2ME6A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens in complex with the dna sequence cgactaattagtcg
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Homeobox protein GBX-1
total genus 16
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me6A00
1VNDA 5F08A 2DA1A 2FQ4A 4GFBA 3ZQLA 3BR1A 2ME0A 3CQZJ 1ZR2A 2LY9A 2LKXA 1IDZA 1ETXA 4S0HB 3JRFA 5F0HA 2O9LA 2IBDA 3S1NJ 4Y7NJ 1HLVA 3S14J 2P81A 1ZK8A 1JJ8C 1B72B 2CQQA 2VI6A 3ZQGA 2VUMJ 4A3BJ 1H8AC 1IUFA 4A93J 5FLVA 4C3HJ 1VI0A 2H1KA 3HB9A 3JR9A 2MGQA 2L0KA 5FJ8J 1MSEC 3Q3SA 1NTCA 1XG1A 2TCTA 1HF0A 4RBOA 1ETYA 3FK6A 4DYRA 1SANA 1FEXA 2M9HA 1Q1VA 5E3LA 1H89C 1WGXA 5C4JJ 3FISA 1U8BA 1TC3C 1U9NA 1P7IA 1AKHB 1K61A 4W97A 1I6HJ 4MO7A 3L1PA 3M4OJ 4V2GA 3OIOA 5E3NA 1Z0XA 2OPTA 2YS9A 3OOUA 2YUSA 2NS7A 1OCPA 4JP0A 1YRNB 3OSGA 5EGOA 3MN2A 4XRSG 2R5YB 4DYCA 3GTJJ 1B8IA 2HXIA 2E2IJ 1IDYA 5IYBJ 3A01B 3RKQA 4M3EA 4UUSB 1ZQ3P 1MNMC 3GTKJ 3BR0A 3WHCA 1IJWC 1RETA 4UUSA 4BY7J 1FJLA 4XRMA 2LVSA 1LE8B 1ETQA 4BBSJ 1GDTA 4J19A 1MBEA 2R5YA 3BG3A 3S16J 2Y9ZA 3HOVJ 3ZQHA 3CCYA 4A3CJ 1TWAJ 1OCTC 2CJJA 3QPLA 2M8GX 4JX5A 1UG2A 1D5YA 1EF4A 1WCMJ 3S15J 4X6AJ 3BTIA 2N8GA 5JLWA 1JUPA 3HEFA 3LNQA 4JX4A 1SFOJ 1U78A 2EBIA 3NAUA 2R93J 5FKKA 3WHBA 1GUUA 5EYRA 1MBJA 2AO9A 5EF6A 1MH3A 1WI3A 2EZLA 3HOUJ 5J1RA 3BR6A 5K7HA 1ETWA 2Y9YA 2X6OA 2DMNA 5FKNA 4B1RA 3IH4A 1Y1WJ 2GBYA 1HCRA 3CDLA 1FTZA 3W6VA 5F04A 1MBHA 3HOXJ 2LLKA 4D5CA 1WPKA 3JRDA 1BL0A 2JA8J 1F43A 2K40A 4FISA 3LSRA 1QVUA 2X48A 1W0TA 3F0CA 4A3GJ 5IOYA 1RKTA 2MW8A 1XC5A 4L5EA 3O8GA 3E7LA 1JKRC 5HODA 5EG0B 5M5XJ 2B63J 4EEFG 1LFBA 2DA5A 1HDDC 2CRGA 3GTGJ 5E3MA 1FIPA 5EG0A 2JWTA 4MLOA 3BTJA 2R5ZA 2CUFA 5J3LA 1HOMA 3OSFA 1HDPA 1APLC 2JJ7A 2XSDC 3BT9A 2NVQJ 3B6CA 2EZHA 4IHWA 1XS9A 2COBA 2ECCA 2W48A 3BG5A 3ZQFA 3S1MJ 2NOGA 2EZIA 4G12A 2HQ5A 4ABZA 2RAEA 4QIWN 2L7ZA 1NK2P 4D5FA 1ZTRA 2G0EA 1GVDA 3M3YJ 2Y2ZA 2NS8A 3RQIA 3D1NI 3BTCA 2DN0A 2DA4A 4FTHA 3HGYA 1VF9A 3DEWA 5C4XJ 1ETVA 1ZGWA 5EDNA 2LP0A 3GTLJ 3JREA 5DTDA 2X9DA 2L9RA 2XPUA 3HOYJ 1AHDP 2IEKA 3LSGA 3PM1A 3H3VK 5M5WJ 1PUFA 3HM5A 1ZKGA 1BW6A 2HI3A 2DA6A 3O8HA 1I50J 1MBGA 4B3AA 5EZHA 4C3IJ 2HDDA 3BTLA 1QRYA 1Y1VJ 5K7FA 2KDZA 2R0QC 3GTOJ 4DW6A 2NVXJ 2KT0A 5IP6A 1ZR4A 2WB1N 2GM4A 9ANTA 5JLXA 1I3QJ 1ETKA 3G1OA 4BXXJ 3ZOBA 1P7JA 4QSHA 5IP7J 3B6AA 3QQAA 1BA5A 2M2EA 2DJNA 2OF7A 5C44J 1T33A 3TW6A 3BR3A 3HBLA 2K9SA 2JA7J 2FX0A 1JTYA 5EGOB 