2ME6A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens in complex with the dna sequence cgactaattagtcg
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 16
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me6A00
2N8GA 5EGOB 3D1NI 2LKXA 2Y30A 4FTHA 1POGA 1T33A 3S2HJ 3OIOA 1GT0C 2CUEA 1JKQC 1FTTA 4QIWN 5C4JJ 1SFOJ 3GTOJ 4XK4A 4A3GJ 3O8GA 4S0HB 3S16J 3LSRA 1LFBA 3A01A 4LOCA 1Z77A 1NK2P 3M3YJ 2KDZA 4A3BJ 5E3MA 2CJJA 4AC0A 4XRSA 3S2DJ 1JJ6C 2K9SA 2NS8A 1HDPA 2EZIA 2DA3A 3DEWA 3ZOBA 3IH3A 3GTPJ 2WV1A 1H88C 1JTYA 2NVXJ 3S14J 1TWHJ 1H89C 3TP0A 5FLVA 5FLMJ 3ZQGA 5IYBJ 2KT0A 2DMNA 2DMQA 4B3AA 4BKXA 1WH5A 5E3OA 1IUFA 3PO3J 2R92J 5K7ZA 3SJMA 4C3IJ 1JGGA 2R5ZA 2DA4A 4DZJA 2JA5J 2E2IJ 3BR6A 3QQAA 2RAEA 2HYJA 2HOAA 2L7FP 4BXXJ 3S1NJ 5DTDA 2L0KA 2X6OA 4FE4A 5F0HA 1TWCJ 3HBLA 4B4CA 1JT6A 3JR9A 2OPTA 3QPSA 4C3JJ 5M3FJ 4W1UA 2VUMJ 2XRLA 1K83J 2LFBA 1IDYA 1ZTRA 2EZLA 2XGDA 1ZGWA 5E3LA 4C2MJ 3QPLA 3IV5A 1I50J 5EDNA 2EH3A 3TEDA 1MNMC 3JRHA 5J1UA 1VNDA 1GDTA 4JP0A 1JT0A 4A3CJ 2AO9A 4BBSJ 3BR3A 1ETVA 1MBEA 2E2HJ 2E2JJ 3Q0WA 2DJNA 5FKOA 3JREA 3BR2A 2Y9YA 5EG0B 2DA7A 1H8AC 2IEKA 2VI6A 2W48A 4JX6A 3G1LA 2LK2A 4G12A 4XIDA 2XGEA 1AHDP 2TCTA 3UKGA 5EG0A 1VI0A 2O7OA 2HOTA 2NVTJ 1RKWA 5F04A 1HLVA 3GTLJ 1DU6A 1WI3A 2IBDA 4V2GA 5JLXA 4BBRJ 1LE8B 3SFIA 1D5YA 3RKQA 4A3KJ 5EZHA 1U8BA 4NDLA 1P7JA 2NVYJ 2R93J 1PUFB 2JK3A 3DCFA 1MBKA 2R5YB 1DU0A 1LE8A 1RKTA 3MN2A 2HDDA 4I76A 1WGXA 2CRGA 1UG2A 2DMPA 2EQRA 2YUSA 2L9RA 3HM5A 4J19A 2CUFA 5M5WJ 3GTKJ 1W0UA 2ID3A 1HCRA 4HNVA 2LD5A 3BR0A 1A6IA 2M9HA 3BT9A 3WHCA 4B1RA 2JN6A 4A3JJ 1U9NA 4M3GA 2M8GX 4M3DA 5EGOA 5GP9A 1ETKA 3BQZA 2MGQA 4BY7J 5HODA 3OSFA 2MG4A 4W97A 1BA5A 1SANA 2ECCA 2R7ZJ 3MKLA 3CDLA 1X2NA 1X58A 5IOYA 1RESA 3BTIA 1WH7A 4V2FA 5FKNA 4A3IJ 2M34A 3HOVJ 2LTPA 2X48A 2DTZA 3JRFA 2E1OA 1QRYA 1GVDA 1R9TJ 2R0QC 1AU7A 5IOZA 1IDZA 4UUTA 1I6HJ 3RZDJ 1IRZA 1K61A 3BQYA 2DA5A 5FKMA 4UUSB 2JA6J 2ELKA 1TWFJ 3B6CA 1MSFC 9ANTA 1P7IA 2GBYA 2XSDC 1JTXA 1FJLA 2CQQA 2VPRA 1XS9A 2FX0A 2L7MP 2DMUA 1NK3P 2H1KA 4A3DJ 2ECBA 4QTRA 2LR8A 2O9LA 4DZPA 3MVPA 1HF0A 1QPIA 3C2BA 2MW8A 3FIWA 1RR7A 3M4OJ 1RETA 3LNQA 4FE7A 5IP6A 3G1OA 4MO7A 3JRBA 4ABZA 3NAUA 2D5VA 2HOSA 3ZQLA 1G2HA 4IHVA 1ORKA 2DA1A 4D7NA 1VFCA 4AYBN 3L1PA 2M0CA 2EZHA 1B8IB 5FKKA 3LOCA 1OJLA 2I10A 3HOYJ 3W6VA 2Y0SN 3HOZJ 1GV5A 1OCTC 2Y2ZA 2VKEA 4Y7NJ 2LP0A 4JX4A 1U9OA 2LLKA 1B72B 2XB5A 3S1RJ 2LY9A 3WHBA 1BW5A 3JRAA 2JMWA 3Q0VA 3PO2J 3BTCA 2GM4A 2COBA 4DYCA 1IC8A 3OOUA 2FJ1A 3FK6A 4FCYA 3G1MA 3LSPA 4M3BA 5BNGA 4XICA 4CYCB 3F0CA 1JJ8C 1GUUA 1FIAA 5M5XJ 1TWAJ 4A69C 2E19A 3B6AA 3TW6A 3LSGA 3HKZN 1ENHA 4GFBA 3ZQIA 4CYCA 1QVTA 1F43A 5EF6A 2HI3A 3GBGA 3JRIA 1MBJA 3H0GJ 1ZK8A 3A02A 1MBHA 1UMQA 5C4XJ 1Z0XA 4M6VA 1Q1VA 5GPCA 3ZQCA 1ZQ3P 5F0FA 3HEFA 4FISA 2JA7J 2ME0A 2X9DA 2XB0X 1IG7A 2DN0A 5F0CA 3HB9A 1HOMA 2XPUA 1JKOC 2O8KA 5M3MJ 3K2AA 1PUFA 4XRMA 2R5YA 1JUPA 4IHXA 1LFUP 4L5EA 1MBFA 4DYRA 4D5CA 2L7ZA 2ME6A 3GTMJ 1XC5A 1FIPA 2HXIA 1ZKGA 4QSHA 2AHQA 2K40A 2NOGA 5K7HA 5F27A 3GTGJ 1JUSA 4RBOA 3TP3A 4JX5A 3I4NJ 1X2MA 3BTLA 3HOXJ 1T56A 1ZR2A 3Q0UA 1E3OC 1BL0A 2Y31A 2NVQJ 3S1MJ 3A01B 1IGNA 3HDDA 4AUXA 1F36A 5F08A 2XPWA 2QCOA 4I6ZA 3HGYA 4RDUA 5IP7J 1TWGJ 3HGGA 1A5JA 3OSGA 1GV2A 4M3FA 1JKRC 2NS7A 2PMZN 3FKIJ 1OCPA 2B63J 5FJ8J 5IYDJ 1RPWA 4UUSA 2H8RA 5M5YJ 4X6AJ 1I3QJ 1HDDC 2VKVA 4MLOA 3VPRA 4A3MJ 4IHWA 2G0EA 1TC3C 1ZR4A 3LSJA 1ETXA 2WAQN 4JYKA 4MFDA 1S7EA 1ETWA 2M2EA 1Y1WJ 2CQXA 2JA8J 2R5ZB 1YRNB 5J1RA 1UHSA 4MIMA 4DW6A 2P81A 4EEFG 2MSYA 1W0TA 2ID6A 4DYQA 4Y52J 3RQIA 1MH4A 3BG5A 3FISA 1MBGA 4MFEA 5EEAA 5E3NA 1YRNA 5DS9A 3BR5A 5F1JA 1MSEC 3NARA 5J3LA 3PM1A 2CU7A 1OFCX 1QVUA 1WCMJ 2DA6A 2HQ5A 5C3EJ 3ZQFA 1IJWC 2YS9A 1MH3A 1FEXA 2LVSA 2Y9ZA 1ETYA 4C3HJ 5J1YA 2EZKA 4M3EA 3JRDA 1B8IA 4A3FJ 5EZGA 1IV6A 1U78A 5C44J 1Y1VJ 2QF7A 1ETOA 3GTJJ 3BG3A 2K9QA 3HOWJ 2DA2A 3TW7A 4IHYA 3FK7A 2EBIA 1ITYA 5IP9J 1APLC 1B72A 4IEJA 1FTZA 2DMTA 1BW6A 1WPKA 2FQ4A 5EYRA 2JWTA 1CQTA 1JKPC 2YU9J 2XGCA 4BY1J 4A3EJ 2TRTA 3K7AJ 3ZQHA 1O4XA 3S15J 3JRGA 5IYCJ 3IH4A 3Q3SA 3BTJA 3S17J 5IPAA 3HOUJ 2XPVA 1BJZA 3O8HA 4XRSG 2GLOA 3GTQJ 2FD5A 3BR1A 1XG1A 4A3LJ 3I4MJ 3CCYA 4D5FA 2WB1N 3RZOJ 3S1QJ 1ETQA 3BG9A 3SDGA 1EF4A 1VF9A 3JRCA 4X1EA 2ZB9A 1AKHB 5K7FA 2HXOA 5GPAA 3A03A 2IAIA 5JLWA 2OF7A 4D7MA 1JUMA 1NTCA 3E7LA 2JJ7A 3H3VK 4A93J 1AKHA 3IH2A 3CMYA 5FKLA 2K9NA 3CQZJ
chains in the Genus database with same CATH superfamily
1YG2A 2IPQX 1BOBA 1HC8A 3D1NI 1UAAA 5KAIC 5ICCA 2HWVA 1T33A 1T6SA 3M7GA 1QQIA 3GFLA 3IRQA 2O5RA 1RIOH 2ESNA 2DT6A 4QIWN 1OYYA 1SFOJ 2K85A 2K27A 3GTOJ 4O3MA 1G6NA 1R5ID 3ABKH 2Q2EA 3T0YA 4LIUA 1XSXA 5HS9A 4H0EA 1MMGA 2BXZA 3H5RA 4LOCA 1D0YA 4WXCA 3A01A 3PQJA 1X1AA 1MMAA 3DTEA 3SZTA 3FHNA 1LQ1A 3TDZC 3K2ZA 3TQNA 4J00A 4P96A 2EZIA 3FM3A 3W2WA 2Z99A 3IH3A 3T1BA 5D5XB 1HXDA 3QOPA 2WV1A 1K7AA 2NVXJ 3S14J 3TP0A 4QLCU 2Z3YA 3P9CA 1ZGAA 4RM2A 2A5WA 3OYIA 2KT0A 2XASA 1AWCA 3KFWX 3UNGC 4BKXA 3DF8A 5E3OA 4ZC3A 3V8KA 1OR7C 2NOJB 2R7RA 2UXNA 4DJAA 3SEQA 2KIMA 1KQ8A 2A6EF 2VJ4A 4UHTA 3QQAA 2HYJA 2CW8A 1R1VA 3R4KA 3WTSC 1ZAOA 3M8FA 2L0KA 2X6OA 5AIPA 4AIDA 1TWCJ 4LK0F 3W6KB 3R61A 4QPOA 3JR9A 4FHTA 3VYSB 3CCUI 1F9NA 3HTSB 2VBWA 3QPSA 2R7DA 4U0VA 2QYOA 4CA0A 4EJVA 4WX9A 1VQLI 2VUMJ 4R1HA 2XHKA 3JSPA 2W7NA 4B44A 1TW3A 3OR1C 2OU2A 1YO5C 1Z67A 2XGDA 2YX7A 4RB0A 1ZGWA 5ICEA 1I50J 2KQRA 3CO6C 3QP5A 1XGOA 1IV8A 2NVUB 4A0YA 4YIRX 3IL2A 1X1BA 1ZELA 2LBFA 2X1EA 3LMMA 2E2JJ 1MGTA 2VL8A 3Q0WA 4BL0B 2R4GA 5DUKA 3RTRA 1YTYA 2BEOA 2X1DA 4Z6YA 5L3DA 3WTTC 2EV0A 1HSTA 4XBFA 5B1AH 1H8AC 1FX7A 1MKMA 2W48A 1NG7A 4AWXB 3G1LA 5DDGA 2XGEA 1AHDP 2FXAA 2TCTA 4HYEA 3UKGA 1VQNI 4A12A 2EWNA 3GLLA 2QLZA 2HPMA 2LC2A 5F04A 3SFIA 5HLHA 3KETA 3RKQA 1I5ZA 4A3KJ 5EZHA 3VYUB 3CCRI 3ZMVA 4RLFA 1U6GA 1MD0A 2R93J 4PJLA 1PUFB 2BVMA 1ZRFA 4IKFA 4C30A 1T08B 3OL3A 3MN2A 3OL4A 2HDDA 2RREA 4I76A 2YUSA 2L9RA 4KN7X 4NBQA 5M5WJ 2STTA 4RGSA 2H1LA 2JSCA 2MC3A 3BR0A 1J5YA 3FXLA 2WA0A 3H1CA 3QP6A 4PFOA 3PNVA 2LG4A 4IQJA 1U9NA 4HOBA 1KONA 1RC9A 2M8GX 2P7VB 4XONA 2ZMEB 2A3SA 2M7AA 1ETKA 1J09A 1R7JA 2Z33A 2KFDA 4I0BA 4W97A 2H6BA 3I3LA 5E17F 4WF2A 2CV2A 3CP8A 2E1CA 4UV9A 1P2FA 2R7SA 2ZMEA 1X2NA 4KT6A 5IOYA 2VQCA 3HOVJ 4V2FA 4A3IJ 2LTPA 1SAUA 3EUHA 1QNTA 1R9TJ 2R0QC 3C3WA 1SVOA 1IDZA 3H3ZA 3NWSA 4O6JA 1TT0A 1I6HJ 3RZDJ 4PJMA 1I1SA 3BQYA 2AQEA 3TL4X 1VTNC 2ELKA 4YIFA 2IGNA 1MMSA 4YELA 3KYCB 4MTDA 5GAHJ 1Q1HA 2QM3A 2HVRA 1JTXA 3WG7H 1FJLA 2FX0A 3EPZA 3VODA 3I58A 4BDZA 1FC3A 3SYTA 2H1KA 4PFPA 4KJZA 3KLNA 5DCFA 1G8XA 2L01A 3QWLA 2VBXA 4KUMA 4A2UA 4XLPF 1O3SA 2GA1A 1QO0D 4E7LA 4ENNA 4TV7A 3TBIA 3L2QA 2KRFA 3HHGA 3KYLA 2VB6A 2V6EA 3KZYA 5F1RA 1RR7A 3LNQA 4FE7A 1ERDA 5B66C 1ZGJA 3H3UA 2JZYA 2IA2A 3L09A 3JRBA 4HG2A 1XDSA 2CSOA 1LB2A 1G2HA 2RNGA 1ORKA 4AU7A 3N97A 2RQQA 2EZHA 2M0CA 4Z2YA 3LAPA 3OV8A 3BZKA 2A6TA 3B73A 1W36C 2Y0SN 1GV5A 3P9IA 4N4NB 3K4LA 4IVNA 2Y2ZA 4U7BA 1L0OC 4YRVA 1IF1A 1YJ9I 3CJNA 3DFGA 1EKEA 2BYVE 4JOMA 4JX4A 1B72B 2DXIA 3S1RJ 4XM3A 3ZMDA 1XGMA 4M74A 2EFWA 4PCQA 3GZ6A 3ASNH 4HLYA 3PO2J 1KQ0A 4Y3OA 4DYCA 1IC8A 2FJ1A 3FK6A 2KIUA 4JQFA 2V26A 3CCQI 3EYYA 3F0CA 4LG0B 3BZ6A 1GUUA 1FIAA 5M5XJ 4PJJA 2YPRA 1N75A 2XKPA 3C1DA 3B6AA 1TNTA 3HKZN 3O6BB 1MIJA 2P6SA 3RKXA 4LG0A 3TKYA 4UVBA 4GFBA 2M0MA 1RUOA 1F43A 2HI3A 1FOWA 3GBGA 3H0GJ 4RMNA 1MBHA 4BXUA 1Z0XA 1X3ZB 2J5PA 2VQLA 3ZQCA 2VPLA 2PJRA 3DQVC 3HEFA 4BJ5C 5HNHA 2OTJI 3V8JA 4IZZA 4ZYHA 3IKTA 4XQFA 1QHHD 5HNFA 1MZBA 2AXLA 4DBRA 2Z9OA 3FX3A 2FBIA 4XRMA 2BE5F 2QQAA 4EJUA 3PSIA 2DOFA 4BHPA 1MBFA 3MZYA 3DKWA 1BI1A 2L7ZA 1ZARA 1OISA 2DO7A 3CUQB 3H9GA 1KU7A 3OOPA 2E34A 2HXIA 1ZKGA 2HKXA 2JTVA 4U88A 5HDKA 2NOGA 1SD5A 2BVLA 2KMUA 2P5LC 3ZMTA 4ZDLA 1KYZA 3TP3A 4JX5A 2K86A 4F52A 3ZQQA 2DW4A 2XROA 1ZRCA 2YU3A 2V9VA 3S1MJ 2FNPA 3KP4A 1SEUA 3HDDA 4S04A 2OCEA 2XPWA 3HSEA 4RLQA 4I6ZA 4M9ZA 5H6RA 1A5JA 1YS7A 4LG3A 4M3FA 2PMZN 2ZSIB 2W82A 1LDKB 4IL6C 1BN5A 3I5UA 3C2GA 3LA7A 3L2VA 4X6AJ 1V54H 4A3MJ 1SVLA 2G0EA 1RUNA 1VQOI 3LSJA 3G2BA 3MEXA 2WB1A 1ETWA 2M2EA 5H6QA 1IO2A 1BR4A 5CJ9A 2FMYA 3EETA 1W7PD 3ABMH 1O3QA 4F55A 3BPXA 5J1RA 1UHSA 2P81A 4OU0A 1MNEA 2MSYA 4U87A 2R7TA 2X6YA 3KPHA 1MBGA 2A07F 5F1JA 3H9QA 4HEA2 2XF6A 4P9FA 4XKWA 3V7SA 2OC6A 1D5VA 2FUG2 2BOLA 2WBMA 3U1KA 4G9YA 3ZQFA 2RDPA 1YIOA 4G7HF 1Z1DA 3K1PA 1FEXA 3I0TA 2VASA 2DFHA 1UZCA 3SZGA 1M1EB 2EZKA 3DEUA 3KP2A 4I99C 1NG6A 2BHYA 4LK1F 4IX7A 4KMFA 1X1CA 4HA8A 3BY6A 4ZYDA 1Y8RB 4CO8A 1WJFA 3TW7A 2LKSA 5IP9J 2VKHA 5CVJA 1APLC 3ELKA 1IRGA 2EPFA 3WTYC 3DEEA 3I4PA 1WPKA 2QQ9A 2I5UA 3S3MA 1KU3A 1FYKA 2XDVA 1YW7A 2VQHA 4KN4X 1CQTA 2JQ7A 2XGCA 1XSVA 1UG0A 1OR7A 1YX5A 2X4HA 2TRTA 