XSX F;  1IAW A;  4ZJZ A;  1FP1 D;  2L9S A;  2VE8 A;  3HSF A;  3HM5 A;  3ZGK A;  2L3D A;  2ZXH A;  3HUG A;  2Z1D A;  1U5T C;  2MLG A;  4A93 J;  1F36 A;  4NDL A;  2M4G A;  3BTJ A;  4EEF G;  3W2W A;  2XAG A;  4IQJ A;  4DNC A;  1UFM A;  3KEO A;  3CO6 C;  2AXT C;  2HPI A;  4D9J A;  1Y6I A;  1ZYR F;  4O5V A;  2BBY A;  3OYJ A;  2FQ4 A;  4JX4 A;  4QIW N;  2I5U A;  3LQQ A;  2DT7 B;  3JTG A;  4JYK A;  5KNL A;  2P5V A;  1VQM I;  3OWT A;  3BG5 A;  2YPR A;  1SD7 A;  2CH0 A;  4PCQ A;  4G7H F;  4E7L A;  1V5F A;  1S72 I;  2HXI A;  2KMU A;  1W0U A;  4LG0 B;  1Y1V J;  1MKM A;  3ONQ A;  3CUQ C;  4A3F J;  4UNO A;  2ETH A;  2A07 F;  4GGG A;  2OTL I;  1TQP A;  1I5Z A;  2A5W A;  4LK1 F;  1R9T J;  1MBH A;  5E1W A;  2LFB A;  5KCM A;  1V5E A;  3RI4 A;  2WB1 N;  4D5C A;  2DPD A;  1WPK A;  2ME0 A;  3PFI A;  4V2F A;  4XN0 A;  1P4W A;  3SEQ A;  2JA7 J;  5D4S A;  1IRF A;  2OUM A;  4YFN F;  2Y0S N;  1O4X A;  4BHC A;  1XGM A;  5DYM A;  3HL2 A;  1ZAR A;  1HW2 A;  2IVM A;  4RGX A;  2L2O A;  3S1Q J;  2W85 A;  4LIV A;  4BXU A;  3PO3 J;  3CDI A;  3P9I A;  1KQ0 A;  4DBR A;  2HOS A;  1MJA A;  2CFO A;  4G6D A;  3M3Y J;  5EZH A;  4BKX A;  2NOG A;  2MD5 A;  4I09 A;  4KDP A;  1X3W B;  5F6F A;  1SMY F;  5E3N A;  2GXB A;  2CGP A;  1Z91 A;  4G94 A;  3GFJ A;  2XKO A;  1Z7L A;  3HOZ J;  1XGN A;  2OBP A;  1ZN2 A;  1YX3 A;  1MZB A;  2DMT A;  3FM5 A;  4U0Y A;  2RQP A;  5L3E A;  3GTO J;  2JWT A;  2LVS A;  2NAZ A;  3ZQF A;  5ICF A;  3B02 A;  2VL8 A;  3GO5 A;  1VQ6 I;  3ZOB A;  2OA4 A;  1T56 A;  1BR4 A;  1X3Z B;  3GEZ A;  1FEX A;  3I56 I;  3R4K A;  1IV8 A;  4XRM A;  4OIN F;  1TLH B;  4LB5 A;  4Y13 A;  4F92 B;  3MKZ A;  5L3D A;  2QCO A;  3ML6 A;  4ON0 A;  5EEH A;  5KAI C;  2EIM H;  2LD5 A;  2JMW A;  4ASN A;  3L00 A;  4NB5 A;  3DV8 A;  3CO7 C;  3TO9 A;  3FXU A;  2HVQ A;  3F23 A;  3PO2 J;  1SFE A;  4BL0 B;  2Y0M A;  1D0Y A;  2ACJ A;  3CUQ B;  3CCS I;  3O6B B;  4EJT A;  1W36 C;  3FKI J;  1LFU P;  2XGD A;  4WF2 A;  3PUF A;  2V6C A;  2LK2 A;  4YFK F;  1WZ2 A;  3OYA A;  1W5S A;  1ZGJ A;  2N8G A;  2VT3 A;  4IEJ A;  3E6C C;  1R5G A;  4YG2 F;  3S17 J;  3K6G A;  3NWT A;  2EH3 A;  5HLI A;  4CO8 A;  2XAS A;  1J0R A;  2X9D A;  3H3Z A;  2DT6 A;  2G9W A;  3RYR A;  3I5U A;  1VZ0 A;  2FSW A;  4FQG A;  2XPW A;  2EA4 A;  2IPQ X;  5DD4 A;  4XNF A;  3LAP A;  3KP6 A;  2DCE A;  4H0E A;  4I2O A;  2VI6 A;  4M9S A;  4YFX F;  5LD2 C;  2KZV A;  2DDB A;  2EV6 A;  2QWW A;  2HFH A;  3CDL A;  4XLC A;  4UVB A;  2VT2 A;  3IL2 A;  2X1E A;  3EYI A;  2JVH A;  4B8X A;  4XL9 A;  5DDG A;  2K86 A;  2VKE A;  2BXY A;  2FF4 A;  2DPU A;  1MBE A;  3BG6 A;  3FMS A;  2HOE A;  4G6Q A;  2VB6 A;  1O57 A;  3GBG A;  2XGC A;  4XRS A;  3FXL A;  1IGN A;  4GYI A;  5TJJ A;  1DPU A;  4X0G A;  1MNM C;  3BY6 A;  2V79 A;  1FIA A;  2FX0 A;  3IKV A;  4XSZ F;  5F0H A;  1J09 A;  3ZR8 X;  1O3R A;  5KHD A;  2HGC A;  1E3P A;  3TKY A;  2NVU B;  1OQY A;  3G4S I;  4F3Q A;  1WCM J;  2R4G A;  3V8J A;  5JFR A;  2PEX A;  4V19 K;  1ETW A;  4EJV A;  3BQY A;  4G7O F;  4DGW B;  2DJN A;  2FOK A;  2KLO A;  3X2Q H;  1OR7 A;  2L7F P;  2IGK A;  2LKX A;  1FY7 A;  4LK0 F;  1OFC X;  1I39 A;  1B72 A;  1HBX G;  5IY5 H;  4IX7 A;  2GLO A;  3CCV I;  4OMZ A;  1XCV A;  2MSY A;  2DN0 A;  3IH3 A;  2GM4 A;  4HQM A;  3R60 A;  1H88 C;  1WI3 A;  2W7N A;  1FNN A;  4D1Q A;  2K5C A;  5C4J J;  3OYC A;  1FWZ A;  3IRR A;  3GUD A;  2KKO A;  1WJB A;  3K69 A;  5DV5 A;  2R5Y A;  1K78 A;  1K83 J;  3BLY A;  4I02 A;  3BTL A;  2BY2 A;  1OCC H;  2B0L A;  