1O4XA 3B02A 4IJAA 3WE2A 1VQ7I 2XV4S 2BXYA 2RNJA 3Q3SA 2H09A 3HRSA 2OQGA 2PQ8A 3S17J 5IPAA 3HOUJ 2X6XA 1IN5A 3BR1A 1FOXA 1UB9A 2Z1DA 2JA2A 3I4MJ 4PGGA 2W57A 3BOQA 4HDUA 2QVOA 2GWRA 1YX3A 2IS1A 1VF9A 4X1EA 5FD6A 1HA8A 4C2UA 2OV7A 2E71A 5JLWA 1BR1A 1LVKA 3I59B 1JUMA 1NTCA 4LGWA 5LEKA 3M8EA 4RGUA 3V7RA 1HKTA 1J75A 4WXHA 1R58A 5CLSA 4OIRF 2QKMB 1Z91A 3O2PE 2K9NA 4A6EA 1D0XA 3I59A 3G3ZA 3K4KA 1FWZA 5EGOB 1WJ5A 4WK8F 3C18A 3AAFA 5HLIA 5KAFC 2EFOA 3TO9A 1OCZH 3OIOA 2IT0A 1FTTA 3ZRGA 2MH9A 3NRVA 5C4JJ 4Y15A 2ZJQF 3JTGA 2RVCA 5LGTA 2GAUA 2M4GA 4CZCA 1LFBA 2UZKA 4NHJA 3CMEI 2QKLB 4N9HA 3M3YJ 2QQ8A 1USTA 4AC0A 3S2DJ 3F8CA 1JXSA 5H2FC 3RCOA 5E1XA 4AD9A 5BOXA 1XMKA 5CVUA 4XORA 2DA3A 2CFOA 3DEWA 2CQNA 1JGSA 2P5KA 2H94A 1U8RA 5LLQA 1FSEA 2V1UA 1H89C 2PMHA 3ROUA 1W4MA 3BG6A 4YIIA 5E1ZB 4A5MA 4Q48A 5IYBJ 1LDDA 3IUOA 2DMNA 4AM3A 3OS1A 2ZFUA 4B3AA 1IZ1A 3V4GA 1WH5A 2PG4A 4FQGA 3PO3J 2O03A 1HSJA 3M1CA 2NXNB 4BQNA 4NC8A 4PUSA 1A31A 3DTKA 1BBYA 1KZHA 1OYWA 2E2IJ 1R5HA 1W5SA 2LOOA 2RAEA 2HOAA 3WTVC 5GTHC 3S1NJ 4NQWA 2FF4A 2PFBA 5L3FA 2VQGA 2KHMA 2I8DA 4B4CA 4MEXF 3A0HC 1WJAA 3IC7A 4W1UA 4CCNA 3J7AY 2X0LA 1K83J 4BQAA 3PFIA 2EZLA 1D1AA 2B0LA 2IS6A 2ZJRF 4IRHA 4OIQF 3AL0B 5DYMA 4EGZA 5D8KB 4E70A 2EH3A 3I53A 3FKJA 3ZR8X 3TEDA 3JRHA 1GDTA 1YLFA 2FBHA 1JT0A 4KIFA 3S8PA 4BBSJ 4M71A 2OBPA 1AA7A 5JHUA 1YQAA 2K4BA 3BC8A 1OCOH 1FT9A 3LWFA 3TGNA 1ETVA 3E6BA 1MBEA 3CUQC 2MH2A 5DCMA 3SXYA 3ERED 3RIRA 3E5QA 3FXJA 2DAOA 3JREA 4UUVA 2DODA 4I01A 4MQ9F 2RKHA 3O3KA 5EG0B 2DOEA 1R6RA 3SZPA 4Y13A 5GAGJ 5FROA 1TL8A 2VI6A 4JX6A 2LK2A 2GXBA 3E1SA 2ZFWA 4BE2A 1K79A 3CC2I 5EG0A 3HC7A 4BJTA 1XPXA 2NVTJ 1HLVA 4CYDA 4HV6A 3IHUA 1UJ8A 4UVAA 1DUXC 1D5YA 2CMPA 3TDUC 2CQKA 2QQBA 4I09A 1EH7A 1LPQA 2YX4A 3OYNA 5BPIA 3FDYA 4GXOA 1N25A 3A0BC 1TNSA 3DCFA 1TQPA 2R5YB 1DU0A 2PN6A 3SFZA 3IRRA 2CRGA 2EQRA 2XSJC 3K10A 1FBSA 3HM5A 3TO7A 2W85A 2EA2A 4BS9A 2MLKA 1HCRA 4HNVA 1T39A 2LD5A 1QHGA 3F6OA 3OYKA 3WHCA 1X19A 2FA5A 2E5ZA 2L9VA 2XIGA 2JN6A 4BAYA 4A3JJ 4V19K 4ZTFA 4LB6B 4YEJA 4N4OB 4BY7J 3COAC 4XSZF 1SANA 1P4XA 3T8TA 2R7ZJ 2R7VA 2R3SA 3MKLA 3N4MA 3REOA 3BZCA 1X58A 1QGPA 2FOKA 1SD4A 1XGSA 2FNAA 2M34A 4LB5A 2V79A 2DTZA 1VQ4I 3OR2C 2E1OA 2IS2A 2G7UA 3QRFF 3WTWC 2CYYA 5LHHA 1AU7A 3L2RA 3VOEA 2DDAA 1WJCA 1HW2A 4XKVA 4DBQA 1IRZA 2CG4A 1VQ6I 4UUSB 4ESBA 2JA6J 1A04A 3QOEA 3VB2A 1DPRA 1P7IA 4RAFA 3OYHA 2VPRA 3BLYA 2H6CA 3NQOA 1A36A 3N05A 1YIJI 1FP2A 4A3DJ 4NB5A 3LAJA 1V5EA 3CCEI 1S5LC 4QTRA 3MKYB 3VFZA 4A0ZA 4CCOA 3CTAA 3OS0A 2XKOA 1Z9CA 4JK1X 3OYAA 3LA3A 3S3OA 1HF0A 1IAWA 2DYSH 1YJWI 2XUBA 3CC7I 3M4OJ 3F21A 1T0FC 3ZMUA 3H36A 5IP6A 5B5EC 2C6YA 4ABZA 2V1XA 3W3CA 2D5VA 2CUJA 3F8FA 2KIFA 2GQQA 3ASOH 3CDHA 1IUYA 4ZYGA 4IHVA 1K6YA 1R36A 4B47A 1BIBA 3G71I 3L1PA 4L9JA 4BDYA 3BCBA 1OJLA 1V3FA 3LL7A 4RAYA 1O7FA 5ERIA 3J80Z 2EIMH 2GIZA 2CO5A 2FMLA 4M6XA 4E7ZA 1P9QC 4Y17A 1PP7U 2VKEA 4Y7NJ 2FE3A 2LP0A 2DK8A 1U9OA 5KHDA 5JVGF 2XB5A 2PEXA 1WJEA 2LY9A 3WHBA 5HS8A 1Z05A 2NS0A 5D6EA 3F8NA 3VDXA 2UV1A 1FOKA 2ZXJA 3MZ8A 1ON2A 1DP3A 2COBA 2DPDA 2E35A 2M1BA 3OOUA 3WODF 3G1MA 1IRXA 3RSNA 5BNGA 3WGIA 3BJOA 5CKTA 2LH9A 4MGRA 2E1NA 1U2WA 1F5TA 2WWYA 4HX7A 1S29A 3JTHA 1YFHA 3WTUC 3LSGA 6PAXA 2ISYA 1QPMA 4L18B 5EF6A 2ELHA 2DTRA 2Z16A 3WU0A 4RB2C 2DFEA 3D0SA 5C4XJ 1EH6A 2DFIA 4M6VA 4BNCA 5GPCA 4MTEA 5J8CA 2XF5A 3I56I 4EMSA 2JA7J 3RYRA 1WSUA 1IG7A 2QWWA 2DN0A 2LYCA 1PVEA 3HB9A 1HOMA 1OLTA 1BI3A 4F92B 3RPUD 2P5VA 3DBHB 4AYBA 3K2AA 1PUFA 4P5OA 3MKZA 1S7AA 4L5EA 1TZLA 3K4MA 4OIOF 4DYRA 1TP4A 1W1WE 3KCCA 4D5CA 2A05A 1BI2A 2DQLA 3DU5A 1XC5A 1IW7F 3M1EA 2M30A 1EV7A 4KT5C 2AHQA 2K40A 3S32A 4R8HA 5ICGA 3ZMSA 3GFMA 1LVAA 4XR6A 2M7BA 5LD2C 2L4AA 3J81K 1JUSA 3F9KA 1SFKA 3HOXJ 1T56A 1E3OC 5J8FA 2Y31A 1BL0A 4OAZA 1IGNA 1IXCA 2G9WA 2KIQA 3OYDA 2HU9A 5E8GA 3HUGB 3G73A 3OYMA 2ZXHA 5J4VA 1LDJA 5DM6F 3HGYA 4E7JA 5IP7J 1TWGJ 2NRAC 4U0YA 1JKRC 3IAM2 3QYBA 2HNHA 2NNYA 3AL0C 2K5CA 3FKIJ 3WU1B 2VXZA 5JVTA 2DOAA 5FJ8J 3FMQA 3V42A 2AS5F 3E6CC 4BHCA 3GUDA 2H8RA 3U2RA 2HYGD 5JHFA 2XF7A 1ZR4A 4XN3A 2WAQN 1I27A 2LRDA 4JYKA 4MFDA 2VJ5A 3S3NA 4NC6A 4LLLA 3E3VA 5GADJ 1WJDA 2CQ7A 4ANJA 5HOOA 2JA8J 2R5ZB 3J7YJ 2EK5A 1YRNB 3EYIA 2A6HF 4OINF 4ZDPA 1FY7A 4XKCA 3QPTA 1XB4A 1S8NA 1MH4A 5CYVA 3FISA 2DT5A 5EEAA 1YRNA 5DS9A 1MSEC 4PK4A 1RR8C 1VQPI 1J0RA 3PM1A 1R4NB 2WTEA 2CU7A 3ZMZA 1LNWA 1J9IA 1QVUA 4BE1A 1GXQA 4II3A 2DA6A 2HTSA 5C3EJ 5K5QA 2WAFA 1ZG5A 2YS9A 1MH3A 2ZC2A 3K70D 2GIVA 3HSRA 4M3EA 4A3FJ 5EZGA 2D1VA 2RV8A 1U78A 2Y48A 1FOYA 4BYYA 2CUZA 4YFNF 2QF7A 2DYRH 3FXRA 3OYCA 1ZG3A 2XC7A 2JRMA 2BW3B 4IHYA 2W00A 2W4SA 3QAHA 1B72A 4IEJA 2W1OA 3LQRA 4ESFA 3AG1H 1UFMA 4S05A 2FQ4A 3U21A 2GXGA 5LGNA 4BACA 2BW3A 4B43A 2QSFX 1RRJA 4FX0A 5H20A 1FSHA 3CCJI 3BJ6A 2L02A 4I98B 4XMYA 4OOIA 2F6CA 1S3JA 3H92A 3S2WA 5CQEA 3S15J 2O8XA 1FBUA 3S93A 2XAHA 3BTJA 3W2VA 2XPVA 2JT1A 3CMAI 2R7UA 3GTQJ 2FD5A 1XG1A 2L5QA 4ESJA 3F23A 2L9NA 2MC4A 1ETQA 3SDGA 5J40A 1OPCA 2ADUA 1X4PA 4IQ4A 5J47A 2ZB9A 3JRCA 1TQIA 3A2KA 2BZTA 1QZYA 2HQAA 4CCJA 5K7FA 2EA4A 2HXOA 3RPQA 1WRJA 2IAIA 2OF7A 3WE3A 4DIQA 2ZXWH 3K4NA 4E7SA 4A93J 1QU3A 1E3PA 2OZ6A 2HKOA 1N78A 2P6TA 2CV0A 3IH2A 4GYIA 2Q0OA 3DPUA 5FKLA 3CQZJ 2FQ3A 4B3XA 3ABUA 3CUQA 2LKXA 2Y30A 2BY0A 2M87A 2B7EA 2EFPA 2JPCA 3S2HJ 3CDIA 4UY8I 3HIFA 1GT0C 1WVRA 2HYFA 4M9XA 2FSWA 1VQ9I 3Q9VA 4XK4A 1QA6A 2OQRA 4S0HB 2OJED 5FLXZ 3T8RA 3S16J 2LSOA 4XN0A 2JPBA 4F93B 1NK2P 5J6XA 2KDZA 4A3BJ 4L9NA 3D5LA 2L4MA 3Q5FA 4XRSA 3LA2A 5HDNA 3PNYA 4UXNA 4AVPA 1VQ8I 5D5UB 3FZVA 1KGSA 4MQVA 5F64A 2CW0F 1G3WA 3ZOBA 4HNUA 1BOAA 2CGPA 2HOEA 4DOZA 3KX2A 1SD7A 3ESWB 1JTYA 2IVMA 5LEJA 3K6GA 2LMDA 5BPDA 1Y56A 1DQUA 2BV6A 3CUOA 4CCLA 2DMQA 2UXXA 3CJTB 2HDCA 2GZWA 1IUFA 4IRIA 2QGUA 3D5RC 5K7ZA 2V1NA 2RQPA 4C3IJ 1OKRA 2KLOA 2XRNA 1Y6IA 5CQGA 2DA4A 4DZJA 2JA5J 4IOAF 2KZGA 1XGNA 3OYJA 1TBXA 1U3EM 2L7FP 5IT3A 1TTYA 3KEOA 3DTIA 4UB8C 4BXXJ 5L3CA 4RB3C 4QPQA 5DTDA 1I39A 2UUZA 4FE4A 1ZN2A 1J59A 3HBLA 1VQ5I 2OPTA 3PIOF 1SFXA 4C3JJ 5M3FJ 4CSWA 1E3HA 2EV6A 2XRLA 2HDWA 3DV8A 5KCMA 1VZ0A 1IDYA 1ZTRA 4AIJA 2NNNA 5E3LA 3QPLA 3FBNB 5FFZA 2YSRA 1PYVA 2OUMA 3OYLA 2ZO4A 1O3TA 2VOOA 1MNMC 5J1UA 4JP0A 4EGYA 2AO9A 3GZ5A 3WG9A 1YW9A 2E1MC 4UVCA 1FYLA 1YW8A 2ZKZA 1YJNI 2VXDA 1XX5A 2KJCA 2E2HJ 3ZN0A 2JUGA 3GFJA 5DV5A 3SHFA 5FKOA 4QWQA 1XD7A 3BR2A 2DT7B 4B09A 4R79A 2MA3A 2OD5A 1BR2A 2XAUA 1JI8A 3AG4H 1U5TB 2DA7A 4KYWA 5LBQA 1ZLJA 2ZBKA 4LJZF 3FM5A 3VWBA 2HEOA 2IEKA 4AVZA 3KE2A 5BMZA 1OYIA 4G12A 4XIDA 2K4JA 2V9KA 1U5TA 2KRHA 1T0FA 2OCCH 1I3AA 3OYBA 1RKWA 3CP2A 2HZDA 1DU6A 1UHMA 4MNUA 1MNDA 2BY3A 1YE9A 3EUAA 5JLXA 4BBRJ 1PJRA 3J80K 1LE8B 1XN7A 2STWA 2M4KA 3PL8A 1U8BA 4NDLA 1P7JA 4HF0A 3GF2A 2NVYJ 3WTZA 2DK5A 4F91B 4YFXF 5CVVA 1JHHA 3WU2C 1A35A 3PJRA 4ENMA 5A2QZ 1RKTA 1LE8A 1BJAA 2DMPA 1UG2A 2CUFA 5FB2A 2L7KA 2Q1ZB 3GTKJ 2ID3A 3R0AA 4ITVA 2GOXB 2LF8A 3ABTA 5JFRA 2M9HA 5E8IA 2VODA 1MW7A 2M3AA 4B1RA 1G3YA 2L54A 4M6YA 3CC4I 2HS5A 4WWCA 2EJRA 3F6VA 4M3GA 5GAEJ 3RYPA 4I7HA 4B48A 4M3DA 4EM0B 5EGOA 5GP9A 3DXJF 1LUJB 2MGQA 2MBFA 5HODA 3OSFA 2MG4A 5D6FA 1SMTA 4OWRB 1BA5A 5JR3A 1K78B 3CDLA 2DBBA 3HXLA 2WY7Q 1RESA 1WH7A 5FKNA 4ZH4F 1B4AA 4XLCA 2X48A 3HYIA 3JRFA 4A6DA 1EA3A 1GVDA 3C7JA 3OWTA 3QU6A 4ZJZA 5IOZA 2K9MA 4CCMA 1K78A 5DD4A 3R6SA 3W6JB 4ZTJA 4DQ2A 2R7FA 2KP6A 2EV5A 3P5JA 2KJBA 1ZRDA 1TWFJ 2TDXA 1A6QA 2L3DA 2CQQA 2PX9A 1XS9A 4RM3A 4XLHA 4E7HA 2P7CB 5FO5A 5D5WB 2DMUA 1VQMI 3QODA 3FXKA 4Y4RA 2ECBA 1WHUA 4DGWB 1IN7A 3LSMA 1SVMA 4HZFA 5DD8A 3K1MA 3PSFA 1T8IA 2LR8A 2V4JC 2VBZA 2F4MB 4DZPA 3MVPA 1TQMA 2Y75A 5D5VB 3C2BA 2MW8A 1WJBA 3E6MA 3FIWA 4CUGA 1Y39A 1H0MA 3TOAA 1YS6A 1RETA 5CPRB 1OMIA 2P0WA 3G1OA 3M8JA 1FMVA 4HNTA 3V8LA 1K4TA 4HQMA 4XL9A 1G59A 1IN4A 2HOSA 4M9SA 2DA1A 4D7NA 5L3GA 1VFCA 2MABA 4GCVA 2R7WA 1B8IB 1MMDA 2HZTA 1GVJA 4H4KC 3W6VA 5KK1A 5FRNA 1I6XA 2IJLA 1UELB 5ILVA 5DM7F 2ZNZA 3GX4X 2DPUA 3AKZA 2HTJA 2Z5UA 2F5FA 4F7ZA 2VONA 4IRGA 4ZZDA 1ACIA 3DKXA 4CZZA 3LFKA 2LKPA 1KYWA 3OMYA 4YG2F 2VN2A 3GYHX 4M3BA 3I9V2 1K6OA 4XICA 3AG2H 1HW5A 1JJ8C 1YITI 3DLLF 1Z6RA 3OY9A 1B59A 1TWAJ 1ENHA 3JW4A 3I55I 2V7FA 4BEHB 1I1GA 1T98A 1ON1A 3PIPF 3L7WA 4XNFA 4RS8A 1TT5B 1ZHFA 1MBJA 4BGDA 3CD6I 4RAGA 3LSKA 3KP5A 2O3FA 1B9MA 2D1HA 2QSGX 2PLYA 4CH7A 4BEHA 2X9DA 5F0CA 2NAZA 4G6DA 3PFYA 3RQ4A 1S7OA 3OYEA 2O8KA 2R5YA 2F5CA 4IHXA 2Y0SA 1FYMA 3QU3A 4HBLA 2IGMA 3GTMJ 3QYEA 4HSRA 4XLAA 1T95A 2Z2SB 1MJ9A 3BP8A 4A5NA 5D8LB 1SFEA 1V4RA 3OYFA 5F27A 4EVIA 3GTGJ 4PGHA 5CVRA 1QZEA 3ZXSA 4RBOA 4IHTA 3I4NJ 1ZH5A 2Q2EB 3BTLA 2LF7A 1ZR2A 3Q0UA 2LDUA 5LRSA 1P4AA 2NVQJ 2VT2A 3CCLI 3A01B 2PMUA 2ZXIA 2H8WA 4AUXA 1F36A 2DDBA 3K4BA 2HPIA 2QZ8A 2QCOA 2EB7A 2MYSA 5CVIA 3ECHA 4RDUA 5J4YA 3JSOA 3HKZA 5K5RA 3OSGA 3GLXA 2NS7A 3TO6A 5FGMA 4CICA 1O7LA 5IYDJ 1RPWA 2A68F 3KP6A 4UUSA 5M5YJ 1I3QJ 4IHWA 4HW0A 3CCSI 5D4SA 1CGPA 3E0JB 1S7EA 2HVQA 2W25A 4ZZLA 5HVQC 4KISA 2CQXA 2QENA 3OIQA 3OIPA 4BE0A 2LREA 2A69F 1ZREA 3GEZA 1BIAA 4PZJA 4U0WA 2ETHA 1R4MB 1U5TC 4EEFG 1W0TA 2ID6A 3AG3H 4Y52J 4I02A 3F8MA 1LJ9A 3BG5A 4PJ0C 4EV0A 1SMYF 5FLXK 4MFEA 4UV8A 3K9TA 5E3NA 1C0WA 3BR5A 2E36A 1FP1D 1Y0NA 5J3LA 2DCEA 1AOYA 1OFCX 1IRFA 1WCMJ 3D5SC 3I71A 2HQ5A 3OYGA 1IJWC 3WGHA 5DUIA 4HV5A 2OZUA 4CXFA 2Y9ZA 3AFHA 2VE9A 4C3HJ 3PNTA 4LITA 3JRDA 4UNOA 3RJPA 5C44J 3HTUA 5LFAA 1XSDA 1Y1VJ 4ZYEA 1ETOA 3GTJJ 1HQCA 3ML6A 3VSKA 4HQEA 4ZDOA 3CF2A 2K9QA 2OTLI 3HOWJ 1R5GA 2ELJA 1YYVA 4L5JA 3L2CA 2EBIA 4BJ6C 2LBFB 2PMZA 3BDDA 1GXPA 1FTZA 5FRMA 2DMTA 1BW6A 3FWEA 4XLNF 4ETSA 1P4WA 3M07A 2L9SA 2JWTA 2YU9J 1H9GA 2BY2A 3ZN1A 4BY1J 2KRCA 3BG7A 3CCVI 2X6WA 3K4CA 2ICWG 3GXOA 2ACJA 3K0LA 3MCZA 1MJAA 3X2QH 2DJIA 2HVSA 3JRGA 2O6GE 5IYCJ 3FHZA 3IH4A 2EINH 1O3RA 2VJIA 2F2EA 4XRSG 2GLOA 3SQNA 3ZQ7A 2RN7A 4A3LJ 4JBAA 3RDIA 5IY5H 1D8JA 1GHCA 4IOCF 1JE8A 4Q47A 1P6RA 3RZOJ 4IHSA 3GVAA 1HBXG 1PUEE 4KDPA 3DKYA 2MLGA 2V9PA 2QBYB 1HKQA 2R7OA 2AQFA 2P8TA 3CLQA 1OCRH 2E1MB 1HW1A 5GPAA 2KISA 1W36D 4D7MA 2ZCWA 3E7LA 2HQNA 1TLHB 5E79C 2VOPA 2MD0A 2QBYA 1FMWA 3CMYA 2PBIA 3VYTB 1SD6A 4KIGA 2M45A 2N8GA 1FZPB 1V5GA 3LSIA 4LD5A 4FTHA 1POGA 3KYDB 4XKBA 1DGRM 2KKOA 2BY1A 2CUEA 1JKQC 1V55H 1MDMB 3ZPLA 4A3GJ 3O8GA 2X51A 4RGRA 3FXMA 3LSRA 1BC8C 2QUFA 4RAZA 1Z77A 1F1ZA 1R22A 1XDUA 3HUGA 3LSTA 1MDMA 5E3MA 2CJJA 4MEYF 1JJ6C 5EJCA 3U1DA 2K9SA 2NS8A 3E5XA 1HDPA 3SDBA 4Q5SF 1Z7UA 2IS4A 5LGUA 2AXTC 2IW5A 2MFZA 4OMZA 1Y0UA 2QA4I 3GTPJ 5A2QK 2OA4A 1IN6A 3KZIC 5JI6A 3DPTA 5HLTA 4FASD 3C2HA 1H88C 3HZJA 1TWHJ 1W7PB 2W24A 3L9FA 4NNJA 1DDNA 3H5NA 5LRRA 2BGCA 5FLMJ 3WGGA 5FLVA 3ZQGA 1D1CA 1GLNA 3CMMA 1DPUA 2DU9A 2UWMA 3H9JA 3KEYA 4Y33A 1W7PA 3G4SI 2R92J 2EFNA 3HSFA 2VT3A 1RI7A 1YOVB 2IGOA 2IXSA 3BCAA 3ISPA 3ZP5A 4PDKA 2R5ZA 3SJMA 4D1QA 1JGGA 3M9AA 1WZ2A 1V5FA 2XVCA 1LFPA 1W5CC 3BR6A 4ENKA 4NUBA 4XOPA 4CCKA 3U9GA 5KNLA 1XTAA 5B1BH 3MD2A 1KQ9A 5F0HA 1X1PA 2VIXA 3IP4B 3DWLE 2E5NA 4HF1A 1JT6A 4DNCA 2P4WA 2WY8Q 5IT9Z 1T2KA 5DEQA 1HKSA 4BU2A 2LFBA 3JAMZ 1WI9A 5E18F 4GDFA 4BHBA 4C2MJ 1MMNA 1U0JA 3ABLH 3F3XA 3IV5A 1F4KA 5EDNA 2PI0A 2EFQA 3VSLA 3E5UA 2BHZA 2COMA 3HRTA 5HDGA 2K3FA 1VNDA 4N9IA 1T38A 1D1BA 3EQLF 3HPHA 5HS7A 4PSXA 1YHQI 4A3CJ 4XLFA 5FD5A 4M72A 1BC7C 1SAXA 4IF4A 2ZJPF 2EIJH 3EUKL 2WAEA 1IXSB 3BR3A 4HLXA 3P9KA 3EDPA 2DJNA 2FEZA 2Y9YA 4LIVA 4LLNA 3HRUA 4ASNA 4I2OA 2XAQA 1NHAA 4NC7A 3CLOA 3E97A 3ECOA 1ZYRF 3MAJA 1PP8F 1VI0A 2O7OA 1R71A 2HOTA 2KZVA 5E20A 3GTLJ 2RGVA 1QZZA 4Q4ZF 1WI3A 2IBDA 2PJRB 4V2GA 3BJAA 4AIKA 3IKVA 4P1WA 4BQOA 3FMSA 2HR3A 1ZLKA 1P92A 2F48A 2VLAA 1J2XA 4G6QA 4BQQA 2VKDA 3CJRB 3HRMA 1B6AA 3GMEA 2WADA 2JK3A 1MBKA 5BQTA 5ED4A 4C2TA 1WGXA 3UR3C 4J19A 3QYFA 2XAJA 1VQKI 1W0UA 2IRFG 3H0DA 2ZNYA 3L2WA 4IO9F 1A6IA 2ESHA 3BT9A 3K69A 1WKMA 3BROA 4RGXA 3LSHA 1X1DA 2X85A 1G4DA 1STZA 3GWZA 4E4HA 3BQZA 2F4OB 4XLEA 2G7HA 2HQRA 3QPHA 5LHGA 3K1NA 4HX8A 2ECCA 3CZ6A 4IPAA 4ON0A 3MZHA 3HG9A 2W84A 3DPLC 4EJTA 3BTIA 4M73A 3SEZA 5L3EA 1O57A 1S9HA 2E60A 2GXAA 1QRYA 3K70C 2XAGA 1XCBA 2HFHA 4CHUA 2R7QA 3H5AA 4UUTA 1ONVA 1N77A 1K61A 2M5WA 4OAYA 1JHFA 2DA5A 5FKMA 3J7ZI 3B6CA 3ERMA 3FXQA 3K4JA 1MSFC 2VC1A 9ANTA 2GBYA 2XSDC 2EIKH 3LQQA 3BPVA 5L3BA 4J01A 3PQKA 2L7MP 3CO7C 4G6TB 5TRDA 4BUPA 2R7XA 1WFXA 1NK3P 3GFIA 4RA2A 1R49A 2EILH 3MQ0A 2X1CA 3KLOA 5TISC 5F6FA 2O9LA 4PJNA 5EEGA 3BWGA 4KICA 1ULYA 3CESA 1QPIA 2K02A 2GOMA 4I0AA 4MO7A 4E7KA 2FOWA 3NAUA 3IAS2 3KP7A 1B1BA 1LKXA 2OAZA 4II2A 3P7NA 5ICFA 4EM2A 3L00A 3ZQLA 1SFUA 2E7XA 1J7KA 1LEAA 4EJOA 2VBYA 4AYBN 3G6EI 1S72I 4MHGA 5FKKA 2RC4A 3LOCA 2MD5A 1X4OA 2I10A 1REPC 3HOYJ 3HOZJ 3OS2A 1USSA 1OCTC 2FRHA 2VE8A 4KITB 4FETA 3TMOA 4K2EA 1BI0A 1UHWA 3PUFA 1R00A 4D9JA 4GRIA 2LLKA 1XCVA 3DU6A 1RZ4A 1BW5A 3JRAA 1X3WB 3I64A 2JMWA 3Q0VA 3BTCA 2GM4A 4L9TA 2ISZA 4FCYA 3LSPA 4FT8A 2JVGA 5TJJA 4CYCB 3FBIB 2VC0A 3A1YA 5BS6A 1DGWY 5AONA 1QBJA 4G7OF 4EM1A 5B3SH 4KNYA 4LMYA 2BBYA 2ZMEC 4A69C 2E19A 3PUBA 5GTIC 3TW6A 1RNLA 3EUHC 1R1UA 3ZQIA 4CYCA 1EH8A 4UB6C 1QVTA 4HX4A 3J81Z 3JRIA 1ZK8A 3A02A 1UMQA 1WWXA 3JCUC 1Q1VA 1SC7A 3MWMA 4GO1A 2K3PA 1FPQA 5F0FA 1ZQ3P 4FISA 2ME0A 4EATA 2XB0X 4LFUA 3FXOA 2O61A 2ZSHB 5LHIA 2XPUA 2CWEA 1Z21A 1JKOC 2Y69H 4YFKF 5E1WA 1KU2A 5M3MJ 1YI2I 4XSXF 2A61A 2L2OA 2V1DA 4PSWA 1JUPA 1XMXA 1LFUP 1MJBA 1CF7B 4OMYA 2CW7A 3HL2A 2DI3A 2ZJ2A 4CGZA 2ME6A 1FIPA 4IXAA 4EJWA 3IWFA 4QSHA 5K1YA 1DP7P 1CF7A 5K7HA 1R23A 1KA8A 3GZNB 3HOSA 1E2XA 1IXRC 3RKYA 4BXFA 3HPGA 1UCRA 1X2MA 3F72A 2F5EA 4ZYAA 2A5YB 5ILUA 4FX4A 3CJQB 1Z3YA 3F22A 4HF2A 3NWTA 5F08A 4X0GA 1K4SA 5AIQA 4LLGF 2DLLA 3ZGKA 4KA4A 1XMAA 4E7IA 4P9UA 3HOTA 3HGGA 5KVRA 1GV2A 2KDOA 3H35A 1KU9A 2NYXA 1OCPA 2B63J 4P55A 3VYRB 2LNBA 4KFCA 1FBQA 3HJEA 4AIHA 1X3UA 4KIBA 1HDDC 2VKVA 4MLOA 3VPRA 2D45A 1TC3C 3KEQA 1ETXA 3LFUA 3R60A 4WCGA 3ZCOA 3NEUA 1LEBA 3KP3A 1Y1WJ 5TGTA 2JVHA 1G3SA 4OIPF 2CFXA 3DBRB 3FXUA 4RB1A 4C9YA 4MIMA 4DW6A 1D0ZA 2VJJA 2KL4A 3R0JA 4BH9A 4G8XA 4DYQA 2CH0A 4GYGA 1L3LA 2IGKA 3RQIA 4B8XA 3RI4A 4NQWB 2CV1A 1W5TA 2K9LA 2LY1A 1FNNA 2K7LA 2XGXA 1PDNC 3V7CA 1B9NA 3NARA 4GGGA 2WV0A 2WC2A 4WXDA 4CDGA 1EJ9A 2GA2A 2HGCA 5EEHA 5HLGA 4ENJA 1ZG1A 3A4CA 4HRIA 4XOTA 4HPQA 2F5DA 4KMUX 2M8EA 2LVSA 5K5OA 1ETYA 5J1YA 3Q9SA 1WQ2A 2XAFA 1E17A 4G94A 1B8IA 1IV6A 2J5OA 2F4IA 4L5IA 2PJPA 3CF5F 2CS3A 4EQQA 3BG3A 3RKWA 2JRTA 4L0ZB 2QEXI 2D2WA 1BM9A 2DA2A 3WTXC 3FK7A 1ITYA 5FFXA 2IA0A 1FLIA 5DCMB 2LY2A 2IP2A 2JSPA 2YR2A 3MMYB 5EYRA 3VEPA 1JKPC 4G7ZF 4F3QA 2V6CA 3F8BA 4HSTA 3ONQA 1Z7LA 2WAQA 4HDVA 4A3EJ 3FF5A 1D8KA 1ODDA 3K7AJ 4HAMA 4L0YB 2FBKA 3ZQHA 3MFKA 1S6LA 3FMRA 1H9TA 4O5VA 4N0BA 2Y0MA 2DFFA 2O0YA 5ILSA 1E0EA 3I54A 1Y8QB 3DP7A 1BJZA 3O8HA 5IT9K 3T5XA 3J7AO 3JAMK 3CCYA 4D5FA 2WB1N 4E6KG 3ULQB 1TW2A 1Z6TA 1R1TA 4L9VA 3BG9A 3S1QJ 2QSHX 1EF4A 3DBLB 3MKWB 1OQYA 1G3TA 1AKHB 3E6DA 4U7DA 3TOBA 2E7WA 2DQRA 2JUCA 3A03A 3CCMI 3RPUA 3GO5A 2Q8KA 2IA1A 1D3YA 5D4RA 3GCMA 1IN8A 3GW2A 3IWZA 3KIOA 2JJ7A 3DLAA 2H27A 2KPMA 3H3VK 3W2AA 1NH3A 3L2UA 1AKHA 4A0XA 3KZZA 1Z3XA 2FU4A 1OCCH 3HHHA 2F5VA 4D0PA 4XRFA 2B9SA
chains in the Genus database with same CATH topology
2N8GA 5EGOB 3D1NI 2LKXA 2Y30A 4FTHA 1POGA 1T33A 3S2HJ 3OIOA 1GT0C 2CUEA 1JKQC 1FTTA 4QIWN 5C4JJ 1SFOJ 3GTOJ 4XK4A 4A3GJ 3O8GA 4S0HB 3S16J 3LSRA 1LFBA 3A01A 4LOCA 1Z77A 1NK2P 3M3YJ 2KDZA 4A3BJ 5E3MA 2CJJA 4AC0A 4XRSA 3S2DJ 1JJ6C 2K9SA 2NS8A 1HDPA 2EZIA 2DA3A 3DEWA 3ZOBA 3IH3A 3GTPJ 2WV1A 1H88C 1JTYA 2NVXJ 3S14J 1TWHJ 1H89C 3TP0A 5FLVA 5FLMJ 3ZQGA 5IYBJ 2KT0A 2DMNA 2DMQA 4B3AA 4BKXA 1WH5A 5E3OA 1IUFA 3PO3J 2R92J 5K7ZA 3SJMA 4C3IJ 1JGGA 2R5ZA 2DA4A 4DZJA 2JA5J 2E2IJ 3BR6A 3QQAA 2RAEA 2HYJA 2HOAA 2L7FP 4BXXJ 3S1NJ 5DTDA 2L0KA 2X6OA 4FE4A 5F0HA 1TWCJ 3HBLA 4B4CA 1JT6A 3JR9A 2OPTA 3QPSA 4C3JJ 5M3FJ 4W1UA 2VUMJ 2XRLA 1K83J 2LFBA 1IDYA 1ZTRA 2EZLA 2XGDA 1ZGWA 5E3LA 4C2MJ 3QPLA 3IV5A 1I50J 5EDNA 2EH3A 3TEDA 1MNMC 3JRHA 5J1UA 1VNDA 1GDTA 4JP0A 1JT0A 4A3CJ 2AO9A 4BBSJ 3BR3A 1ETVA 1MBEA 2E2HJ 2E2JJ 3Q0WA 2DJNA 5FKOA 3JREA 3BR2A 2Y9YA 5EG0B 2DA7A 1H8AC 2IEKA 2VI6A 2W48A 4JX6A 3G1LA 2LK2A 4G12A 4XIDA 2XGEA 1AHDP 2TCTA 3UKGA 5EG0A 1VI0A 2O7OA 2HOTA 2NVTJ 1RKWA 5F04A 1HLVA 3GTLJ 1DU6A 1WI3A 2IBDA 4V2GA 5JLXA 4BBRJ 1LE8B 3SFIA 1D5YA 3RKQA 4A3KJ 5EZHA 1U8BA 4NDLA 1P7JA 2NVYJ 2R93J 1PUFB 2JK3A 3DCFA 1MBKA 2R5YB 1DU0A 1LE8A 1RKTA 3MN2A 2HDDA 4I76A 1WGXA 2CRGA 1UG2A 2DMPA 2EQRA 2YUSA 2L9RA 3HM5A 4J19A 2CUFA 5M5WJ 3GTKJ 1W0UA 2ID3A 1HCRA 4HNVA 2LD5A 3BR0A 1A6IA 2M9HA 3BT9A 3WHCA 4B1RA 2JN6A 4A3JJ 1U9NA 4M3GA 2M8GX 4M3DA 5EGOA 5GP9A 1ETKA 3BQZA 2MGQA 4BY7J 5HODA 3OSFA 2MG4A 4W97A 1BA5A 1SANA 2ECCA 2R7ZJ 3MKLA 3CDLA 1X2NA 1X58A 5IOYA 1RESA 3BTIA 1WH7A 4V2FA 5FKNA 4A3IJ 2M34A 3HOVJ 2LTPA 2X48A 2DTZA 3JRFA 2E1OA 1QRYA 1GVDA 1R9TJ 2R0QC 1AU7A 5IOZA 1IDZA 4UUTA 1I6HJ 3RZDJ 1IRZA 1K61A 3BQYA 2DA5A 5FKMA 4UUSB 2JA6J 2ELKA 1TWFJ 3B6CA 1MSFC 9ANTA 1P7IA 2GBYA 2XSDC 1JTXA 1FJLA 2CQQA 2VPRA 1XS9A 2FX0A 2L7MP 2DMUA 1NK3P 2H1KA 4A3DJ 2ECBA 4QTRA 2LR8A 2O9LA 4DZPA 3MVPA 1HF0A 1QPIA 3C2BA 2MW8A 3FIWA 1RR7A 3M4OJ 1RETA 3LNQA 4FE7A 5IP6A 3G1OA 4MO7A 3JRBA 4ABZA 3NAUA 2D5VA 2HOSA 3ZQLA 1G2HA 4IHVA 1ORKA 2DA1A 4D7NA 1VFCA 4AYBN 3L1PA 2M0CA 2EZHA 1B8IB 5FKKA 3LOCA 1OJLA 2I10A 3HOYJ 3W6VA 2Y0SN 3HOZJ 1GV5A 1OCTC 2Y2ZA 2VKEA 4Y7NJ 2LP0A 4JX4A 1U9OA 2LLKA 1B72B 2XB5A 3S1RJ 2LY9A 3WHBA 1BW5A 3JRAA 2JMWA 3Q0VA 3PO2J 3BTCA 2GM4A 2COBA 4DYCA 1IC8A 3OOUA 2FJ1A 3FK6A 4FCYA 3G1MA 