2BZT A;  4IRH A;  3QRF F;  1Z7U A;  3U1K A;  4DYC A;  4HLX A;  4BEH A;  3CCR I;  2VQC A;  1RR7 A;  2WC2 A;  1KYZ A;  2XAH A;  3KZZ A;  1J2X A;  2DU9 A;  2IJL A;  2DMQ A;  3BWG A;  4ZYG A;  4BQQ A;  3H0G J;  3ISP A;  5IP7 J;  1E17 A;  3MKW B;  1FOK A;  3O8G A;  2NVY J;  3WTY C;  1EF4 A;  3F8B A;  4BU2 A;  4KFC A;  2VAS A;  3BQZ A;  2DJI A;  4BAC A;  4YRV A;  1QPI A;  2FQ3 A;  3IAM 2;  2JRT A;  2DMP A;  1KZH A;  1UZC A;  1ZR2 A;  1XDS A;  1A36 A;  5D5X B;  1FSE A;  3A01 B;  2O61 A;  3HC7 A;  3RQ4 A;  5F1J A;  2E35 A;  3BG7 A;  3CCE I;  3DPT A;  1GVJ A;  3ZQG A;  2DW4 A;  3MWM A;  4EV0 A;  2X6O A;  3GTM J;  1HQC A;  2DA5 A;  2KRF A;  2FBI A;  2XAF A;  5FKO A;  3BC8 A;  5K7H A;  4L0Y B;  3GW2 A;  3BR5 A;  1UHW A;  5IYC J;  2GOM A;  2Z33 A;  4OIQ F;  1BIA A;  2EBI A;  1H89 C;  2PBI A;  2F4O B;  1KU3 A;  1TBX A;  2L5Q A;  2Y75 A;  4Q5S F;  2Q0O A;  3FIW A;  1BL0 A;  4C2T A;  2FXA A;  3BRO A;  3CD6 I;  1X1P A;  1QO0 D;  2AQE A;  1U9O A;  4OMY A;  2Z3Y A;  1IJW C;  1YS7 A;  2P5K A;  2MFZ A;  5FRO A;  5J1U A;  4MQV A;  4E4H A;  1LE8 B;  3P9C A;  1FBQ A;  3VSK A;  6PAX A;  3OYG A;  3KFW X;  3K70 D;  3LNQ A;  2YX4 A;  4ZDP A;  1LDD A;  1T95 A;  2DFE A;  4I7H A;  1TNS A;  2LR8 A;  2CFX A;  4AIK A;  2DMN A;  2HNH A;  5J3L A;  1VQ4 I;  3WTW C;  5FLX K;  3CMM A;  4LG3 A;  2JUG A;  2RAE A;  4Q48 A;  5JR3 A;  2AS5 F;  2BY1 A;  4BXX J;  4ABZ A;  1PUF A;  3E7L A;  1LKX A;  1TQI A;  2AXL A;  2GXA A;  2JA5 J;  4OIO F;  5HDK A;  2R5Z A;  1QHH D;  3JTH A;  4CCK A;  3I64 A;  1D1B A;  1SD5 A;  5JVG F;  1YIO A;  1Y0U A;  2IEK A;  1HCR A;  1S3J A;  1ZRD A;  3OS1 A;  4S04 A;  2BOL A;  2WBM A;  3OR1 C;  1P7J A;  3PNT A;  5J4V A;  1RZ4 A;  4FTH A;  5BNG A;  2LF7 A;  3HOX J;  1J75 A;  4XN3 A;  2RC4 A;  2XF5 A;  1XDU A;  3KYD B;  4M74 A;  2YS9 A;  2P8T A;  2GIZ A;  3TP0 A;  1YI2 I;  4A0Y A;  5C4X J;  3K1N A;  3BR3 A;  4OIP F;  3GCM A;  1SFU A;  3P7N A;  1E3O C;  2EIK H;  2L01 A;  1MNE A;  4A6D A;  5HS7 A;  1GXP A;  2K9Q A;  2CW8 A;  3DBL B;  3K10 A;  4AID A;  3L09 A;  2FE3 A;  1R00 A;  3T0Y A;  4A3G J;  2CW0 F;  1WRJ A;  1P6R A;  1K4T A;  2V9K A;  3CCL I;  2H1K A;  3WTZ A;  1BOA A;  4LG0 A;  5HS8 A;  2VQG A;  3O3K A;  4QSH A;  2PJR B;  3IHU A;  3JRD A;  5E1Z B;  2WAQ A;  1T33 A;  2LOO A;  5LBQ A;  2Z16 A;  4ZYE A;  4HNV A;  1ORK A;  1XGO A;  2M8G X;  3JRB A;  5FRN A;  2CQN A;  3M8E A;  4CA0 A;  4XLP F;  2WWY A;  1MSF C;  3RKW A;  1T0F A;  4G9Y A;  4PUS A;  3OSG A;  2D1H A;  2A6H F;  2E7X A;  2Z2S B;  1AKH B;  2E71 A;  2HWV A;  2XAJ A;  5EYR A;  5F1R A;  3ASN H;  1X19 A;  3C1D A;  5IPA A;  3R0A A;  3OYI A;  3VYU B;  1T38 A;  3WGH A;  2NXN B;  4FX0 A;  5F64 A;  4S0H B;  3JRA A;  3QOD A;  4IVN A;  2VC1 A;  4Q47 A;  5FD6 A;  3ABK H;  4E7I A;  4MFD A;  2WV1 A;  1NH3 A;  4CHU A;  3AAF A;  1YLF A;  4ENM A;  4BJT A;  2V1D A;  5BPI A;  1S9H A;  1SEU A;  4W97 A;  4II2 A;  2QVO A;  3GTG J;  4WX9 A;  1S7A A;  2CO5 A;  2EWN A;  2R7X A;  1MMA A;  1X2M A;  1USS A;  3H9Q A;  2QKM B;  3KYC B;  4ZYH A;  2COB A;  3JSO A;  2K27 A;  2HPM A;  3LSK A;  4XLN F;  3AKZ A;  2Z99 A;  4RB1 A;  1I1S A;  1HKS A;  4O3M A;  4HZF A;  1J59 A;  3QU6 A;  3E97 A;  3WTX C;  5J47 A;  5ILS A;  2JPC A;  4B3X A;  1PVE A;  1MBG A;  3A02 A;  2VQH A;  3M07 A;  1VFC A;  2A68 F;  1KU2 A;  3DEU A;  3OIQ A;  4NNJ A;  4M6V A;  1YJW I;  2XV4 S;  4LIT A;  2F2E A;  2KFD A;  4X1E A;  3L2U A;  2OPT A;  3RKY A;  3N4M A;  2ECB A;  1PYV A;  4XM3 A;  5IOZ A;  3CUQ A;  3S14 J;  