3LSPA 4M3BA 5BNGA 4XICA 4CYCB 3F0CA 1JJ8C 1GUUA 1FIAA 5M5XJ 1TWAJ 4A69C 2E19A 3B6AA 3TW6A 3LSGA 3HKZN 1ENHA 4GFBA 3ZQIA 4CYCA 1QVTA 1F43A 5EF6A 2HI3A 3GBGA 3JRIA 1MBJA 3H0GJ 1ZK8A 3A02A 1MBHA 1UMQA 5C4XJ 1Z0XA 4M6VA 1Q1VA 5GPCA 3ZQCA 1ZQ3P 5F0FA 3HEFA 4FISA 2JA7J 2ME0A 2X9DA 2XB0X 1IG7A 2DN0A 5F0CA 3HB9A 1HOMA 2XPUA 1JKOC 2O8KA 5M3MJ 3K2AA 1PUFA 4XRMA 2R5YA 1JUPA 4IHXA 1LFUP 4L5EA 1MBFA 4DYRA 4D5CA 2L7ZA 2ME6A 3GTMJ 1XC5A 1FIPA 2HXIA 1ZKGA 4QSHA 2AHQA 2K40A 2NOGA 5K7HA 5F27A 3GTGJ 1JUSA 4RBOA 3TP3A 4JX5A 3I4NJ 1X2MA 3BTLA 3HOXJ 1T56A 1ZR2A 3Q0UA 1E3OC 1BL0A 2Y31A 2NVQJ 3S1MJ 3A01B 1IGNA 3HDDA 4AUXA 1F36A 5F08A 2XPWA 2QCOA 4I6ZA 3HGYA 4RDUA 5IP7J 1TWGJ 3HGGA 1A5JA 3OSGA 1GV2A 4M3FA 1JKRC 2NS7A 2PMZN 3FKIJ 1OCPA 2B63J 5FJ8J 5IYDJ 1RPWA 4UUSA 2H8RA 5M5YJ 4X6AJ 1I3QJ 1HDDC 2VKVA 4MLOA 3VPRA 4A3MJ 4IHWA 2G0EA 1TC3C 1ZR4A 3LSJA 1ETXA 2WAQN 4JYKA 4MFDA 1S7EA 1ETWA 2M2EA 1Y1WJ 2CQXA 2JA8J 2R5ZB 1YRNB 5J1RA 1UHSA 4MIMA 4DW6A 2P81A 4EEFG 2MSYA 1W0TA 2ID6A 4DYQA 4Y52J 3RQIA 1MH4A 3BG5A 3FISA 1MBGA 4MFEA 5EEAA 5E3NA 1YRNA 5DS9A 3BR5A 5F1JA 1MSEC 3NARA 5J3LA 3PM1A 2CU7A 1OFCX 1QVUA 1WCMJ 2DA6A 2HQ5A 5C3EJ 3ZQFA 1IJWC 2YS9A 1MH3A 1FEXA 2LVSA 2Y9ZA 1ETYA 4C3HJ 5J1YA 2EZKA 4M3EA 3JRDA 1B8IA 4A3FJ 5EZGA 1IV6A 1U78A 5C44J 1Y1VJ 2QF7A 1ETOA 3GTJJ 3BG3A 2K9QA 3HOWJ 2DA2A 3TW7A 4IHYA 3FK7A 2EBIA 1ITYA 5IP9J 1APLC 1B72A 4IEJA 1FTZA 2DMTA 1BW6A 1WPKA 2FQ4A 5EYRA 2JWTA 1CQTA 1JKPC 2YU9J 2XGCA 4BY1J 4A3EJ 2TRTA 3K7AJ 3ZQHA 1O4XA 3S15J 3JRGA 5IYCJ 3IH4A 3Q3SA 3BTJA 3S17J 5IPAA 3HOUJ 2XPVA 1BJZA 3O8HA 4XRSG 2GLOA 3GTQJ 2FD5A 3BR1A 1XG1A 4A3LJ 3I4MJ 3CCYA 4D5FA 2WB1N 3RZOJ 3S1QJ 1ETQA 3BG9A 3SDGA 1EF4A 1VF9A 3JRCA 4X1EA 2ZB9A 1AKHB 5K7FA 2HXOA 5GPAA 3A03A 2IAIA 5JLWA 2OF7A 4D7MA 1JUMA 1NTCA 3E7LA 2JJ7A 3H3VK 4A93J 1AKHA 3IH2A 3CMYA 5FKLA 2K9NA 3CQZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8G A;  5EGO B;  3D1N I;  2LKX A;  2Y30 A;  4FTH A;  1POG A;  1T33 A;  3S2H J;  3OIO A;  1GT0 C;  2CUE A;  1JKQ C;  1FTT A;  4QIW N;  5C4J J;  1SFO J;  3GTO J;  4XK4 A;  4A3G J;  3O8G A;  4S0H B;  3S16 J;  3LSR A;  1LFB A;  3A01 A;  4LOC A;  1Z77 A;  1NK2 P;  3M3Y J;  2KDZ A;  4A3B J;  5E3M A;  2CJJ A;  4AC0 A;  4XRS A;  3S2D J;  1JJ6 C;  2K9S A;  2NS8 A;  1HDP A;  2EZI A;  2DA3 A;  3DEW A;  3ZOB A;  3IH3 A;  3GTP J;  2WV1 A;  1H88 C;  1JTY A;  2NVX J;  3S14 J;  1TWH J;  1H89 C;  3TP0 A;  5FLV A;  5FLM J;  3ZQG A;  5IYB J;  2KT0 A;  2DMN A;  2DMQ A;  4B3A A;  4BKX A;  1WH5 A;  5E3O A;  1IUF A;  3PO3 J;  2R92 J;  5K7Z A;  3SJM A;  4C3I J;  1JGG A;  2R5Z A;  2DA4 A;  4DZJ A;  2JA5 J;  2E2I J;  3BR6 A;  3QQA A;  2RAE A;  2HYJ A;  2HOA A;  2L7F P;  4BXX J;  3S1N J;  5DTD A;  2L0K A;  2X6O A;  4FE4 A;  5F0H A;  1TWC J;  3HBL A;  4B4C A;  1JT6 A;  3JR9 A;  2OPT A;  3QPS A;  4C3J J;  5M3F J;  4W1U A;  2VUM J;  2XRL A;  1K83 J;  2LFB A;  1IDY A;  1ZTR A;  2EZL A;  2XGD A;  1ZGW A;  5E3L A;  4C2M J;  3QPL A;  3IV5 A;  1I50 J;  5EDN A;  2EH3 A;  3TED A;  1MNM C;  3JRH A;  5J1U A;  1VND A;  1GDT A;  4JP0 A;  1JT0 A;  4A3C J;  2AO9 A;  4BBS J;  3BR3 A;  1ETV A;  1MBE A;  2E2H J;  2E2J J;  3Q0W A;  2DJN A;  5FKO A;  3JRE A;  3BR2 A;  2Y9Y A;  5EG0 B;  2DA7 A;  1H8A C;  2IEK A;  2VI6 A;  2W48 A;  4JX6 A;  3G1L A;  2LK2 A;  4G12 A;  4XID A;  2XGE A;  1AHD P;  2TCT A;  3UKG A;  5EG0 A;  1VI0 A;  2O7O A;  2HOT A;  2NVT J;  1RKW A;  5F04 A;  1HLV A;  3GTL J;  1DU6 A;  1WI3 A;  2IBD A;  4V2G A;  5JLX A;  4BBR J;  1LE8 B;  3SFI A;  1D5Y A;  3RKQ A;  4A3K J;  5EZH A;  1U8B A;  4NDL A;  1P7J A;  2NVY J;  2R93 J;  1PUF B;  2JK3 A;  3DCF A;  1MBK A;  2R5Y B;  1DU0 A;  1LE8 A;  1RKT A;  3MN2 A;  2HDD A;  4I76 A;  1WGX A;  2CRG A;  1UG2 A;  2DMP A;  2EQR A;  2YUS A;  2L9R A;  3HM5 A;  4J19 A;  2CUF A;  5M5W J;  3GTK J;  1W0U A;  2ID3 A;  1HCR A;  4HNV A;  2LD5 A;  3BR0 A;  1A6I A;  2M9H A;  3BT9 A;  3WHC A;  4B1R A;  2JN6 A;  4A3J J;  1U9N A;  4M3G A;  2M8G X;  4M3D A;  5EGO A;  5GP9 A;  1ETK A;  3BQZ A;  2MGQ A;  4BY7 J;  5HOD A;  3OSF A;  2MG4 A;  4W97 A;  1BA5 A;  1SAN A;  2ECC A;  2R7Z J;  3MKL A;  3CDL A;  1X2N A;  1X58 A;  5IOY A;  1RES A;  3BTI A;  1WH7 A;  4V2F A;  5FKN A;  4A3I J;  2M34 A;  3HOV J;  2LTP A;  2X48 A;  2DTZ A;  3JRF A;  2E1O A;  1QRY A;  1GVD A;  1R9T J;  2R0Q C;  1AU7 A;  5IOZ A;  1IDZ A;  4UUT A;  1I6H J;  3RZD J;  1IRZ A;  1K61 A;  3BQY A;  2DA5 A;  5FKM A;  4UUS B;  2JA6 J;  2ELK A;  1TWF J;  3B6C A;  1MSF C;  9ANT A;  1P7I A;  2GBY A;  2XSD C;  1JTX A;  1FJL A;  2CQQ A;  2VPR A;  1XS9 A;  2FX0 A;  2L7M P;  2DMU A;  1NK3 P;  2H1K A;  4A3D J;  2ECB A;  4QTR A;  2LR8 A;  2O9L A;  4DZP A;  3MVP A;  1HF0 A;  1QPI A;  3C2B A;  2MW8 A;  3FIW A;  1RR7 A;  3M4O J;  1RET A;  3LNQ A;  4FE7 A;  5IP6 A;  3G1O A;  4MO7 A;  3JRB A;  4ABZ A;  3NAU A;  2D5V A;  2HOS A;  3ZQL A;  1G2H A;  4IHV A;  1ORK A;  2DA1 A;  4D7N A;  1VFC A;  4AYB N;  3L1P A;  2M0C A;  2EZH A;  1B8I B;  5FKK A;  3LOC A;  1OJL A;  2I10 A;  3HOY J;  3W6V A;  2Y0S N;  3HOZ J;  1GV5 A;  1OCT C;  2Y2Z A;  2VKE A;  4Y7N J;  2LP0 A;  4JX4 A;  1U9O A;  2LLK A;  1B72 B;  2XB5 A;  3S1R J;  2LY9 A;  3WHB A;  1BW5 A;  3JRA A;  2JMW A;  3Q0V A;  3PO2 J;  3BTC A;  2GM4 A;  2COB A;  4DYC A;  1IC8 A;  3OOU A;  2FJ1 A;  3FK6 A;  4FCY A;  3G1M A;  3LSP A;  4M3B A;  5BNG A;  4XIC A;  4CYC B;  3F0C A;  1JJ8 C;  1GUU A;  1FIA A;  5M5X J;  1TWA J;  4A69 C;  2E19 A;  3B6A A;  3TW6 A;  3LSG A;  3HKZ N;  1ENH A;  4GFB A;  3ZQI A;  4CYC A;  1QVT A;  1F43 A;  5EF6 A;  2HI3 A;  3GBG A;  3JRI A;  1MBJ A;  3H0G J;  1ZK8 A;  3A02 A;  1MBH A;  1UMQ A;  5C4X J;  1Z0X A;  4M6V A;  1Q1V A;  5GPC A;  3ZQC A;  1ZQ3 P;  5F0F A;  3HEF A;  4FIS A;  2JA7 J;  2ME0 A;  2X9D A;  2XB0 X;  1IG7 A;  2DN0 A;  5F0C A;  3HB9 A;  1HOM A;  2XPU A;  1JKO C;  2O8K A;  5M3M J;  3K2A A;  1PUF A;  4XRM A;  2R5Y A;  1JUP A;  4IHX A;  1LFU P;  4L5E A;  1MBF A;  4DYR A;  4D5C A;  2L7Z A;  2ME6 A;  3GTM J;  1XC5 A;  1FIP A;  2HXI A;  1ZKG A;  4QSH A;  2AHQ A;  2K40 A;  2NOG A;  5K7H A;  5F27 A;  3GTG J;  1JUS A;  4RBO A;  3TP3 A;  4JX5 A;  3I4N J;  1X2M A;  3BTL A;  3HOX J;  1T56 A;  1ZR2 A;  3Q0U A;  1E3O C;  1BL0 A;  2Y31 A;  2NVQ J;  3S1M J;  3A01 B;  1IGN A;  3HDD A;  4AUX A;  1F36 A;  5F08 A;  2XPW A;  2QCO A;  4I6Z A;  3HGY A;  4RDU A;  5IP7 J;  1TWG J;  3HGG A;  1A5J A;  3OSG A;  1GV2 A;  4M3F A;  1JKR C;  2NS7 A;  2PMZ N;  3FKI J;  1OCP A;  2B63 J;  5FJ8 J;  5IYD J;  1RPW A;  4UUS A;  2H8R A;  5M5Y J;  4X6A J;  1I3Q J;  1HDD C;  2VKV A;  4MLO A;  3VPR A;  4A3M J;  4IHW A;  2G0E A;  1TC3 C;  1ZR4 A;  3LSJ A;  1ETX A;  2WAQ N;  4JYK A;  4MFD A;  1S7E A;  1ETW A;  2M2E A;  1Y1W J;  2CQX A;  2JA8 J;  2R5Z B;  1YRN B;  5J1R A;  1UHS A;  4MIM A;  4DW6 A;  2P81 A;  4EEF G;  2MSY A;  1W0T A;  2ID6 A;  4DYQ A;  4Y52 J;  3RQI A;  1MH4 A;  3BG5 A;  3FIS A;  1MBG A;  4MFE A;  5EEA A;  5E3N A;  1YRN A;  5DS9 A;  3BR5 A;  5F1J A;  1MSE C;  3NAR A;  5J3L A;  3PM1 A;  2CU7 A;  1OFC X;  1QVU A;  1WCM J;  2DA6 A;  2HQ5 A;  5C3E J;  3ZQF A;  1IJW C;  2YS9 A;  1MH3 A;  1FEX A;  2LVS A;  2Y9Z A;  1ETY A;  4C3H J;  5J1Y A;  2EZK A;  4M3E A;  3JRD A;  1B8I A;  4A3F J;  5EZG A;  1IV6 A;  1U78 A;  5C44 J;  1Y1V J;  2QF7 A;  1ETO A;  3GTJ J;  3BG3 A;  2K9Q A;  3HOW J;  2DA2 A;  3TW7 A;  4IHY A;  3FK7 A;  2EBI A;  1ITY A;  5IP9 J;  1APL C;  1B72 A;  4IEJ A;  1FTZ A;  2DMT A;  1BW6 A;  1WPK A;  2FQ4 A;  5EYR A;  2JWT A;  1CQT A;  1JKP C;  2YU9 J;  2XGC A;  4BY1 J;  4A3E J;  2TRT A;  3K7A J;  3ZQH A;  1O4X A;  3S15 J;  3JRG A;  5IYC J;  3IH4 A;  3Q3S A;  3BTJ A;  3S17 J;  5IPA A;  3HOU J;  2XPV A;  1BJZ A;  3O8H A;  4XRS G;  2GLO A;  3GTQ J;  2FD5 A;  3BR1 A;  1XG1 A;  4A3L J;  3I4M J;  3CCY A;  4D5F A;  2WB1 N;  3RZO J;  3S1Q J;  1ETQ A;  3BG9 A;  3SDG A;  1EF4 A;  1VF9 A;  3JRC A;  4X1E A;  2ZB9 A;  1AKH B;  5K7F A;  2HXO A;  5GPA A;  3A03 A;  2IAI A;  5JLW A;  2OF7 A;  4D7M A;  1JUM A;  1NTC A;  3E7L A;  2JJ7 A;  3H3V K;  4A93 J;  1AKH A;  3IH2 A;  3CMY A;  5FKL A;  2K9N A;  3CQZ J; 
#chains in the Genus database with same CATH topology
 1YG2 A;  2IPQ X;  1BOB A;  1HC8 A;  3D1N I;  1UAA A;  5KAI C;  5ICC A;  2HWV A;  1T33 A;  1T6S A;  3M7G A;  1QQI A;  3GFL A;  3IRQ A;  2O5R A;  1RIO H;  2ESN A;  2DT6 A;  4QIW N;  1OYY A;  1SFO J;  2K85 A;  2K27 A;  3GTO J;  4O3M A;  1G6N A;  1R5I D;  3ABK H;  2Q2E A;  3T0Y A;  4LIU A;  1XSX A;  5HS9 A;  4H0E A;  1MMG A;  2BXZ A;  3H5R A;  4LOC A;  1D0Y A;  4WXC A;  3A01 A;  3PQJ A;  1X1A A;  1MMA A;  3DTE A;  3SZT A;  3FHN A;  1LQ1 A;  3TDZ C;  3K2Z A;  3TQN A;  4J00 A;  4P96 A;  2EZI A;  3FM3 A;  3W2W A;  2Z99 A;  3IH3 A;  3T1B A;  5D5X B;  1HXD A;  3QOP A;  2WV1 A;  1K7A A;  2NVX J;  3S14 J;  3TP0 A;  4QLC U;  2Z3Y A;  3P9C A;  1ZGA A;  4RM2 A;  2A5W A;  3OYI A;  2KT0 A;  2XAS A;  1AWC A;  3KFW X;  3UNG C;  4BKX A;  3DF8 A;  5E3O A;  4ZC3 A;  3V8K A;  1OR7 C;  2NOJ B;  2R7R A;  2UXN A;  4DJA A;  3SEQ A;  2KIM A;  1KQ8 A;  2A6E F;  2VJ4 A;  4UHT A;  3QQA A;  2HYJ A;  2CW8 A;  1R1V A;  3R4K A;  3WTS C;  1ZAO A;  3M8F A;  2L0K A;  2X6O A;  5AIP A;  4AID A;  1TWC J;  4LK0 F;  3W6K B;  3R61 A;  4QPO A;  3JR9 A;  4FHT A;  3VYS B;  3CCU I;  1F9N A;  3HTS B;  2VBW A;  3QPS A;  2R7D A;  4U0V A;  2QYO A;  4CA0 A;  4EJV A;  4WX9 A;  1VQL I;  2VUM J;  4R1H A;  2XHK A;  3JSP A;  2W7N A;  4B44 A;  1TW3 A;  3OR1 C;  2OU2 A;  1YO5 C;  1Z67 A;  2XGD A;  2YX7 A;  4RB0 A;  1ZGW A;  5ICE A;  1I50 J;  2KQR A;  3CO6 C;  3QP5 A;  1XGO A;  1IV8 A;  2NVU B;  4A0Y A;  4YIR X;  3IL2 A;  1X1B A;  1ZEL A;  2LBF A;  2X1E A;  3LMM A;  2E2J J;  1MGT A;  2VL8 A;  3Q0W A;  4BL0 B;  2R4G A;  5DUK A;  3RTR A;  1YTY A;  2BEO A;  2X1D A;  4Z6Y A;  5L3D A;  3WTT C;  2EV0 A;  1HST A;  4XBF A;  5B1A H;  1H8A C;  1FX7 A;  1MKM A;  2W48 A;  1NG7 A;  4AWX B;  3G1L A;  5DDG A;  2XGE A;  1AHD P;  2FXA A;  2TCT A;  4HYE A;  3UKG A;  1VQN I;  4A12 A;  2EWN A;  3GLL A;  2QLZ A;  2HPM A;  2LC2 A;  5F04 A;  3SFI A;  5HLH A;  3KET A;  3RKQ A;  1I5Z A;  4A3K J;  5EZH A;  3VYU B;  3CCR I;  3ZMV A;  4RLF A;  1U6G A;  1MD0 A;  2R93 J;  4PJL A;  1PUF B;  2BVM A;  1ZRF A;  4IKF A;  4C30 A;  1T08 B;  3OL3 A;  3MN2 A;  3OL4 A;  2HDD A;  2RRE A;  4I76 A;  2YUS A;  2L9R A;  4KN7 X;  4NBQ A;  5M5W J;  2STT A;  4RGS A;  2H1L A;  2JSC A;  2MC3 A;  3BR0 A;  1J5Y A;  3FXL A;  2WA0 A;  3H1C A;  3QP6 A;  4PFO A;  3PNV A;  2LG4 A;  4IQJ A;  1U9N A;  4HOB A;  1KON A;  1RC9 A;  2M8G X;  2P7V B;  4XON A;  2ZME B;  2A3S A;  2M7A A;  1ETK A;  1J09 A;  1R7J A;  2Z33 A;  2KFD A;  4I0B A;  4W97 A;  2H6B A;  3I3L A;  5E17 F;  4WF2 A;  2CV2 A;  3CP8 A;  2E1C A;  4UV9 A;  1P2F A;  2R7S A;  2ZME A;  1X2N A;  4KT6 A;  5IOY A;  2VQC A;  3HOV J;  4V2F A;  4A3I J;  2LTP A;  1SAU A;  3EUH A;  1QNT A;  1R9T J;  2R0Q C;  3C3W A;  1SVO A;  1IDZ A;  3H3Z A;  3NWS A;  4O6J A;  1TT0 A;  1I6H J;  3RZD J;  4PJM A;  1I1S A;  3BQY A;  2AQE A;  3TL4 X;  1VTN C;  2ELK A;  4YIF A;  2IGN A;  1MMS A;  4YEL A;  3KYC B;  4MTD A;  5GAH J;  1Q1H A;  2QM3 A;  2HVR A;  1JTX A;  3WG7 H;  1FJL A;  2FX0 A;  3EPZ A;  3VOD A;  3I58 A;  4BDZ A;  1FC3 A;  3SYT A;  2H1K A;  4PFP A;  4KJZ A;  3KLN A;  5DCF A;  1G8X A;  2L01 A;  3QWL A;  2VBX A;  4KUM A;  4A2U A;  4XLP F;  1O3S A;  2GA1 A;  1QO0 D;  4E7L A;  4ENN A;  4TV7 A;  3TBI A;  3L2Q A;  2KRF A;  3HHG A;  3KYL A;  2VB6 A;  2V6E A;  3KZY A;  5F1R A;  1RR7 A;  3LNQ A;  4FE7 A;  1ERD A;  5B66 C;  1ZGJ A;  3H3U A;  2JZY A;  2IA2 A;  3L09 A;  3JRB A;  4HG2 A;  1XDS A;  2CSO A;  1LB2 A;  1G2H A;  2RNG A;  1ORK A;  4AU7 A;  3N97 A;  2RQQ A;  2EZH A;  2M0C A;  4Z2Y A;  3LAP A;  3OV8 A;  3BZK A;  2A6T A;  3B73 A;  1W36 C;  2Y0S N;  1GV5 A;  3P9I A;  4N4N B;  3K4L A;  4IVN A;  2Y2Z A;  4U7B A;  1L0O C;  4YRV A;  1IF1 A;  1YJ9 I;  3CJN A;  3DFG A;  1EKE A;  2BYV E;  4JOM A;  4JX4 A;  1B72 B;  2DXI A;  3S1R J;  4XM3 A;  3ZMD A;  1XGM A;  4M74 A;  2EFW A;  4PCQ A;  3GZ6 A;  3ASN H;  4HLY A;  3PO2 J;  1KQ0 A;  4Y3O A;  4DYC A;  1IC8 A;  2FJ1 A;  3FK6 A;  2KIU A;  4JQF A;  2V26 A;  3CCQ I;  3EYY A;  3F0C A;  4LG0 B;  3BZ6 A;  1GUU A;  1FIA A;  5M5X J;  4PJJ A;  2YPR A;  1N75 A;  2XKP A;  3C1D A;  3B6A A;  1TNT A;  3HKZ N;  3O6B B;  1MIJ A;  2P6S A;  3RKX A;  4LG0 A;  3TKY A;  4UVB A;  4GFB A;  2M0M A;  1RUO A;  1F43 A;  2HI3 A;  1FOW A;  3GBG A;  3H0G J;  4RMN A;  1MBH A;  4BXU A;  1Z0X A;  1X3Z B;  2J5P A;  2VQL A;  3ZQC A;  2VPL A;  2PJR A;  3DQV C;  3HEF A;  4BJ5 C;  5HNH A;  2OTJ I;  3V8J A;  4IZZ A;  4ZYH A;  3IKT A;  4XQF A;  1QHH D;  5HNF A;  1MZB A;  2AXL A;  4DBR A;  2Z9O A;  3FX3 A;  2FBI A;  4XRM A;  2BE5 F;  2QQA A;  4EJU A;  3PSI A;  2DOF A;  4BHP A;  1MBF A;  3MZY A;  3DKW A;  1BI1 A;  2L7Z A;  1ZAR A;  1OIS A;  2DO7 A;  3CUQ B;  3H9G A;  1KU7 A;  3OOP A;  2E34 A;  2HXI A;  1ZKG A;  2HKX A;  2JTV A;  4U88 A;  5HDK A;  2NOG A;  1SD5 A;  2BVL A;  2KMU A;  2P5L C;  3ZMT A;  4ZDL A;  1KYZ A;  3TP3 A;  4JX5 A;  2K86 A;  4F52 A;  3ZQQ A;  2DW4 A;  2XRO A;  1ZRC A;  2YU3 A;  2V9V A;  3S1M J;  2FNP A;  3KP4 A;  1SEU A;  3HDD A;  4S04 A;  2OCE A;  2XPW A;  3HSE A;  4RLQ A;  4I6Z A;  4M9Z A;  5H6R A;  1A5J A;  1YS7 A;  4LG3 A;  4M3F A;  2PMZ N;  2ZSI B;  2W82 A;  1LDK B;  4IL6 C;  1BN5 A;  3I5U A;  3C2G A;  3LA7 A;  3L2V A;  4X6A J;  1V54 H;  4A3M J;  1SVL A;  2G0E A;  1RUN A;  1VQO I;  3LSJ A;  3G2B A;  3MEX A;  2WB1 A;  1ETW A;  2M2E A;  5H6Q A;  1IO2 A;  1BR4 A;  5CJ9 A;  2FMY A;  3EET A;  1W7P D;  3ABM H;  1O3Q A;  4F55 A;  3BPX A;  5J1R A;  1UHS A;  2P81 A;  4OU0 A;  1MNE A;  2MSY A;  4U87 A;  2R7T A;  2X6Y A;  3KPH A;  1MBG A;  2A07 F;  5F1J A;  3H9Q A;  4HEA 2;  2XF6 A;  4P9F A;  4XKW A;  3V7S A;  2OC6 A;  1D5V A;  2FUG 2;  2BOL A;  2WBM A;  3U1K A;  4G9Y A;  3ZQF A;  2RDP A;  1YIO A;  4G7H F;  1Z1D A;  3K1P A;  1FEX A;  3I0T A;  2VAS A;  2DFH A;  1UZC A;  3SZG A;  1M1E B;  2EZK A;  3DEU A;  3KP2 A;  4I99 C;  1NG6 A;  2BHY A;  4LK1 F;  4IX7 A;  4KMF A;  1X1C A;  4HA8 A;  3BY6 A;  4ZYD A;  1Y8R B;  4CO8 A;  1WJF A;  3TW7 A;  2LKS A;  5IP9 J;  2VKH A;  5CVJ A;  1APL C;  3ELK A;  1IRG A;  2EPF A;  3WTY C;  3DEE A;  3I4P A;  1WPK A;  2QQ9 A;  2I5U A;  3S3M A;  1KU3 A;  1FYK A;  2XDV A;  1YW7 A;  2VQH A;  4KN4 X;  1CQT A;  2JQ7 A;  2XGC A;  1XSV A;  1UG0 A;  1OR7 A;  1YX5 A;  2X4H A;  2TRT A;  1O4X A;  3B02 A;  4IJA A;  3WE2 A;  1VQ7 I;  2XV4 S;  2BXY A;  2RNJ A;  3Q3S A;  2H09 A;  3HRS A;  2OQG A;  2PQ8 A;  3S17 J;  5IPA A;  3HOU J;  2X6X A;  1IN5 A;  3BR1 A;  1FOX A;  1UB9 A;  2Z1D A;  2JA2 A;  3I4M J;  4PGG A;  2W57 A;  3BOQ A;  4HDU A;  2QVO A;  2GWR A;  1YX3 A;  2IS1 A;  1VF9 A;  4X1E A;  5FD6 A;  1HA8 A;  4C2U A;  2OV7 A;  2E71 A;  5JLW A;  1BR1 A;  1LVK A;  3I59 B;  1JUM A;  1NTC A;  4LGW A;  5LEK A;  3M8E A;  4RGU A;  3V7R A;  1HKT A;  1J75 A;  4WXH A;  1R58 A;  5CLS A;  4OIR F;  2QKM B;  1Z91 A;  3O2P E;  2K9N A;  4A6E A;  1D0X A;  3I59 A;  3G3Z A;  3K4K A;  1FWZ A;  5EGO B;  1WJ5 A;  4WK8 F;  3C18 A;  3AAF A;  5HLI A;  5KAF C;  2EFO A;  3TO9 A;  1OCZ H;  3OIO A;  2IT0 A;  1FTT A;  3ZRG A;  2MH9 A;  3NRV A;  5C4J J;  4Y15 A;  2ZJQ F;  3JTG A;  2RVC A;  5LGT A;  2GAU A;  2M4G A;  4CZC A;  1LFB A;  2UZK A;  4NHJ A;  3CME I;  2QKL B;  4N9H A;  3M3Y J;  2QQ8 A;  1UST A;  4AC0 A;  3S2D J;  3F8C A;  1JXS A;  5H2F C;  3RCO A;  5E1X A;  4AD9 A;  5BOX A;  1XMK A;  5CVU A;  4XOR A;  2DA3 A;  2CFO A;  3DEW A;  2CQN A;  1JGS A;  2P5K A;  2H94 A;  1U8R A;  5LLQ A;  1FSE A;  2V1U A;  1H89 C;  2PMH A;  3ROU A;  1W4M A;  3BG6 A;  4YII A;  5E1Z B;  4A5M A;  4Q48 A;  5IYB J;  1LDD A;  3IUO A;  2DMN A;  4AM3 A;  3OS1 A;  2ZFU A;  4B3A A;  1IZ1 A;  3V4G A;  1WH5 A;  2PG4 A;  4FQG A;  3PO3 J;  2O03 A;  1HSJ A;  3M1C A;  2NXN B;  4BQN A;  4NC8 A;  4PUS A;  1A31 A;  3DTK A;  1BBY A;  1KZH A;  1OYW A;  2E2I J;  1R5H A;  1W5S A;  2LOO A;  2RAE A;  2HOA A;  3WTV C;  5GTH C;  3S1N J;  4NQW A;  2FF4 A;  2PFB A;  5L3F A;  2VQG A;  2KHM A;  2I8D A;  4B4C A;  4MEX F;  3A0H C;  1WJA A;  3IC7 A;  4W1U A;  4CCN A;  3J7A Y;  2X0L A;  1K83 J;  4BQA A;  3PFI A;  2EZL A;  1D1A A;  2B0L A;  2IS6 A;  2ZJR F;  4IRH A;  4OIQ F;  3AL0 B;  5DYM A;  4EGZ A;  5D8K B;  4E70 A;  2EH3 A;  3I53 A;  3FKJ A;  3ZR8 X;  3TED A;  3JRH A;  1GDT A;  1YLF A;  2FBH A;  1JT0 A;  4KIF A;  3S8P A;  4BBS J;  4M71 A;  2OBP A;  1AA7 A;  5JHU A;  1YQA A;  2K4B A;  3BC8 A;  1OCO H;  1FT9 A;  3LWF A;  3TGN A;  1ETV A;  3E6B A;  1MBE A;  3CUQ C;  2MH2 A;  5DCM A;  3SXY A;  3ERE D;  3RIR A;  3E5Q A;  3FXJ A;  2DAO A;  3JRE A;  4UUV A;  2DOD A;  4I01 A;  4MQ9 F;  2RKH A;  3O3K A;  5EG0 B;  2DOE A;  1R6R A;  3SZP A;  4Y13 A;  5GAG J;  5FRO A;  1TL8 A;  2VI6 A;  4JX6 A;  2LK2 A;  2GXB A;  3E1S A;  2ZFW A;  4BE2 A;  1K79 A;  3CC2 I;  5EG0 A;  3HC7 A;  4BJT A;  1XPX A;  2NVT J;  1HLV A;  4CYD A;  4HV6 A;  3IHU A;  1UJ8 A;  4UVA A;  1DUX C;  1D5Y A;  2CMP A;  3TDU C;  2CQK A;  2QQB A;  4I09 A;  1EH7 A;  1LPQ A;  2YX4 A;  3OYN A;  5BPI A;  3FDY A;  4GXO A;  1N25 A;  3A0B C;  1TNS A;  3DCF A;  1TQP A;  2R5Y B;  1DU0 A;  2PN6 A;  3SFZ A;  3IRR A;  2CRG A;  