2O0Y A;  3CF2 A;  1MIJ A;  1G3W A;  2ELK A;  2XVC A;  3K4M A;  2JSC A;  2LRD A;  3HXL A;  4KIT B;  3EPZ A;  4RLF A;  5L3C A;  2QQ8 A;  3I4N J;  1JKP C;  1AWC A;  2VIX A;  2KPM A;  1JTX A;  2MC3 A;  4EGY A;  3M4O J;  1R1T A;  4HPQ A;  1ZRF A;  4P55 A;  1I1G A;  1D3Y A;  3IRQ A;  3ABL H;  3DTE A;  2DYR H;  1YIT I;  1ODD A;  4MQ9 F;  4D7M A;  5FO5 A;  1LEB A;  5D6F A;  3EQL F;  1XSD A;  3OYB A;  2WTE A;  3V7C A;  2XGE A;  1WSU A;  2KDZ A;  3EUH A;  1ACI A;  3QPT A;  4DIQ A;  4KNY A;  3J7Y J;  1WJE A;  1GLN A;  1W7P A;  4U7B A;  1AA7 A;  4BJ5 C;  3S3N A;  1FBU A;  2EFN A;  1MMG A;  1J9I A;  1RRJ A;  3OIP A;  2VKD A;  1R1V A;  2WA0 A;  2CV0 A;  2HQ5 A;  2WAE A;  1A04 A;  4BQO A;  2HQA A;  2WAQ N;  4HRI A;  3K4L A;  3AG1 H;  3ZCO A;  4WCG A;  3WGI A;  4CGZ A;  1IN8 A;  1DUX C;  1Y8Q B;  3PJR A;  1Y0N A;  4A2U A;  1JT0 A;  3KP3 A;  4DW6 A;  2R7O A;  5DD8 A;  3I55 I;  3HTS B;  1ETX A;  2R93 J;  1SVO A;  3HRM A;  1N25 A;  1ZTR A;  5GPA A;  2CQQ A;  5CLS A;  3DEW A;  3RJP A;  2QEN A;  2QGU A;  1OYW A;  2LTP A;  4Y7N J;  3ZRG A;  3DPU A;  5FJ8 J;  4BBS J;  2EB7 A;  1B9N A;  3BTI A;  1RNL A;  1UMQ A;  1XCB A;  4LMY A;  1DU0 A;  1HXD A;  4NHJ A;  3TDU C;  4MLO A;  1XTA A;  2DAO A;  4ZYA A;  1W5T A;  1W4M A;  4QLC U;  2G7U A;  5LEJ A;  3JRF A;  2XF6 A;  5L3B A;  3GX4 X;  1YTY A;  5F04 A;  1N78 A;  2MH9 A;  3S1N J;  2R7T A;  4AYB A;  2XGX A;  3GZN B;  4FE4 A;  5IOY A;  2ZC2 A;  2KDO A;  2FML A;  2V7F A;  3HGY A;  5DCF A;  4HDV A;  5GP9 A;  1TP4 A;  1BI3 A;  1LVA A;  1G4D A;  2NVX J;  1Z6R A;  1F43 A;  4E7K A;  2VBW A;  3HYI A;  3CLO A;  3KX2 A;  5D8K B;  3SDB A;  5GPC A;  2PJP A;  2QEX I;  2VXZ A;  1MDM B;  4MHG A;  5FLM J;  4XK4 A;  4MEX F;  3JRE A;  1GDT A;  3ABU A;  2Q2E B;  5J8F A;  2X0L A;  2B9S A;  1D0X A;  3IWF A;  1J7K A;  4FT8 A;  1XG1 A;  1R36 A;  3D5S C;  1WFX A;  2F5V A;  1IV6 A;  2QKL B;  4EM0 B;  1BW5 A;  2O9L A;  1WJ5 A;  3H5A A;  1V54 H;  3ZN0 A;  4JX6 A;  1QNT A;  2A05 A;  4UHT A;  5CVV A;  2MLK A;  2TCT A;  1K6O A;  4I0A A;  4IRG A;  3AL0 B;  1R22 A;  4CZZ A;  1Y56 A;  5M3M J;  4NBQ A;  4ZDO A;  2XRO A;  2BY0 A;  5EF6 A;  1V5G A;  1FYL A;  1JUM A;  4LOC A;  4RGR A;  1FZP B;  2VOP A;  3S15 J;  4XLE A;  4OAY A;  3A01 A;  1Z6T A;  2K3F A;  1ZQ3 P;  2Y2Z A;  2HOT A;  1XPX A;  3GZ6 A;  3G1L A;  5FFX A;  1YRN A;  3CLQ A;  4UXN A;  5LGU A;  1U8R A;  3RCO A;  4E7S A;  4RAF A;  2QF7 A;  3NAR A;  1LQ1 A;  1U0J A;  3RZO J;  4XOR A;  2EIL H;  3MFK A;  1OLT A;  1X58 A;  5FFZ A;  4A5N A;  2ZJR F;  4OWR B;  2HVR A;  1IO2 A;  2F48 A;  4HX4 A;  5EJC A;  4IZZ A;  1ZG1 A;  1G3S A;  4XQF A;  4RGS A;  3VWB A;  3RKQ A;  1IG7 A;  2KRH A;  2EFO A;  5DM7 F;  1Y39 A;  1QZZ A;  2TRT A;  1BBY A;  2OCC H;  3I0T A;  2LC2 A;  4M3F A;  1XC5 A;  1NK3 P;  2CWE A;  3ZMD A;  1IUY A;  2DA4 A;  4XKC A;  4CYC B;  4Y33 A;  4EVI A;  2ZFW A;  1MW7 A;  3CC7 I;  5FKN A;  1MMS A;  4HG2 A;  2JVG A;  2ISY A;  4ESF A;  3U1D A;  3NRV A;  3WTT C;  1BI2 A;  2FOW A;  3K1P A;  5DCM B;  1LE8 A;  2MA3 A;  1JUP A;  3GFM A;  1SMT A;  3LA3 A;  1MD0 A;  2X51 A;  2GZW A;  3IH4 A;  3M7G A;  4ITV A;  2V1X A;  3CES A;  2R7R A;  2PFB A;  3OS2 A;  1NTC A;  3I3L A;  3WG9 A;  2LLK A;  3CCJ I;  4EJU A;  2V1U A;  3LSI A;  1R58 A;  2OAZ A;  2M3A A;  2VKV A;  2DA7 A;  2ZXW H;  4PDK A;  4LIU A;  2LG4 A;  3SFI A;  2GWR A;  1D1C A;  1STZ A;  3KLO A;  2B63 J;  2ELJ A;  2ESH A;  1DQU A;  1XSV A;  2KJB A;  3QP6 A;  1PUE E;  3FF5 A;  2UWM A;  3PFY A;  1WJD A;  