2EQR A;  2XSJ C;  3K10 A;  1FBS A;  3HM5 A;  3TO7 A;  2W85 A;  2EA2 A;  4BS9 A;  2MLK A;  1HCR A;  4HNV A;  1T39 A;  2LD5 A;  1QHG A;  3F6O A;  3OYK A;  3WHC A;  1X19 A;  2FA5 A;  2E5Z A;  2L9V A;  2XIG A;  2JN6 A;  4BAY A;  4A3J J;  4V19 K;  4ZTF A;  4LB6 B;  4YEJ A;  4N4O B;  4BY7 J;  3COA C;  4XSZ F;  1SAN A;  1P4X A;  3T8T A;  2R7Z J;  2R7V A;  2R3S A;  3MKL A;  3N4M A;  3REO A;  3BZC A;  1X58 A;  1QGP A;  2FOK A;  1SD4 A;  1XGS A;  2FNA A;  2M34 A;  4LB5 A;  2V79 A;  2DTZ A;  1VQ4 I;  3OR2 C;  2E1O A;  2IS2 A;  2G7U A;  3QRF F;  3WTW C;  2CYY A;  5LHH A;  1AU7 A;  3L2R A;  3VOE A;  2DDA A;  1WJC A;  1HW2 A;  4XKV A;  4DBQ A;  1IRZ A;  2CG4 A;  1VQ6 I;  4UUS B;  4ESB A;  2JA6 J;  1A04 A;  3QOE A;  3VB2 A;  1DPR A;  1P7I A;  4RAF A;  3OYH A;  2VPR A;  3BLY A;  2H6C A;  3NQO A;  1A36 A;  3N05 A;  1YIJ I;  1FP2 A;  4A3D J;  4NB5 A;  3LAJ A;  1V5E A;  3CCE I;  1S5L C;  4QTR A;  3MKY B;  3VFZ A;  4A0Z A;  4CCO A;  3CTA A;  3OS0 A;  2XKO A;  1Z9C A;  4JK1 X;  3OYA A;  3LA3 A;  3S3O A;  1HF0 A;  1IAW A;  2DYS H;  1YJW I;  2XUB A;  3CC7 I;  3M4O J;  3F21 A;  1T0F C;  3ZMU A;  3H36 A;  5IP6 A;  5B5E C;  2C6Y A;  4ABZ A;  2V1X A;  3W3C A;  2D5V A;  2CUJ A;  3F8F A;  2KIF A;  2GQQ A;  3ASO H;  3CDH A;  1IUY A;  4ZYG A;  4IHV A;  1K6Y A;  1R36 A;  4B47 A;  1BIB A;  3G71 I;  3L1P A;  4L9J A;  4BDY A;  3BCB A;  1OJL A;  1V3F A;  3LL7 A;  4RAY A;  1O7F A;  5ERI A;  3J80 Z;  2EIM H;  2GIZ A;  2CO5 A;  2FML A;  4M6X A;  4E7Z A;  1P9Q C;  4Y17 A;  1PP7 U;  2VKE A;  4Y7N J;  2FE3 A;  2LP0 A;  2DK8 A;  1U9O A;  5KHD A;  5JVG F;  2XB5 A;  2PEX A;  1WJE A;  2LY9 A;  3WHB A;  5HS8 A;  1Z05 A;  2NS0 A;  5D6E A;  3F8N A;  3VDX A;  2UV1 A;  1FOK A;  2ZXJ A;  3MZ8 A;  1ON2 A;  1DP3 A;  2COB A;  2DPD A;  2E35 A;  2M1B A;  3OOU A;  3WOD F;  3G1M A;  1IRX A;  3RSN A;  5BNG A;  3WGI A;  3BJO A;  5CKT A;  2LH9 A;  4MGR A;  2E1N A;  1U2W A;  1F5T A;  2WWY A;  4HX7 A;  1S29 A;  3JTH A;  1YFH A;  3WTU C;  3LSG A;  6PAX A;  2ISY A;  1QPM A;  4L18 B;  5EF6 A;  2ELH A;  2DTR A;  2Z16 A;  3WU0 A;  4RB2 C;  2DFE A;  3D0S A;  5C4X J;  1EH6 A;  2DFI A;  4M6V A;  4BNC A;  5GPC A;  4MTE A;  5J8C A;  2XF5 A;  3I56 I;  4EMS A;  2JA7 J;  3RYR A;  1WSU A;  1IG7 A;  2QWW A;  2DN0 A;  2LYC A;  1PVE A;  3HB9 A;  1HOM A;  1OLT A;  1BI3 A;  4F92 B;  3RPU D;  2P5V A;  3DBH B;  4AYB A;  3K2A A;  1PUF A;  4P5O A;  3MKZ A;  1S7A A;  4L5E A;  1TZL A;  3K4M A;  4OIO F;  4DYR A;  1TP4 A;  1W1W E;  3KCC A;  4D5C A;  2A05 A;  1BI2 A;  2DQL A;  3DU5 A;  1XC5 A;  1IW7 F;  3M1E A;  2M30 A;  1EV7 A;  4KT5 C;  2AHQ A;  2K40 A;  3S32 A;  4R8H A;  5ICG A;  3ZMS A;  3GFM A;  1LVA A;  4XR6 A;  2M7B A;  5LD2 C;  2L4A A;  3J81 K;  1JUS A;  3F9K A;  1SFK A;  3HOX J;  1T56 A;  1E3O C;  5J8F A;  2Y31 A;  1BL0 A;  4OAZ A;  1IGN A;  1IXC A;  2G9W A;  2KIQ A;  3OYD A;  2HU9 A;  5E8G A;  3HUG B;  3G73 A;  3OYM A;  2ZXH A;  5J4V A;  1LDJ A;  5DM6 F;  3HGY A;  4E7J A;  5IP7 J;  1TWG J;  2NRA C;  4U0Y A;  1JKR C;  3IAM 2;  3QYB A;  2HNH A;  2NNY A;  3AL0 C;  2K5C A;  3FKI J;  3WU1 B;  2VXZ A;  5JVT A;  2DOA A;  5FJ8 J;  3FMQ A;  3V42 A;  2AS5 F;  3E6C C;  4BHC A;  3GUD A;  2H8R A;  3U2R A;  2HYG D;  5JHF A;  2XF7 A;  1ZR4 A;  4XN3 A;  2WAQ N;  1I27 A;  2LRD A;  4JYK A;  4MFD A;  2VJ5 A;  3S3N A;  4NC6 A;  4LLL A;  3E3V A;  5GAD J;  1WJD A;  2CQ7 A;  4ANJ A;  5HOO A;  2JA8 J;  2R5Z B;  3J7Y J;  2EK5 A;  1YRN B;  3EYI A;  2A6H F;  4OIN F;  4ZDP A;  1FY7 A;  4XKC A;  3QPT A;  1XB4 A;  1S8N A;  1MH4 A;  5CYV A;  3FIS A;  2DT5 A;  5EEA A;  1YRN A;  5DS9 A;  1MSE C;  4PK4 A;  1RR8 C;  1VQP I;  1J0R A;  3PM1 A;  1R4N B;  2WTE A;  2CU7 A;  3ZMZ A;  1LNW A;  1J9I A;  1QVU A;  4BE1 A;  1GXQ A;  4II3 A;  2DA6 A;  2HTS A;  5C3E J;  5K5Q A;  2WAF A;  1ZG5 A;  2YS9 A;  1MH3 A;  2ZC2 A;  3K70 D;  2GIV A;  3HSR A;  4M3E A;  4A3F J;  5EZG A;  2D1V A;  2RV8 A;  1U78 A;  2Y48 A;  1FOY A;  4BYY A;  2CUZ A;  4YFN F;  2QF7 A;  2DYR H;  3FXR A;  3OYC A;  1ZG3 A;  2XC7 A;  2JRM A;  2BW3 B;  4IHY A;  2W00 A;  2W4S A;  3QAH A;  1B72 A;  4IEJ A;  2W1O A;  3LQR A;  4ESF A;  3AG1 H;  1UFM A;  4S05 A;  2FQ4 A;  3U21 A;  2GXG A;  5LGN A;  4BAC A;  2BW3 A;  4B43 A;  2QSF X;  1RRJ A;  4FX0 A;  5H20 A;  1FSH A;  3CCJ I;  3BJ6 A;  2L02 A;  4I98 B;  4XMY A;  4OOI A;  2F6C A;  1S3J A;  3H92 A;  3S2W A;  5CQE A;  3S15 J;  2O8X A;  1FBU A;  3S93 A;  2XAH A;  3BTJ A;  3W2V A;  2XPV A;  2JT1 A;  3CMA I;  2R7U A;  3GTQ J;  2FD5 A;  1XG1 A;  2L5Q A;  4ESJ A;  3F23 A;  2L9N A;  2MC4 A;  1ETQ A;  3SDG A;  5J40 A;  1OPC A;  2ADU A;  1X4P A;  4IQ4 A;  5J47 A;  2ZB9 A;  3JRC A;  1TQI A;  3A2K A;  2BZT A;  1QZY A;  2HQA A;  4CCJ A;  5K7F A;  2EA4 A;  2HXO A;  3RPQ A;  1WRJ A;  2IAI A;  2OF7 A;  3WE3 A;  4DIQ A;  2ZXW H;  3K4N A;  4E7S A;  4A93 J;  1QU3 A;  1E3P A;  2OZ6 A;  2HKO A;  1N78 A;  2P6T A;  2CV0 A;  3IH2 A;  4GYI A;  2Q0O A;  3DPU A;  5FKL A;  3CQZ J;  2FQ3 A;  4B3X A;  3ABU A;  3CUQ A;  2LKX A;  2Y30 A;  2BY0 A;  2M87 A;  2B7E A;  2EFP A;  2JPC A;  3S2H J;  3CDI A;  4UY8 I;  3HIF A;  1GT0 C;  1WVR A;  2HYF A;  4M9X A;  2FSW A;  1VQ9 I;  3Q9V A;  4XK4 A;  1QA6 A;  2OQR A;  4S0H B;  2OJE D;  5FLX Z;  3T8R A;  3S16 J;  2LSO A;  4XN0 A;  2JPB A;  4F93 B;  1NK2 P;  5J6X A;  2KDZ A;  4A3B J;  4L9N A;  3D5L A;  2L4M A;  3Q5F A;  4XRS A;  3LA2 A;  5HDN A;  3PNY A;  4UXN A;  4AVP A;  1VQ8 I;  5D5U B;  3FZV A;  1KGS A;  4MQV A;  5F64 A;  2CW0 F;  1G3W A;  3ZOB A;  4HNU A;  1BOA A;  2CGP A;  2HOE A;  4DOZ A;  3KX2 A;  1SD7 A;  3ESW B;  1JTY A;  2IVM A;  5LEJ A;  3K6G A;  2LMD A;  5BPD A;  1Y56 A;  1DQU A;  2BV6 A;  3CUO A;  4CCL A;  2DMQ A;  2UXX A;  3CJT B;  2HDC A;  2GZW A;  1IUF A;  4IRI A;  2QGU A;  3D5R C;  5K7Z A;  2V1N A;  2RQP A;  4C3I J;  1OKR A;  2KLO A;  2XRN A;  1Y6I A;  5CQG A;  2DA4 A;  4DZJ A;  2JA5 J;  4IOA F;  2KZG A;  1XGN A;  3OYJ A;  1TBX A;  1U3E M;  2L7F P;  5IT3 A;  1TTY A;  3KEO A;  3DTI A;  4UB8 C;  4BXX J;  5L3C A;  4RB3 C;  4QPQ A;  5DTD A;  1I39 A;  2UUZ A;  4FE4 A;  1ZN2 A;  1J59 A;  3HBL A;  1VQ5 I;  2OPT A;  3PIO F;  1SFX A;  4C3J J;  5M3F J;  4CSW A;  1E3H A;  2EV6 A;  2XRL A;  2HDW A;  3DV8 A;  5KCM A;  1VZ0 A;  1IDY A;  1ZTR A;  4AIJ A;  2NNN A;  5E3L A;  3QPL A;  3FBN B;  5FFZ A;  2YSR A;  1PYV A;  2OUM A;  3OYL A;  2ZO4 A;  1O3T A;  2VOO A;  1MNM C;  5J1U A;  4JP0 A;  4EGY A;  2AO9 A;  3GZ5 A;  3WG9 A;  1YW9 A;  2E1M C;  4UVC A;  1FYL A;  1YW8 A;  2ZKZ A;  1YJN I;  2VXD A;  1XX5 A;  2KJC A;  2E2H J;  3ZN0 A;  2JUG A;  3GFJ A;  5DV5 A;  3SHF A;  5FKO A;  4QWQ A;  1XD7 A;  3BR2 A;  2DT7 B;  4B09 A;  4R79 A;  2MA3 A;  2OD5 A;  1BR2 A;  2XAU A;  1JI8 A;  3AG4 H;  1U5T B;  2DA7 A;  4KYW A;  5LBQ A;  1ZLJ A;  2ZBK A;  4LJZ F;  3FM5 A;  3VWB A;  2HEO A;  2IEK A;  4AVZ A;  3KE2 A;  5BMZ A;  1OYI A;  4G12 A;  4XID A;  2K4J A;  2V9K A;  1U5T A;  2KRH A;  1T0F A;  2OCC H;  1I3A A;  3OYB A;  1RKW A;  3CP2 A;  2HZD A;  1DU6 A;  1UHM A;  4MNU A;  1MND A;  2BY3 A;  1YE9 A;  3EUA A;  5JLX A;  4BBR J;  1PJR A;  3J80 K;  1LE8 B;  1XN7 A;  2STW A;  2M4K A;  3PL8 A;  1U8B A;  4NDL A;  1P7J A;  4HF0 A;  3GF2 A;  2NVY J;  3WTZ A;  2DK5 A;  4F91 B;  4YFX F;  5CVV A;  1JHH A;  3WU2 C;  1A35 A;  3PJR A;  4ENM A;  5A2Q Z;  1RKT A;  1LE8 A;  1BJA A;  2DMP A;  1UG2 A;  2CUF A;  5FB2 A;  2L7K A;  2Q1Z B;  3GTK J;  2ID3 A;  3R0A A;  4ITV A;  2GOX B;  2LF8 A;  3ABT A;  5JFR A;  2M9H A;  5E8I A;  2VOD A;  1MW7 A;  2M3A A;  4B1R A;  1G3Y A;  2L54 A;  4M6Y A;  3CC4 I;  2HS5 A;  4WWC A;  2EJR A;  3F6V A;  4M3G A;  5GAE J;  3RYP A;  4I7H A;  4B48 A;  4M3D A;  4EM0 B;  5EGO A;  5GP9 A;  3DXJ F;  1LUJ B;  2MGQ A;  2MBF A;  5HOD A;  3OSF A;  2MG4 A;  5D6F A;  1SMT A;  4OWR B;  1BA5 A;  5JR3 A;  1K78 B;  3CDL A;  2DBB A;  3HXL A;  2WY7 Q;  1RES A;  1WH7 A;  5FKN A;  4ZH4 F;  1B4A A;  4XLC A;  2X48 A;  3HYI A;  3JRF A;  4A6D A;  1EA3 A;  1GVD A;  3C7J A;  3OWT A;  3QU6 A;  4ZJZ A;  5IOZ A;  2K9M A;  4CCM A;  1K78 A;  5DD4 A;  3R6S A;  3W6J B;  4ZTJ A;  4DQ2 A;  2R7F A;  2KP6 A;  2EV5 A;  3P5J A;  2KJB A;  1ZRD A;  1TWF J;  2TDX A;  1A6Q A;  2L3D A;  2CQQ A;  2PX9 A;  1XS9 A;  4RM3 A;  4XLH A;  4E7H A;  2P7C B;  5FO5 A;  5D5W B;  2DMU A;  1VQM I;  3QOD A;  3FXK A;  4Y4R A;  2ECB A;  1WHU A;  4DGW B;  1IN7 A;  3LSM A;  1SVM A;  4HZF A;  5DD8 A;  3K1M A;  3PSF A;  1T8I A;  2LR8 A;  2V4J C;  2VBZ A;  2F4M B;  4DZP A;  3MVP A;  1TQM A;  2Y75 A;  5D5V B;  3C2B A;  2MW8 A;  1WJB A;  3E6M A;  3FIW A;  4CUG A;  1Y39 A;  1H0M A;  3TOA A;  1YS6 