3BJ6 A;  3GTL J;  1D1A A;  2BE5 F;  3UR3 C;  3ZQ7 A;  3CUO A;  1P7I A;  2V9P A;  1IUF A;  3FXQ A;  5IT3 A;  2EFW A;  1X1D A;  5E18 F;  5FLV A;  4AYB N;  2H94 A;  3HSR A;  1JKR C;  2E5Z A;  2R0Q C;  1U5T B;  3C2G A;  5CVR A;  2L9R A;  2D5V A;  3Q9S A;  3C2B A;  2H09 A;  5BS6 A;  4BQA A;  1AHD P;  4BQN A;  1IRG A;  3PIO F;  1SVL A;  1ZH5 A;  1NG6 A;  3C3W A;  3Q0W A;  2JN6 A;  3CC2 I;  4Y3O A;  2IA1 A;  5JI6 A;  2PJR A;  4KIF A;  2DFH A;  5K7F A;  5GAD J;  2L4M A;  2V4J C;  3FMQ A;  3Q9V A;  3REO A;  4CYD A;  5BOX A;  5HDG A;  3RZD J;  2UXX A;  2M7A A;  2M8E A;  1MBJ A;  2QM3 A;  3M8F A;  4EM2 A;  5E17 F;  2HTS A;  4KN7 X;  2JT1 A;  4BY7 J;  3H3U A;  2R7Q A;  5K1Y A;  1AKH A;  3ZQQ A;  2HOA A;  4PGH A;  3LWF A;  4RAY A;  2ZBK A;  1F1Z A;  2R7W A;  2XKP A;  2XC7 A;  2DA1 A;  2FRH A;  2L9N A;  4BYY A;  2A5Y B;  1VQ7 I;  3PNV A;  2EFP A;  2CUE A;  4I76 A;  2HVS A;  3QPL A;  3H36 A;  4KT5 C;  5DEQ A;  1IRZ A;  2KL4 A;  1TW2 A;  5B3S H;  1LFP A;  3LSP A;  1WI9 A;  2XSD C;  1YIJ I;  2HEO A;  1REP C;  2ZSH B;  3HRT A;  3K4J A;  3O2P E;  5DUI A;  3J7Z I;  4F7Z A;  5GTI C;  3A1Y A;  3WTU C;  1B9M A;  2VJI A;  4A3B J;  1R71 A;  1YE9 A;  4D0P A;  4EM1 A;  3S2H J;  2BGC A;  1RES A;  3N05 A;  1HW5 A;  3K4K A;  3GFI A;  1I50 J;  2CMP A;  2XHK A;  2IGO A;  3TOB A;  1WVR A;  3SEZ A;  3BOQ A;  2FA5 A;  3ROU A;  2MGQ A;  4M6X A;  5E8G A;  3AG2 H;  3J80 Z;  2HDW A;  1BR2 A;  3TO7 A;  4L9J A;  4HSR A;  2M4K A;  3RIR A;  1BOB A;  1LEA A;  2OC6 A;  3BPX A;  2GBY A;  3VOD A;  3I4P A;  5FKK A;  4L5J A;  1XD7 A;  5CVI A;  2VC0 A;  3CZ6 A;  2Y69 H;  4V2G A;  3LSG A;  3B6A A;  2IA0 A;  4HDU A;  4S05 A;  2E2H J;  3C18 A;  3UKG A;  2JA2 A;  1H0M A;  4CH7 A;  1OJL A;  3QYB A;  3TW7 A;  4A3D J;  2W24 A;  3HSE A;  2HZD A;  3A0H C;  3LA2 A;  3LSJ A;  3CDH A;  3OYK A;  1TZL A;  4MTD A;  2KIS A;  2GAU A;  4AUX A;  2AHQ A;  3U2R A;  4HBL A;  4IOA F;  3TED A;  1DGR M;  4AU7 A;  4L5E A;  5LHG A;  1P4A A;  1E3H A;  2ZXI A;  5JLX A;  4FHT A;  4RS8 A;  3RSN A;  1APL C;  3OL3 A;  3A4C A;  3ELK A;  4J19 A;  1FYM A;  3S16 J;  3DQV C;  2ZFU A;  1IZ1 A;  1OYI A;  4AVZ A;  2OJE D;  9ANT A;  4C2U A;  3E5X A;  5JLW A;  3GTP J;  2H8W A;  2YUS A;  2BXZ A;  3DU5 A;  3VYS B;  2CRG A;  2X1C A;  4A3K J;  4AM3 A;  2CQK A;  3D5L A;  2DYS H;  3PL8 A;  2EQR A;  5ICC A;  3Q0V A;  1ZK8 A;  2WAF A;  2BY3 A;  4OAZ A;  4W1U A;  1T39 A;  4KIB A;  3KET A;  4RDU A;  5F0C A;  2GQQ A;  2FMY A;  2JSP A;  5AIP A;  1EH8 A;  3H35 A;  4F91 B;  2HU9 A;  2M0M A;  3L2C A;  1ERD A;  2EZI A;  4FIS A;  2LSO A;  3J81 Z;  1E2X A;  2VKH A;  5GAG J;  2E60 A;  4ZZL A;  2CUF A;  4IHV A;  4BDZ A;  4E7J A;  3ZPL A;  1O7F A;  1TQM A;  3K4B A;  3LSM A;  1ON1 A;  2UUZ A;  4J00 A;  3CME I;  1Z3Y A;  3CP8 A;  2RNJ A;  3Q0U A;  3SDG A;  5HS9 A;  1D5V A;  2AO9 A;  2XSJ C;  5HLH A;  2P7V B;  1HDP A;  1WH7 A;  1MJB A;  2HXO A;  4RAZ A;  5EGO B;  1Z3X A;  5J4Y A;  2DDA A;  1BC8 C;  1BIB A;  2DA6 A;  3CCY A;  3MZ8 A;  4BBR J;  4BE0 A;  5HLT A;  2VOO A;  2DLL A;  3DPL C;  3L7W A;  1X3U A;  2HYF A;  5B66 C;  5D5U B;  3FKJ A;  1K7A A;  3HGG A;  4ZH4 F;  1DP7 P;  4E7Z A;  2E2J J;  2XB5 A;  4YEJ A;  2PX9 A;  4HX7 A;  2W25 A;  4BXF A;  2STT A;  1YJ9 I;  1PJR A;  4KJZ A;  1U3E M;  3HPH A;  3ERM A;  2IS4 A;  5J1Y A;  1UCR A;  1XS9 A;  5HOO A;  4XRS G;  4P9F A;  3IC7 A;  1NK2 P;  2KHM A;  4BUP A;  1YW7 A;  3F9K A;  5C3E J;  1Q1H A;  1T98 A;  4B1R A;  5F27 A;  2KIU A;  1VQO I;  3H0D A;  1MDM A;  1QRY A;  4NC8 A;  5M5W J;  3B6C A;  4OIR F;  3CMA I;  2Q2E A;  2Z5U A;  1R49 A;  4TV7 A;  5K5O A;  4GCV A;  4UVA A;  4HW0 A;  4PJM A;  2OCE A;  4XKV A;  1WGX A;  3W2A A;  1MSE C;  4UUT A;  2IGM A;  2IA2 A;  4FCY A;  1WH5 A;  1SFO J;  4ESJ A;  3H3V K;  3QP5 A;  4JK1 X;  3ZXS A;  3CMY A;  4PK4 A;  2UXN A;  3NQO A;  4E6K G;  1KU7 A;  3OOP A;  4Q4Z F;  1QPM A;  3TW6 A;  3FXO A;  1TWH J;  2LKS A;  4YEL A;  2ECC A;  3W6V A;  1OYY A;  4U0W A;  1TNT A;  2ADU A;  2HYG D;  3ZMS A;  3CF5 F;  1GV5 A;  1W1W E;  2VXD A;  5DM6 F;  1ZRE A;  1IRX A;  3ZP5 A;  2RV8 A;  2NOJ B;  5HNF A;  2NNN A;  1LUJ B;  1UHM A;  4YIR X;  2UZK A;  4HLY A;  2E2I J;  4BE2 A;  2YX7 A;  3BJA A;  3E5Q A;  2LBF B;  5H20 A;  3CCQ I;  3H1C A;  1ZHF A;  3BR0 A;  3LOC A;  4LD5 A;  2HTJ A;  1I3A A;  3S32 A;  1XB4 A;  3QAH A;  4XKW A;  3JR9 A;  2VPL A;  2HQR A;  4MTE A;  3BPV A;  2IW5 A;  4IXA A;  2M2E A;  1G59 A;  4BGD A;  2LYC A;  1ETQ A;  1ZRC A;  3JCU C;  2BEO A;  2MG4 A;  2L7M P;  4CYC A;  1FTZ A;  4P9U A;  4I99 C;  4FX4 A;  4PJN A;  2JZY A;  1MGT A;  3G2B A;  4PSW A;  1S29 A;  3BCB A;  4RAG A;  2E5N A;  2DOE A;  4HST A;  1A6I A;  2X48 A;  4ZYD A;  5DCM A;  1GVD A;  4L9V A;  5B1B H;  5GAE J;  4KA4 A;  2ICW G;  2V1N A;  3VPR A;  5LHH A;  1S5L C;  1I6X A;  2EZL A;  4Y15 A;  1D8K A;  1T08 B;  2RDP A;  3CCM I;  5H6R A;  1P4X A;  3WGG A;  1S7O A;  2ZKZ A;  1JJ8 C;  1F4K A;  2CJJ A;  2KT0 A;  2A61 A;  4OOI A;  1RET A;  5D8L B;  1POG A;  1JI8 A;  1S8N A;  1U8B A;  2W48 A;  3H5R A;  4ESB A;  1Y8R B;  5FGM A;  5K7Z A;  1ZG5 A;  3JW4 A;  2BVL A;  2ZME C;  2K4J A;  1SFK A;  3OYE A;  2QLZ A;  3LFK A;  5L3F A;  4N9H A;  2FNP A;  5ILV A;  3BT9 A;  1JGG A;  1D0Z A;  3E0J B;  1B4A A;  3IP4 B;  4J01 A;  1QBJ A;  4IKF A;  5FKM A;  2M1B A;  4QWQ A;  3K2A A;  4A3M J;  1TL8 A;  2W4S A;  5E79 C;  3VEP A;  3QOE A;  2XRN A;  1OR7 C;  3ZMV A;  2EIN H;  1LPQ A;  4KMU X;  4RMN A;  2NS0 A;  4PZJ A;  1BW6 A;  1IDY A;  3L2V A;  1OCT C;  2DK5 A;  2E1N A;  3F6V A;  1ZEL A;  1G8X A;  1QGP A;  2CG4 A;  2M5W A;  3I59 B;  2F6C A;  3F8M A;  4XIC A;  3S8P A;  1U5T A;  3OMY A;  4M3G A;  3AG3 H;  5CYV A;  3HOW J;  1SFX A;  2RGV A;  4IHY A;  2YR2 A;  3RPQ A;  1YQA A;  3QPS A;  4P5O A;  4RM2 A;  1IXS B;  4N0B A;  1JUS A;  3L9F A;  4C3I J;  4XBF A;  1L0O C;  4ZDL A;  5LGN A;  3FDY A;  4UUS B;  3MZH A;  5B1A H;  1XN7 A;  2Y31 A;  4NC7 A;  3VOE A;  2O8K A;  3VFZ A;  2R7V A;  2HKO A;  1JT6 A;  1JKQ C;  3QU3 A;  1YO5 C;  3HTU A;  2HDD A;  5CVJ A;  1SAN A;  3IH2 A;  1GUU A;  4U7D A;  4L9T A;  4D5F A;  3F6O A;  1FT9 A;  4CSW A;  2O6G E;  3Q5F A;  5H2F C;  3KE2 A;  1ZR4 A;  1T8I A;  2BV6 A;  1I3Q J;  2W82 A;  2BW3 B;  2EZK A;  3OV8 A;  4CDG A;  1ETO A;  1HDD C;  3K70 C;  3P9K A;  4F52 A;  1JXS A;  4IJA A;  1LJ9 A;  3WHC A;  3WU0 A;  2QSH X;  2ZME B;  1HLV A;  3P5J A;  3V42 A;  5D5V B;  4DBQ A;  5E1X A;  5BMZ A;  2Y48 A;  3JRG A;  1CQT A;  4HNU A;  1FTT A;  1WJC A;  2ID3 A;  3L2R A;  2KJC A;  2WY7 Q;  3IKT A;  3W2V A;  1U6G A;  2OZ6 A;  1K6Y A;  3BTC A;  2GOX B;  3NWS A;  2K9M A;  3F8C A;  4CCJ A;  3ZQI A;  1VND A;  3DLA A;  3V8L A;  2OQR A;  3E6D A;  1FP2 A;  2P6T A;  2RNG A;  2X4H A;  3U9G A;  4EQQ A;  3J80 K;  1JTY A;  1L3L A;  3VYR B;  3GF2 A;  2R92 J;  1HKQ A;  4ENN A;  1ZAO A;  4B3A A;  4IQ4 A;  1H9T A;  2R7Z J;  4WXC A;  1KQ9 A;  2V9V A;  4GO1 A;  4NQW B;  3FK6 A;  3B73 A;  3T8T A;  4CCM A;  4UB8 C;  1SD6 A;  3AG4 H;  2ME6 A;  1FBS A;  5KAF C;  3FM3 A;  2EK5 A;  2GA2 A;  