A;  1RET A;  5CPR B;  1OMI A;  2P0W A;  3G1O A;  3M8J A;  1FMV A;  4HNT A;  3V8L A;  1K4T A;  4HQM A;  4XL9 A;  1G59 A;  1IN4 A;  2HOS A;  4M9S A;  2DA1 A;  4D7N A;  5L3G A;  1VFC A;  2MAB A;  4GCV A;  2R7W A;  1B8I B;  1MMD A;  2HZT A;  1GVJ A;  4H4K C;  3W6V A;  5KK1 A;  5FRN A;  1I6X A;  2IJL A;  1UEL B;  5ILV A;  5DM7 F;  2ZNZ A;  3GX4 X;  2DPU A;  3AKZ A;  2HTJ A;  2Z5U A;  2F5F A;  4F7Z A;  2VON A;  4IRG A;  4ZZD A;  1ACI A;  3DKX A;  4CZZ A;  3LFK A;  2LKP A;  1KYW A;  3OMY A;  4YG2 F;  2VN2 A;  3GYH X;  4M3B A;  3I9V 2;  1K6O A;  4XIC A;  3AG2 H;  1HW5 A;  1JJ8 C;  1YIT I;  3DLL F;  1Z6R A;  3OY9 A;  1B59 A;  1TWA J;  1ENH A;  3JW4 A;  3I55 I;  2V7F A;  4BEH B;  1I1G A;  1T98 A;  1ON1 A;  3PIP F;  3L7W A;  4XNF A;  4RS8 A;  1TT5 B;  1ZHF A;  1MBJ A;  4BGD A;  3CD6 I;  4RAG A;  3LSK A;  3KP5 A;  2O3F A;  1B9M A;  2D1H A;  2QSG X;  2PLY A;  4CH7 A;  4BEH A;  2X9D A;  5F0C A;  2NAZ A;  4G6D A;  3PFY A;  3RQ4 A;  1S7O A;  3OYE A;  2O8K A;  2R5Y A;  2F5C A;  4IHX A;  2Y0S A;  1FYM A;  3QU3 A;  4HBL A;  2IGM A;  3GTM J;  3QYE A;  4HSR A;  4XLA A;  1T95 A;  2Z2S B;  1MJ9 A;  3BP8 A;  4A5N A;  5D8L B;  1SFE A;  1V4R A;  3OYF A;  5F27 A;  4EVI A;  3GTG J;  4PGH A;  5CVR A;  1QZE A;  3ZXS A;  4RBO A;  4IHT A;  3I4N J;  1ZH5 A;  2Q2E B;  3BTL A;  2LF7 A;  1ZR2 A;  3Q0U A;  2LDU A;  5LRS A;  1P4A A;  2NVQ J;  2VT2 A;  3CCL I;  3A01 B;  2PMU A;  2ZXI A;  2H8W A;  4AUX A;  1F36 A;  2DDB A;  3K4B A;  2HPI A;  2QZ8 A;  2QCO A;  2EB7 A;  2MYS A;  5CVI A;  3ECH A;  4RDU A;  5J4Y A;  3JSO A;  3HKZ A;  5K5R A;  3OSG A;  3GLX A;  2NS7 A;  3TO6 A;  5FGM A;  4CIC A;  1O7L A;  5IYD J;  1RPW A;  2A68 F;  3KP6 A;  4UUS A;  5M5Y J;  1I3Q J;  4IHW A;  4HW0 A;  3CCS I;  5D4S A;  1CGP A;  3E0J B;  1S7E A;  2HVQ A;  2W25 A;  4ZZL A;  5HVQ C;  4KIS A;  2CQX A;  2QEN A;  3OIQ A;  3OIP A;  4BE0 A;  2LRE A;  2A69 F;  1ZRE A;  3GEZ A;  1BIA A;  4PZJ A;  4U0W A;  2ETH A;  1R4M B;  1U5T C;  4EEF G;  1W0T A;  2ID6 A;  3AG3 H;  4Y52 J;  4I02 A;  3F8M A;  1LJ9 A;  3BG5 A;  4PJ0 C;  4EV0 A;  1SMY F;  5FLX K;  4MFE A;  4UV8 A;  3K9T A;  5E3N A;  1C0W A;  3BR5 A;  2E36 A;  1FP1 D;  1Y0N A;  5J3L A;  2DCE A;  1AOY A;  1OFC X;  1IRF A;  1WCM J;  3D5S C;  3I71 A;  2HQ5 A;  3OYG A;  1IJW C;  3WGH A;  5DUI A;  4HV5 A;  2OZU A;  4CXF A;  2Y9Z A;  3AFH A;  2VE9 A;  4C3H J;  3PNT A;  4LIT A;  3JRD A;  4UNO A;  3RJP A;  5C44 J;  3HTU A;  5LFA A;  1XSD A;  1Y1V J;  4ZYE A;  1ETO A;  3GTJ J;  1HQC A;  3ML6 A;  3VSK A;  4HQE A;  4ZDO A;  3CF2 A;  2K9Q A;  2OTL I;  3HOW J;  1R5G A;  2ELJ A;  1YYV A;  4L5J A;  3L2C A;  2EBI A;  4BJ6 C;  2LBF B;  2PMZ A;  3BDD A;  1GXP A;  1FTZ A;  5FRM A;  2DMT A;  1BW6 A;  3FWE A;  4XLN F;  4ETS A;  1P4W A;  3M07 A;  2L9S A;  2JWT A;  2YU9 J;  1H9G A;  2BY2 A;  3ZN1 A;  4BY1 J;  2KRC A;  3BG7 A;  3CCV I;  2X6W A;  3K4C A;  2ICW G;  3GXO A;  2ACJ A;  3K0L A;  3MCZ A;  1MJA A;  3X2Q H;  2DJI A;  2HVS A;  3JRG A;  2O6G E;  5IYC J;  3FHZ A;  3IH4 A;  2EIN H;  1O3R A;  2VJI A;  2F2E A;  4XRS G;  2GLO A;  3SQN A;  3ZQ7 A;  2RN7 A;  4A3L J;  4JBA A;  3RDI A;  5IY5 H;  1D8J A;  1GHC A;  4IOC F;  1JE8 A;  4Q47 A;  1P6R A;  3RZO J;  4IHS A;  3GVA A;  1HBX G;  1PUE E;  4KDP A;  3DKY A;  2MLG A;  2V9P A;  2QBY B;  1HKQ A;  2R7O A;  2AQF A;  2P8T A;  3CLQ A;  1OCR H;  2E1M B;  1HW1 A;  5GPA A;  2KIS A;  1W36 D;  4D7M A;  2ZCW A;  3E7L A;  2HQN A;  1TLH B;  5E79 C;  2VOP A;  2MD0 A;  2QBY A;  1FMW A;  3CMY A;  2PBI A;  3VYT B;  1SD6 A;  4KIG A;  2M45 A;  2N8G A;  1FZP B;  1V5G A;  3LSI A;  4LD5 A;  4FTH A;  1POG A;  3KYD B;  4XKB A;  1DGR M;  2KKO A;  2BY1 A;  2CUE A;  1JKQ C;  1V55 H;  1MDM B;  3ZPL A;  4A3G J;  3O8G A;  2X51 A;  4RGR A;  3FXM A;  3LSR A;  1BC8 C;  2QUF A;  4RAZ A;  1Z77 A;  1F1Z A;  1R22 A;  1XDU A;  3HUG A;  3LST A;  1MDM A;  5E3M A;  2CJJ A;  4MEY F;  1JJ6 C;  5EJC A;  3U1D A;  2K9S A;  2NS8 A;  3E5X A;  1HDP A;  3SDB A;  4Q5S F;  1Z7U A;  2IS4 A;  5LGU A;  2AXT C;  2IW5 A;  2MFZ A;  4OMZ A;  1Y0U A;  2QA4 I;  3GTP J;  5A2Q K;  2OA4 A;  1IN6 A;  3KZI C;  5JI6 A;  3DPT A;  5HLT A;  4FAS D;  3C2H A;  1H88 C;  3HZJ A;  1TWH J;  1W7P B;  2W24 A;  3L9F A;  4NNJ A;  1DDN A;  3H5N A;  5LRR A;  2BGC A;  5FLM J;  3WGG A;  5FLV A;  3ZQG A;  1D1C A;  1GLN A;  3CMM A;  1DPU A;  2DU9 A;  2UWM A;  3H9J A;  3KEY A;  4Y33 A;  1W7P A;  3G4S I;  2R92 J;  2EFN A;  3HSF A;  2VT3 A;  1RI7 A;  1YOV B;  2IGO A;  2IXS A;  3BCA A;  3ISP A;  3ZP5 A;  4PDK A;  2R5Z A;  3SJM A;  4D1Q A;  1JGG A;  3M9A A;  1WZ2 A;  1V5F A;  2XVC A;  1LFP A;  1W5C C;  3BR6 A;  4ENK A;  4NUB A;  4XOP A;  4CCK A;  3U9G A;  5KNL A;  1XTA A;  5B1B H;  3MD2 A;  1KQ9 A;  5F0H A;  1X1P A;  2VIX A;  3IP4 B;  3DWL E;  2E5N A;  4HF1 A;  1JT6 A;  4DNC A;  2P4W A;  2WY8 Q;  5IT9 Z;  1T2K A;  5DEQ A;  1HKS A;  4BU2 A;  2LFB A;  3JAM Z;  1WI9 A;  5E18 F;  4GDF A;  4BHB A;  4C2M J;  1MMN A;  1U0J A;  3ABL H;  3F3X A;  3IV5 A;  1F4K A;  5EDN A;  2PI0 A;  2EFQ A;  3VSL A;  3E5U A;  2BHZ A;  2COM A;  3HRT A;  5HDG A;  2K3F A;  1VND A;  4N9I A;  1T38 A;  1D1B A;  3EQL F;  3HPH A;  5HS7 A;  4PSX A;  1YHQ I;  4A3C J;  4XLF A;  5FD5 A;  4M72 A;  1BC7 C;  1SAX A;  4IF4 A;  2ZJP F;  2EIJ H;  3EUK L;  2WAE A;  1IXS B;  3BR3 A;  4HLX A;  3P9K A;  3EDP A;  2DJN A;  2FEZ A;  2Y9Y A;  4LIV A;  4LLN A;  3HRU A;  4ASN A;  4I2O A;  2XAQ A;  1NHA A;  4NC7 A;  3CLO A;  3E97 A;  3ECO A;  1ZYR F;  3MAJ A;  1PP8 F;  1VI0 A;  2O7O A;  1R71 A;  2HOT A;  2KZV A;  5E20 A;  3GTL J;  2RGV A;  1QZZ A;  4Q4Z F;  1WI3 A;  2IBD A;  2PJR B;  4V2G A;  3BJA A;  4AIK A;  3IKV A;  4P1W A;  4BQO A;  3FMS A;  2HR3 A;  1ZLK A;  1P92 A;  2F48 A;  2VLA A;  1J2X A;  4G6Q A;  4BQQ A;  2VKD A;  3CJR B;  3HRM A;  1B6A A;  3GME A;  2WAD A;  2JK3 A;  1MBK A;  5BQT A;  5ED4 A;  4C2T A;  1WGX A;  3UR3 C;  4J19 A;  3QYF A;  2XAJ A;  1VQK I;  1W0U A;  2IRF G;  3H0D A;  2ZNY A;  3L2W A;  4IO9 F;  1A6I A;  2ESH A;  3BT9 A;  3K69 A;  1WKM A;  3BRO A;  4RGX A;  3LSH A;  1X1D A;  2X85 A;  1G4D A;  1STZ A;  3GWZ A;  4E4H A;  3BQZ A;  2F4O B;  4XLE A;  2G7H A;  2HQR A;  3QPH A;  5LHG A;  3K1N A;  4HX8 A;  2ECC A;  3CZ6 A;  4IPA A;  4ON0 A;  3MZH A;  3HG9 A;  2W84 A;  3DPL C;  4EJT A;  3BTI A;  4M73 A;  3SEZ A;  5L3E A;  1O57 A;  1S9H A;  2E60 A;  2GXA A;  1QRY A;  3K70 C;  2XAG A;  1XCB A;  2HFH A;  4CHU A;  2R7Q A;  3H5A A;  4UUT A;  1ONV A;  1N77 A;  1K61 A;  2M5W A;  4OAY A;  1JHF A;  2DA5 A;  5FKM A;  3J7Z I;  3B6C A;  3ERM A;  3FXQ A;  3K4J A;  1MSF C;  2VC1 A;  9ANT A;  2GBY A;  2XSD C;  2EIK H;  3LQQ A;  3BPV A;  5L3B A;  4J01 A;  3PQK A;  2L7M P;  3CO7 C;  4G6T B;  5TRD A;  4BUP A;  2R7X A;  1WFX A;  1NK3 P;  3GFI A;  4RA2 A;  1R49 A;  2EIL H;  3MQ0 A;  2X1C A;  3KLO A;  5TIS C;  5F6F A;  2O9L A;  4PJN A;  5EEG A;  3BWG A;  4KIC A;  1ULY A;  3CES A;  1QPI A;  2K02 A;  2GOM A;  4I0A A;  4MO7 A;  4E7K A;  2FOW A;  3NAU A;  3IAS 2;  3KP7 A;  1B1B A;  1LKX A;  2OAZ A;  4II2 A;  3P7N A;  5ICF A;  4EM2 A;  3L00 A;  3ZQL A;  1SFU A;  2E7X A;  1J7K A;  1LEA A;  4EJO A;  2VBY A;  4AYB N;  3G6E I;  1S72 I;  4MHG A;  5FKK A;  2RC4 A;  3LOC A;  2MD5 A;  1X4O A;  2I10 A;  1REP C;  3HOY J;  3HOZ J;  3OS2 A;  1USS A;  1OCT C;  2FRH A;  2VE8 A;  4KIT B;  4FET A;  3TMO A;  4K2E A;  1BI0 A;  1UHW A;  3PUF A;  1R00 A;  4D9J A;  4GRI A;  2LLK A;  1XCV A;  3DU6 A;  1RZ4 A;  1BW5 A;  3JRA A;  1X3W B;  3I64 A;  2JMW A;  3Q0V A;  3BTC A;  2GM4 A;  4L9T A;  2ISZ A;  4FCY A;  3LSP A;  4FT8 A;  2JVG A;  5TJJ A;  4CYC B;  3FBI B;  2VC0 A;  3A1Y A;  5BS6 A;  1DGW Y;  5AON A;  1QBJ A;  4G7O F;  4EM1 A;  5B3S H;  4KNY A;  4LMY A;  2BBY A;  2ZME C;  4A69 C;  2E19 A;  3PUB A;  5GTI C;  3TW6 A;  1RNL A;  3EUH C;  1R1U A;  3ZQI A;  4CYC A;  1EH8 A;  4UB6 C;  1QVT A;  4HX4 A;  3J81 Z;  3JRI A;  1ZK8 A;  3A02 A;  1UMQ A;  1WWX A;  3JCU C;  1Q1V A;  1SC7 A;  3MWM A;  4GO1 A;  2K3P A;  1FPQ A;  5F0F A;  1ZQ3 P;  4FIS A;  2ME0 A;  4EAT A;  2XB0 X;  4LFU A;  3FXO A;  2O61 A;  2ZSH B;  5LHI A;  2XPU A;  2CWE A;  1Z21 A;  1JKO C;  2Y69 H;  4YFK F;  5E1W A;  1KU2 A;  5M3M J;  1YI2 I;  4XSX F;  2A61 A;  2L2O A;  2V1D A;  4PSW A;  1JUP A;  1XMX A;  1LFU P;  1MJB A;  1CF7 B;  4OMY A;  2CW7 A;  3HL2 A;  2DI3 A;  2ZJ2 A;  4CGZ A;  2ME6 A;  1FIP A;  4IXA A;  4EJW A;  3IWF A;  4QSH A;  5K1Y A;  1DP7 P;  1CF7 A;  5K7H A;  1R23 A;  1KA8 A;  3GZN B;  3HOS A;  1E2X A;  1IXR C;  3RKY A;  4BXF A;  3HPG A;  1UCR A;  1X2M A;  3F72 A;  2F5E A;  4ZYA A;  2A5Y B;  5ILU A;  4FX4 A;  