2ZJP F;  4DZP A;  3MN2 A;  4CUG A;  4QPQ A;  4ETS A;  3DTK A;  5C44 J;  2L9V A;  2H1L A;  3OYD A;  1OIS A;  2L7K A;  5FB2 A;  3LSR A;  2CU7 A;  1YFH A;  1AU7 A;  4BNC A;  1WHU A;  2BYV E;  1T2K A;  3M1C A;  2CW7 A;  2Q8K A;  1X1B A;  1UST A;  1RC9 A;  5A2Q Z;  3GXO A;  3MKY B;  2JTV A;  1R5H A;  4AD9 A;  3RYP A;  1W7P D;  1PDN C;  1G3Y A;  3HRS A;  5CJ9 A;  4BDY A;  2VUM J;  5EEA A;  1XSX A;  1Z0X A;  2LF8 A;  2VBX A;  3I53 A;  2IT0 A;  2HI3 A;  4EJO A;  3ABM H;  3OYH A;  3HHH A;  1EKE A;  1FYK A;  2YSR A;  1OCZ H;  3TL4 X;  2F5F A;  2FBH A;  3F3X A;  2LP0 A;  4XOP A;  2KRC A;  1ENH A;  4EJW A;  4KN4 X;  1S7E A;  4G8X A;  5GAH J;  4JBA A;  5EG0 B;  4N4N B;  3M9A A;  3TO6 A;  1QVT A;  3Q3S A;  5IT9 Z;  2W00 A;  3FHZ A;  2ZNY A;  3FZV A;  3PSI A;  1MBF A;  1FX7 A;  3J81 K;  3PIP F;  3F8F A;  3D0S A;  3MVP A;  3RPU A;  4EMS A;  3FXK A;  4XID A;  3HOU J;  2DFF A;  4CZC A;  4U0V A;  2DOD A;  2M0C A;  1U2W A;  5KK1 A;  3KPH A;  3TGN A;  2VJ4 A;  4EGZ A;  1ETK A;  2V26 A;  2P7C B;  5HNH A;  1B1B A;  1R1U A;  2DI3 A;  1OMI A;  1IN6 A;  4A3I J;  3COA C;  3CQZ J;  4BJ6 C;  1H8A C;  3ZMT A;  3CC4 I;  2RN7 A;  5EGO A;  3HDD A;  1E0E A;  3C7J A;  2H6B A;  4ENJ A;  2LMD A;  3GTK J;  3K1M A;  5M5X J;  2QSG X;  1P2F A;  2BVM A;  1T0F C;  2JPB A;  4MO7 A;  1UEL B;  2MAB A;  2YU3 A;  3J7A O;  4O6J A;  2F5E A;  4LJZ F;  2EIJ H;  2UV1 A;  3K4N A;  2A6T A;  3G6E I;  4WXH A;  4JX5 A;  3JRC A;  4PJ0 C;  3L1P A;  3PQK A;  4G12 A;  4RGU A;  2O3F A;  1YG2 A;  2K9S A;  2EA2 A;  3WE2 A;  3HOV J;  3K4C A;  3FK7 A;  3R6S A;  1F5T A;  4QPO A;  3TBI A;  4IHX A;  3OYM A;  2XAU A;  3DXJ F;  1SVM A;  2OF7 A;  3KP2 A;  5B5E C;  3EYY A;  1W0T A;  1VQP I;  1RKW A;  5TRD A;  4F55 A;  2X85 A;  3HG9 A;  3UNG C;  3F21 A;  1D5Y A;  2K3P A;  2H27 A;  1FJL A;  3BG9 A;  1MMD A;  3FBI B;  4F93 B;  4KIC A;  1CF7 B;  1HKT A;  2P0W A;  3KZY A;  1AOY A;  1DGW Y;  1P92 A;  5LHI A;  3DU6 A;  5DTD A;  1S6L A;  1H9G A;  3DCF A;  3EUA A;  3LQR A;  2PMH A;  2X6Y A;  3FMR A;  4KUM A;  5J8C A;  3DLL F;  3A03 A;  3I71 A;  1WJF A;  1EH6 A;  2WV0 A;  5CVU A;  1TWG J;  2R7F A;  2CV1 A;  4A3L J;  1VQ5 I;  4HV5 A;  4PFO A;  2C6Y A;  4DJA A;  5D4R A;  3GLL A;  4HA8 A;  3JAM Z;  4X6A J;  1UG2 A;  1IXC A;  4LLG F;  2RRE A;  3HRU A;  4C3J J;  2Y9Y A;  2H6C A;  2F4I A;  1HA8 A;  1YYV A;  3MAJ A;  1X2N A;  4BHP A;  2CSO A;  2E36 A;  1TT5 B;  1SD4 A;  3I58 A;  2YU9 J;  3ZQL A;  2O03 A;  2O8X A;  4RB0 A;  1J5Y A;  2HYJ A;  5BQT A;  3JRI A;  1R7J A;  2LBF A;  2ZSI B;  5JHU A;  1LVK A;  1OCR H;  1TWA J;  5ICG A;  3HZJ A;  4IF4 A;  1QZE A;  4B48 A;  3ERE D;  2NRA C;  3LA7 A;  3SZG A;  4XON A;  5GTH C;  1U78 A;  2XDV A;  2ZB9 A;  3BR2 A;  1V55 H;  1UJ8 A;  2PLY A;  5HLG A;  2QQ9 A;  4RLQ A;  3WOD F;  1QVU A;  3WG7 H;  1GV2 A;  5CPR B;  1WKM A;  2CUJ A;  3M8J A;  2IRF G;  1K61 A;  2DA3 A;  2J5O A;  3EUH C;  1YW9 A;  1BR1 A;  2JUC A;  5FRM A;  4I98 B;  4PSX A;  3CCU I;  2KQR A;  1PP7 U;  1JHF A;  4IO9 F;  4HQE A;  1O7L A;  3TDZ C;  2LH9 A;  4JQF A;  1YHQ I;  3ABT A;  3DKY A;  4HF0 A;  1Z1D A;  2G0E A;  1HF0 A;  1LDK B;  3K0L A;  3RKX A;  1MBK A;  2I8D A;  1RR8 C;  1ETV A;  2OV7 A;  4CCN A;  1VQ9 I;  3DF8 A;  4CXF A;  1B8I B;  3IV5 A;  1Z67 A;  3CP2 A;  2OTJ I;  1IDZ A;  3MD2 A;  4ANJ A;  3LAJ A;  3EUK L;  3V7S A;  1EH7 A;  2IS2 A;  1G2H A;  1NHA A;  2VJ5 A;  3I9V 2;  4M3B A;  4C2M J;  5IYD J;  3WU1 B;  1HOM A;  4A3C J;  2E19 A;  4PJJ A;  4M6Y A;  2FEZ A;  3VSL A;  3G3Z A;  3D5R C;  2DOA A;  4I01 A;  1XMX A;  2P81 A;  2DT5 A;  3ZQC A;  3TOA A;  5E8I A;  3JSP A;  1TTY A;  2FU4 A;  1K79 A;  2ZJ2 A;  1T6S A;  3GVA A;  4JP0 A;  3RQI A;  3I59 A;  4A6E A;  2FBK A;  1ON2 A;  1WJA A;  5J1R A;  2P4W A;  1YW8 A;  2P5L C;  2L4A A;  2RVC A;  2X6W A;  1TC3 C;  4Z2Y A;  4G7Z F;  3KIO A;  3WTV C;  2MD0 A;  4MGR A;  1LB2 A;  4H4K C;  1ONV A;  3BR1 A;  3V8K A;  3EET A;  3QYE A;  1LDJ A;  3HKZ A;  5FKL A;  3WTS C;  1YJN I;  3SZT A;  3FHN A;  4UVC A;  4UUS A;  1Y1W J;  3OYN A;  1FC3 A;  2Y30 A;  1HW1 A;  5ERI A;  1FSH A;  3CJQ B;  1GHC A;  3K7A J;  5IP9 J;  3T8R A;  1VQK I;  3MZY A;  2QYO A;  5D5W B;  2V6E A;  2VN2 A;  1X1A A;  4N9I A;  2L7Z A;  1M1E B;  1QQI A;  2O5R A;  5EDN A; 
#chains in the Genus database with same CATH homology
 1BJZ A;  2DTZ A;  1GV5 A;  4DYQ A;  2LY9 A;  2FQ4 A;  4JX4 A;  4GFB A;  2DMU A;  3NAU A;  4QIW N;  4D7M A;  3FIS A;  2E2I J;  2Y9Z A;  2XGE A;  4JYK A;  2KDZ A;  1MH3 A;  5M3F J;  3OOU A;  3BR0 A;  3BG5 A;  3LOC A;  3JR9 A;  2HXI A;  1W0U A;  1Y1V J;  4A3F J;  2M2E A;  4B4C A;  1ETQ A;  1BA5 A;  1R9T J;  4CYC A;  5HOD A;  2MG4 A;  1MBH A;  2L7M P;  1FTZ A;  2LFB A;  2HQ5 A;  2WB1 N;  1A6I A;  2DA2 A;  4D5C A;  2WAQ N;  1WPK A;  3ZQH A;  2ME0 A;  2X48 A;  3MKL A;  4V2F A;  1GVD A;  4AC0 A;  2JA7 J;  1IC8 A;  3VPR A;  2Y0S N;  1O4X A;  1JT0 A;  2XPU A;  2EZL A;  4DW6 A;  3S1Q J;  3PO3 J;  1ETX A;  2R93 J;  2HOS A;  1ZTR A;  5GPA A;  3M3Y J;  2CQQ A;  1JJ8 C;  5EZH A;  2CJJ A;  2KT0 A;  4A69 C;  3DEW A;  4BKX A;  4A3E J;  1RET A;  2NOG A;  1POG A;  1U8B A;  2W48 A;  2LTP A;  3BR6 A;  4MIM A;  4Y7N J;  1JJ6 C;  5E3N A;  5K7Z A;  5FJ8 J;  4BBS J;  2FD5 A;  3BTI A;  1UMQ A;  3D1N I;  1DU0 A;  3HOZ J;  4MLO A;  3JRF A;  1TWC J;  2I10 A;  2DMT A;  3BG3 A;  3BT9 A;  1JGG A;  5F04 A;  3GTO J;  2JWT A;  3S1N J;  2LVS A;  3ZQF A;  5FKM A;  4FE4 A;  5IOY A;  4A3M J;  3F0C A;  3K2A A;  4QTR A;  3HGY A;  5GP9 A;  3ZOB A;  2MW8 A;  1T56 A;  1FEX A;  2NVX J;  1F43 A;  4XRM A;  2XRL A;  5GPC A;  1BW6 A;  1IDY A;  1OCT C;  3TP3 A;  5FLM J;  2QCO A;  2E1O A;  4XK4 A;  4XIC A;  3JRE A;  1GDT A;  2IBD A;  4M3G A;  3HOW J;  2LD5 A;  4IHY A;  1LFB A;  2JMW A;  1XG1 A;  3QPS A;  1IV6 A;  3HOY J;  1BW5 A;  4C3I J;  2O9L A;  1JUS A;  3PO2 J;  2IAI A;  1ZGW A;  4JX6 A;  1YRN B;  2TCT A;  5EG0 A;  4UUS B;  3FKI J;  1LFU P;  2XGD A;  2XB0 X;  2Y31 A;  2LK2 A;  2XPV A;  2O8K A;  5M3M J;  2N8G A;  4IEJ A;  3S17 J;  1JT6 A;  5EF6 A;  1JKQ C;  1JUM A;  3HKZ N;  4LOC A;  2EH3 A;  3S15 J;  2X9D A;  2HDD A;  3A01 A;  1ZQ3 P;  2HOT A;  2Y2Z A;  1SAN A;  2XPW A;  3IH2 A;  2K40 A;  3G1L A;  5F0F A;  1GUU A;  1YRN A;  2VI6 A;  1Z77 A;  4D5F A;  3WHB A;  2QF7 A;  3NAR A;  3RZO J;  3CDL A;  2O7O A;  1ZR4 A;  1X58 A;  1I3Q J;  2EZK A;  2NVT J;  1ETO A;  1HDD C;  3RKQ A;  1IG7 A;  3WHC A;  2VKE A;  1MBE A;  2TRT A;  1HLV A;  4M3F A;  1XC5 A;  1NK3 P;  2DA4 A;  4CYC B;  3GBG A;  2XGC A;  4XRS A;  3JRG A;  1CQT A;  1IGN A;  5EZG A;  4I6Z A;  1FTT A;  1MNM C;  2M9H A;  2ID3 A;  5FKN A;  1FIA A;  1LE8 A;  2FX0 A;  3BTC A;  5F0H A;  3G1M A;  5E3O A;  1JUP A;  3ZQI A;  1VND A;  3IH4 A;  2JA6 J;  1TWF J;  1JTY A;  1WCM J;  1NTC A;  2R92 J;  3OIO A;  4MFE A;  4B3A A;  2LLK A;  1ETW A;  2R7Z J;  3BQY A;  2DJN A;  2VKV A;  2L7F P;  5DS9 A;  3FK6 A;  2LKX A;  2DA7 A;  1OFC X;  3SFI A;  2ME6 A;  5E3M A;  2B63 J;  1B72 A;  2GLO A;  4DZP A;  3MN2 A;  3IH3 A;  2MSY A;  2DN0 A;  2GM4 A;  2K9N