3CJQ B;  1Z3Y A;  3F22 A;  4HF2 A;  3NWT A;  5F08 A;  4X0G A;  1K4S A;  5AIQ A;  4LLG F;  2DLL A;  3ZGK A;  4KA4 A;  1XMA A;  4E7I A;  4P9U A;  3HOT A;  3HGG A;  5KVR A;  1GV2 A;  2KDO A;  3H35 A;  1KU9 A;  2NYX A;  1OCP A;  2B63 J;  4P55 A;  3VYR B;  2LNB A;  4KFC A;  1FBQ A;  3HJE A;  4AIH A;  1X3U A;  4KIB A;  1HDD C;  2VKV A;  4MLO A;  3VPR A;  2D45 A;  1TC3 C;  3KEQ A;  1ETX A;  3LFU A;  3R60 A;  4WCG A;  3ZCO A;  3NEU A;  1LEB A;  3KP3 A;  1Y1W J;  5TGT A;  2JVH A;  1G3S A;  4OIP F;  2CFX A;  3DBR B;  3FXU A;  4RB1 A;  4C9Y A;  4MIM A;  4DW6 A;  1D0Z A;  2VJJ A;  2KL4 A;  3R0J A;  4BH9 A;  4G8X A;  4DYQ A;  2CH0 A;  4GYG A;  1L3L A;  2IGK A;  3RQI A;  4B8X A;  3RI4 A;  4NQW B;  2CV1 A;  1W5T A;  2K9L A;  2LY1 A;  1FNN A;  2K7L A;  2XGX A;  1PDN C;  3V7C A;  1B9N A;  3NAR A;  4GGG A;  2WV0 A;  2WC2 A;  4WXD A;  4CDG A;  1EJ9 A;  2GA2 A;  2HGC A;  5EEH A;  5HLG A;  4ENJ A;  1ZG1 A;  3A4C A;  4HRI A;  4XOT A;  4HPQ A;  2F5D A;  4KMU X;  2M8E A;  2LVS A;  5K5O A;  1ETY A;  5J1Y A;  3Q9S A;  1WQ2 A;  2XAF A;  1E17 A;  4G94 A;  1B8I A;  1IV6 A;  2J5O A;  2F4I A;  4L5I A;  2PJP A;  3CF5 F;  2CS3 A;  4EQQ A;  3BG3 A;  3RKW A;  2JRT A;  4L0Z B;  2QEX I;  2D2W A;  1BM9 A;  2DA2 A;  3WTX C;  3FK7 A;  1ITY A;  5FFX A;  2IA0 A;  1FLI A;  5DCM B;  2LY2 A;  2IP2 A;  2JSP A;  2YR2 A;  3MMY B;  5EYR A;  3VEP A;  1JKP C;  4G7Z F;  4F3Q A;  2V6C A;  3F8B A;  4HST A;  3ONQ A;  1Z7L A;  2WAQ A;  4HDV A;  4A3E J;  3FF5 A;  1D8K A;  1ODD A;  3K7A J;  4HAM A;  4L0Y B;  2FBK A;  3ZQH A;  3MFK A;  1S6L A;  3FMR A;  1H9T A;  4O5V A;  4N0B A;  2Y0M A;  2DFF A;  2O0Y A;  5ILS A;  1E0E A;  3I54 A;  1Y8Q B;  3DP7 A;  1BJZ A;  3O8H A;  5IT9 K;  3T5X A;  3J7A O;  3JAM K;  3CCY A;  4D5F A;  2WB1 N;  4E6K G;  3ULQ B;  1TW2 A;  1Z6T A;  1R1T A;  4L9V A;  3BG9 A;  3S1Q J;  2QSH X;  1EF4 A;  3DBL B;  3MKW B;  1OQY A;  1G3T A;  1AKH B;  3E6D A;  4U7D A;  3TOB A;  2E7W A;  2DQR A;  2JUC A;  3A03 A;  3CCM I;  3RPU A;  3GO5 A;  2Q8K A;  2IA1 A;  1D3Y A;  5D4R A;  3GCM A;  1IN8 A;  3GW2 A;  3IWZ A;  3KIO A;  2JJ7 A;  3DLA A;  2H27 A;  2KPM A;  3H3V K;  3W2A A;  1NH3 A;  3L2U A;  1AKH A;  4A0X A;  3KZZ A;  1Z3X A;  2FU4 A;  1OCC H;  3HHH A;  2F5V A;  4D0P A;  4XRF A;  2B9S A; 
#chains in the Genus database with same CATH homology
 2N8G A;  5EGO B;  3D1N I;  2LKX A;  2Y30 A;  4FTH A;  1POG A;  1T33 A;  3S2H J;  3OIO A;  1GT0 C;  2CUE A;  1JKQ C;  1FTT A;  4QIW N;  5C4J J;  1SFO J;  3GTO J;  4XK4 A;  4A3G J;  3O8G A;  4S0H B;  3S16 J;  3LSR A;  1LFB A;  3A01 A;  4LOC A;  1Z77 A;  1NK2 P;  3M3Y J;  2KDZ A;  4A3B J;  5E3M A;  2CJJ A;  4AC0 A;  4XRS A;  3S2D J;  1JJ6 C;  2K9S A;  2NS8 A;  1HDP A;  2EZI A;  2DA3 A;  3DEW A;  3ZOB A;  3IH3 A;  3GTP J;  2WV1 A;  1H88 C;  1JTY A;  2NVX J;  3S14 J;  1TWH J;  1H89 C;  3TP0 A;  5FLV A;  5FLM J;  3ZQG A;  5IYB J;  2KT0 A;  2DMN A;  2DMQ A;  4B3A A;  4BKX A;  1WH5 A;  5E3O A;  1IUF A;  3PO3 J;  2R92 J;  5K7Z A;  3SJM A;  4C3I J;  1JGG A;  2R5Z A;  2DA4 A;  4DZJ A;  2JA5 J;  2E2I J;  3BR6 A;  3QQA A;  2RAE A;  2HYJ A;  2HOA A;  2L7F P;  4BXX J;  3S1N J;  5DTD A;  2L0K A;  2X6O A;  4FE4 A;  5F0H A;  1TWC J;  3HBL A;  4B4C A;  1JT6 A;  3JR9 A;  2OPT A;  3QPS A;  4C3J J;  5M3F J;  4W1U A;  2VUM J;  2XRL A;  1K83 J;  2LFB A;  1IDY A;  1ZTR A;  2EZL A;  2XGD A;  1ZGW A;  5E3L A;  4C2M J;  3QPL A;  3IV5 A;  1I50 J;  5EDN A;  2EH3 A;  3TED A;  1MNM C;  3JRH A;  5J1U A;  1VND A;  1GDT A;  4JP0 A;  1JT0 A;  4A3C J;  2AO9 A;  4BBS J;  3BR3 A;  1ETV A;  1MBE A;  2E2H J;  2E2J J;  3Q0W A;  2DJN A;  5FKO A;  3JRE A;  3BR2 A;  2Y9Y A;  5EG0 B;  2DA7 A;  1H8A C;  2IEK A;  2VI6 A;  2W48 A;  4JX6 A;  3G1L A;  2LK2 A;  4G12 A;  4XID A;  2XGE A;  1AHD P;  2TCT A;  3UKG A;  5EG0 A;  1VI0 A;  2O7O A;  2HOT A;  2NVT J;  1RKW A;  5F04 A;  1HLV A;  3GTL J;  1DU6 A;  1WI3 A;  2IBD A;  4V2G A;  5JLX A;  4BBR J;  1LE8 B;  3SFI A;  1D5Y A;  3RKQ A;  4A3K J;  5EZH A;  1U8B A;  4NDL A;  1P7J A;  2NVY J;  2R93 J;  1PUF B;  2JK3 A;  3DCF A;  1MBK A;  2R5Y B;  1DU0 A;  1LE8 A;  1RKT A;  3MN2 A;  2HDD A;  4I76 A;  1WGX A;  2CRG A;  1UG2 A;  2DMP A;  2EQR A;  2YUS A;  2L9R A;  3HM5 A;  4J19 A;  2CUF A;  5M5W J;  3GTK J;  1W0U A;  2ID3 A;  1HCR A;  4HNV A;  2LD5 A;  3BR0 A;  1A6I A;  2M9H A;  3BT9 A;  3WHC A;  4B1R A;  2JN6 A;  4A3J J;  1U9N A;  4M3G A;  2M8G X;  4M3D A;  5EGO A;  5GP9 A;  1ETK A;  3BQZ A;  2MGQ A;  4BY7 J;  5HOD A;  3OSF A;  2MG4 A;  4W97 A;  1BA5 A;  1SAN A;  2ECC A;  2R7Z J;  3MKL A;  3CDL A;  1X2N A;  1X58 A;  5IOY A;  1RES A;  3BTI A;  1WH7 A;  4V2F A;  5FKN A;  4A3I J;  2M34 A;  3HOV J;  2LTP A;  2X48 A;  2DTZ A;  3JRF A;  2E1O A;  1QRY A;  1GVD A;  1R9T J;  2R0Q C;  1AU7 A;  5IOZ A;  1IDZ A;  4UUT A;  1I6H J;  3RZD J;  1IRZ A;  1K61 A;  3BQY A;  2DA5 A;  5FKM A;  4UUS B;  2JA6 J;  2ELK A;  1TWF J;  3B6C A;  1MSF C;  9ANT A;  1P7I A;  2GBY A;  2XSD C;  1JTX A;  1FJL A;  2CQQ A;  2VPR A;  1XS9 A;  2FX0 A;  2L7M P;  2DMU A;  1NK3 P;  2H1K A;  4A3D J;  2ECB A;  4QTR A;  2LR8 A;  2O9L A;  4DZP A;  3MVP A;  1HF0 A;  1QPI A;  3C2B A;  2MW8 A;  3FIW A;  1RR7 A;  3M4O J;  1RET A;  3LNQ A;  4FE7 A;  5IP6 A;  3G1O A;  4MO7 A;  3JRB A;  4ABZ A;  3NAU A;  2D5V A;  2HOS A;  3ZQL A;  1G2H A;  4IHV A;  1ORK A;  2DA1 A;  4D7N A;  1VFC A;  4AYB N;  3L1P A;  2M0C A;  2EZH A;  1B8I B;  5FKK A;  3LOC A;  1OJL A;  2I10 A;  3HOY J;  3W6V A;  2Y0S N;  3HOZ J;  1GV5 A;  1OCT C;  2Y2Z A;  2VKE A;  4Y7N J;  2LP0 A;  4JX4 A;  1U9O A;  2LLK A;  1B72 B;  2XB5 A;  3S1R J;  2LY9 A;  3WHB A;  1BW5 A;  3JRA A;  2JMW A;  3Q0V A;  3PO2 J;  3BTC A;  2GM4 A;  2COB A;  4DYC A;  1IC8 A;  3OOU A;  2FJ1 A;  3FK6 A;  4FCY A;  3G1M A;  3LSP A;  4M3B A;  5BNG A;  4XIC A;  4CYC B;  3F0C A;  1JJ8 C;  1GUU A;  1FIA A;  5M5X J;  1TWA J;  4A69 C;  2E19 A;  3B6A A;  3TW6 A;  3LSG A;  3HKZ N;  1ENH A;  4GFB A;  3ZQI A;  4CYC A;  1QVT A;  1F43 A;  5EF6 A;  2HI3 A;  3GBG A;  3JRI A;  1MBJ A;  3H0G J;  1ZK8 A;  3A02 A;  1MBH A;  1UMQ A;  5C4X J;  1Z0X A;  4M6V A;  1Q1V A;  5GPC A;  3ZQC A;  1ZQ3 P;  5F0F A;  3HEF A;  4FIS A;  2JA7 J;  2ME0 A;  2X9D A;  2XB0 X;  1IG7 A;  2DN0 A;  5F0C A;  3HB9 A;  1HOM A;  2XPU A;  1JKO C;  2O8K A;  5M3M J;  3K2A A;  1PUF A;  4XRM A;  2R5Y A;  1JUP A;  4IHX A;  1LFU P;  4L5E A;  1MBF A;  4DYR A;  4D5C A;  2L7Z A;  2ME6 A;  3GTM J;  1XC5 A;  1FIP A;  2HXI A;  1ZKG A;  4QSH A;  2AHQ A;  2K40 A;  2NOG A;  5K7H A;  5F27 A;  3GTG J;  1JUS A;  4RBO A;  3TP3 A;  4JX5 A;  3I4N J;  1X2M A;  3BTL A;  3HOX J;  1T56 A;  1ZR2 A;  3Q0U A;  1E3O C;  1BL0 A;  2Y31 A;  2NVQ J;  3S1M J;  3A01 B;  1IGN A;  3HDD A;  4AUX A;  1F36 A;  5F08 A;  2XPW A;  2QCO A;  4I6Z A;  3HGY A;  4RDU A;  5IP7 J;  1TWG J;  3HGG A;  1A5J A;  3OSG A;  1GV2 A;  4M3F A;  1JKR C;  2NS7 A;  2PMZ N;  3FKI J;  1OCP A;  2B63 J;  5FJ8 J;  5IYD J;  1RPW A;  4UUS A;  2H8R A;  5M5Y J;  4X6A J;  1I3Q J;  1HDD C;  2VKV A;  4MLO A;  3VPR A;  4A3M J;  4IHW A;  2G0E A;  1TC3 C;  1ZR4 A;  3LSJ A;  1ETX A;  2WAQ N;  4JYK A;  4MFD A;  1S7E A;  1ETW A;  2M2E A;  1Y1W J;  2CQX A;  2JA8 J;  2R5Z B;  1YRN B;  5J1R A;  1UHS A;  4MIM A;  4DW6 A;  2P81 A;  4EEF G;  2MSY A;  1W0T A;  2ID6 A;  4DYQ A;  4Y52 J;  3RQI A;  1MH4 A;  3BG5 A;  3FIS A;  1MBG A;  4MFE A;  5EEA A;  5E3N A;  1YRN A;  5DS9 A;  3BR5 A;  5F1J A;  1MSE C;  3NAR A;  5J3L A;  3PM1 A;  2CU7 A;  1OFC X;  1QVU A;  1WCM J;  2DA6 A;  2HQ5 A;  5C3E J;  3ZQF A;  1IJW C;  2YS9 A;  1MH3 A;  1FEX A;  2LVS A;  2Y9Z A;  1ETY A;  4C3H J;  5J1Y A;  2EZK A;  4M3E A;  3JRD A;  1B8I A;  4A3F J;  5EZG A;  1IV6 A;  1U78 A;  5C44 J;  1Y1V J;  2QF7 A;  1ETO A;  3GTJ J;  3BG3 A;  2K9Q A;  3HOW J;  2DA2 A;  3TW7 A;  4IHY A;  3FK7 A;  2EBI A;  1ITY A;  5IP9 J;  1APL C;  1B72 A;  4IEJ A;  1FTZ A;  2DMT A;  1BW6 A;  1WPK A;  2FQ4 A;  5EYR A;  2JWT A;  1CQT A;  1JKP C;  2YU9 J;  2XGC A;  4BY1 J;  4A3E J;  2TRT A;  3K7A J;  3ZQH A;  1O4X A;  3S15 J;  3JRG A;  5IYC J;  3IH4 A;  3Q3S A;  3BTJ A;  3S17 J;  5IPA A;  3HOU J;  2XPV A;  1BJZ A;  3O8H A;  4XRS G;  2GLO A;  3GTQ J;  2FD5 A;  3BR1 A;  1XG1 A;  4A3L J;  3I4M J;  3CCY A;  4D5F A;  2WB1 N;  3RZO J;  3S1Q J;  1ETQ A;  3BG9 A;  3SDG A;  1EF4 A;  1VF9 A;  3JRC A;  4X1E A;  2ZB9 A;  1AKH B;  5K7F A;  2HXO A;  5GPA A;  3A03 A;  2IAI A;  5JLW A;  2OF7 A;  4D7M A;  1JUM A;  1NTC A;  3E7L A;  2JJ7 A;  3H3V K;  4A93 J;  1AKH A;  3IH2 A;  3CMY A;  5FKL A;  2K9N A;  3CQZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...