A;  5C44 J;  1H88 C;  1WI3 A;  4M3D A;  3LSR A;  2CU7 A;  5C4J J;  1AU7 A;  3GTL J;  2FJ1 A;  1P7I A;  1IUF A;  2R5Y A;  4D7N A;  1K83 J;  5FLV A;  3BTL A;  4AYB N;  1JKR C;  2R0Q C;  2VUM J;  5EEA A;  4DYC A;  5E3L A;  1Z0X A;  2L9R A;  2D5V A;  2EZH A;  2HI3 A;  3C2B A;  1RR7 A;  1AHD P;  2DMQ A;  4IHW A;  3Q0W A;  2JN6 A;  2LP0 A;  3H0G J;  5IP7 J;  1ENH A;  1S7E A;  4A3J J;  5K7F A;  3O8G A;  5EG0 B;  2NVY J;  1EF4 A;  1QVT A;  3Q3S A;  1RKT A;  3RZD J;  3BQZ A;  1MBF A;  1MBJ A;  1QPI A;  3MVP A;  4BY7 J;  4XID A;  3HOU J;  2DMP A;  2M0C A;  1ZR2 A;  5M5Y J;  1AKH A;  3A01 B;  2HOA A;  1ETK A;  5F1J A;  2NVQ J;  2DA1 A;  3ZQG A;  4A3I J;  1H8A C;  3CQZ J;  3G1O A;  2CUE A;  4I76 A;  3QPL A;  1IRZ A;  2X6O A;  5EGO A;  3HDD A;  2DA5 A;  2JK3 A;  2M34 A;  5FKO A;  5K7H A;  3LSP A;  3GTM J;  3GTK J;  2XSD C;  5M5X J;  3BR5 A;  4MO7 A;  5IYC J;  2L0K A;  2EBI A;  1H89 C;  1B8I A;  4A3B J;  1ZKG A;  4JX5 A;  3JRC A;  3S2H J;  3L1P A;  1RES A;  4G12 A;  2K9S A;  3FIW A;  1BL0 A;  3HOV J;  1I50 J;  3S2D J;  3FK7 A;  1U9O A;  4IHX A;  1IJW C;  2NS7 A;  2OF7 A;  3HBL A;  3GTJ J;  5J1U A;  3S1R J;  1LE8 B;  2MGQ A;  1W0T A;  1RKW A;  1FIP A;  1D5Y A;  1Q1V A;  3LNQ A;  2ID6 A;  1FJL A;  3BG9 A;  1VF9 A;  2LR8 A;  2GBY A;  1A5J A;  5FKK A;  2DMN A;  5J3L A;  4BY1 J;  5DTD A;  2RAE A;  4V2G A;  3LSG A;  3B6A A;  2E2H J;  4BXX J;  4ABZ A;  3DCF A;  1PUF A;  3E7L A;  3UKG A;  1OJL A;  3TW7 A;  2JA5 J;  4A3D J;  3A03 A;  2R5Z A;  3LSJ A;  1TWG J;  1VI0 A;  1B72 B;  4AUX A;  2AHQ A;  4A3L J;  1RPW A;  3TED A;  1JKO C;  2IEK A;  4L5E A;  1HCR A;  3GTQ J;  2PMZ N;  4FE7 A;  1U9N A;  5JLX A;  4X6A J;  1APL C;  1UG2 A;  1P7J A;  4J19 A;  4C3J J;  2Y9Y A;  3S16 J;  4FTH A;  9ANT A;  5BNG A;  3HOX J;  2R5Y B;  3TP0 A;  2YS9 A;  4DYR A;  5JLW A;  1X2N A;  3GTP J;  2JJ7 A;  1I6H J;  2YUS A;  5C4X J;  2CRG A;  3BR3 A;  4A3K J;  2YU9 J;  1E3O C;  3ZQL A;  1MH4 A;  2EQR A;  2K9Q A;  3Q0V A;  3SJM A;  1ZK8 A;  2HYJ A;  5F08 A;  3JRI A;  4W1U A;  2VPR A;  1TWA J;  4RDU A;  5F0C A;  5IP6 A;  4A3G J;  2H1K A;  2EZI A;  1U78 A;  4FIS A;  4QSH A;  3JRD A;  2ZB9 A;  3PM1 A;  3BR2 A;  1T33 A;  2CUF A;  4IHV A;  1ITY A;  4HNV A;  1ORK A;  1QVU A;  2M8G X;  3JRB A;  1GV2 A;  3I4M J;  1MSF C;  3OSG A;  1K61 A;  2DA3 A;  1AKH B;  1ETY A;  2NS8 A;  3Q0U A;  3SDG A;  5EYR A;  5IYB J;  3OSF A;  2AO9 A;  1OCP A;  5IPA A;  2H8R A;  1HDP A;  1WH7 A;  4Y52 J;  2HXO A;  2CQX A;  5EGO B;  2G0E A;  3HB9 A;  1HF0 A;  2DA6 A;  3CCY A;  4BBR J;  1MBK A;  4RBO A;  1ETV A;  4S0H B;  3JRA A;  1B8I B;  3IV5 A;  4MFD A;  2WV1 A;  1IDZ A;  1DU6 A;  3HGG A;  2E2J J;  1UHS A;  2XB5 A;  1G2H A;  5IYD J;  4M3B A;  4C2M J;  3GTG J;  4W97 A;  3S1M J;  1HOM A;  5J1Y A;  3JRH A;  1X2M A;  4A3C J;  2E19 A;  2JA8 J;  1XS9 A;  2COB A;  4XRS G;  3HEF A;  2P81 A;  1NK2 P;  3ZQC A;  5C3E J;  4B1R A;  5F27 A;  3QQA A;  4JP0 A;  3RQI A;  4DZJ A;  1QRY A;  1MBG A;  3A02 A;  4C3H J;  5M5W J;  3B6C A;  1VFC A;  5J1R A;  1TC3 C;  4M6V A;  4M3E A;  4X1E A;  1PUF B;  3BR1 A;  2OPT A;  1WGX A;  2ECB A;  3O8H A;  2R5Z B;  1GT0 C;  1MSE C;  5FKL A;  5IOZ A;  4UUT A;  3S14 J;  4UUS A;  1Y1W J;  4FCY A;  2ELK A;  1WH5 A;  1SFO J;  3HM5 A;  2Y30 A;  3H3V K;  3CMY A;  3K7A J;  5IP9 J;  4A93 J;  1F36 A;  4NDL A;  3I4N J;  3BTJ A;  3TW6 A;  1JKP C;  4EEF G;  2L7Z A;  1TWH J;  1JTX A;  2ECC A;  3W6V A;  3M4O J;  5EDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...