1E3OC 2DMPA 3IH2A 4M3FA 4JX6A 3C2BA 1B72A 4IHYA 1JUMA 5IPAA 4B4CA 3JRGA 1JGGA 4IHXA 5EZGA 3MKLA 3TEDA 2PMZN 1MBKA 4UUTA 2XPWA 3ZQCA 1FIAA 1AU7A 1ITYA 1T56A 3I4MJ 5IOZA 1JKOC 1JT0A 2ECBA 4M3DA 3JRBA 5FLMJ 2E2JJ 1TWFJ 3GBGA 1TWCJ 2EZKA 1JTXA 4C3JJ 1ETOA 4A69C 1RPWA 1O4XA 2HOTA 1X2MA 4HNVA 4FE7A 2E2HJ 4IEJA 4FE4A 4QTRA 1FTTA 3A02A 3S1QJ 2DA3A 4A3LJ 2DA7A 2M34A 2NVYJ 5IYDJ 3JRIA 2XPVA 3VPRA 2K9NA 2DMQA 4C2MJ 5FKOA 4XRSA 2QCOA 2JA5J 5IYCJ 3S1RJ 2XB0X 2ZB9A 4DZJA 4A3KJ 1JKQC 1W0UA 2L7MP 5GP9A 3S2DJ 2R7ZJ 1NK3P 1GV5A 4FCYA 3FKIJ 1POGA 3S17J 4XICA 3JRCA 4A3IJ 4A3MJ 5EEAA 2CUEA 5BNGA 2VKVA 2Y31A 4MFDA 2DA2A 2DMUA 5K7ZA 5M3FJ 4DYQA 3IH3A 4BBRJ 4XIDA 3G1LA 4XK4A 3K2AA 3SJMA 1UMQA 4IHVA 3A03A 1GV2A 4AUXA 5E3OA 1F36A 2XGCA 4I76A 4A3DJ 1TWHJ 1IG7A 3FIWA 3DCFA 2CQXA 4RDUA 2JMWA 3Q0WA 4A3EJ 3TP3A 2NVTJ 2VKEA 4Y52J 5IP9J 5GPAA 3LSJA 4CYCB 4MIMA 2FD5A 4BY1J 2O7OA 5DS9A 1DU0A 2H8RA 3QPSA 2CU7A 1TWGJ 5F0FA 3A01A 2HXOA 2DTZA 3UKGA 4X1EA 3Q0VA 3BG9A 1RKWA 2JK3A 1QPIA 2WAQN 3SFIA 3I4NJ 2I10A 2GLOA 4M6VA 2XB5A 1S7EA 3Q0UA 4V2FA 4W1UA 2D5VA 2XGEA 4MFEA 3FK7A 2ME6A 5M3MJ 2LTPA 1JT6A 5GPCA 1U9OA 3MVPA 3TW7A 1VFCA 2E19A 2AHQA 3HDDA 4D7MA 2ID6A 2TRTA 1WH7A 4AYBN 2O8KA 3HOZJ 1BW5A 1X2NA 5C3EJ 1R9TJ 2HOSA 3GTQJ 3PO2J 4A3FJ 3CMYA 5F27A 2Y0SN 1WH5A 4AC0A 4A3JJ 3K7AJ 2LR8A 2EQRA 4D7NA 2VPRA 3HOWJ 1K83J 2K9QA 4M3GA 2XGDA 5F1JA 1CQTA 1MH4A 4NDLA 2L7FP 1Z77A 5J1YA 2LK2A 1MSFC 2R92J 1UHSA 2XRLA 1ENHA 2QF7A 1MBFA 4M3BA 1DU6A 1AKHA 2HOAA 3SDGA 4LOCA 1JJ6C 3BR2A 3LSPA 3JRAA 3H0GJ 5M5YJ 1IV6A 3S2HJ 1OFCX 5FKLA 3ZQIA 2WV1A 3LOCA 1BJZA 2JA6J 4BKXA 3RZOJ 1GT0C 2FJ1A 1QVTA 3G1MA 1ORKA 4CYCA 2MG4A 2Y30A 1RR7A 1PUFB 1A6IA 3HGGA 1OJLA 1B8IB 2IAIA 3TP0A 3RZDJ 3GTPJ 4JYKA 2DMTA 1G2HA 1IGNA 1A5JA 2E1OA 2ID3A 3JRHA 1IRZA 5F0CA 2HYJA 1IC8A 1RESA 2MSYA 1YRNA 2YU9J 2M0CA 3PO3J 2LFBA 1LE8A 3BQZA 4DZPA 1JUSA 1H88C 2EH3A 1JKPC 4I6ZA 3BR5A 3NARA 3GTMJ 2JN6A 2R5ZB 2LD5A 3BQYA 5J1UA 3IV5A 2ELKA 1X58A 3HKZN 5FKMA 1LFUP
chains in the Genus database with same CATH superfamily
4KMUX 1ZG1A 5B5EC 2ME0A 1ZR2A 3JCUC 4DBQA 1FWZA 1W7PD 2JQ7A 4UB8C 5LHIA 1J75A 1BC8C 3JRFA 4ZYEA 5F0HA 3KFWX 3S1NJ 5H6RA 4Y7NJ 4PSXA 1STZA 4B09A 2VI6A 3ML6A 1PDNC 4RB1A 3W6KB 2JRTA 4A93J 1K7AA 2MA3A 4BJTA 1OCOH 2ZJRF 3BJAA 2HYFA 3RJPA 2W00A 4N0BA 2L0KA 2R7QA 5FJ8J 2V1DA 2HGCA 3H36A 1MSEC 1KA8A 2O5RA 2RREA 1NTCA 3E3VA 1HF0A 2KRFA 3FK6A 2ZMEB 4EQQA 4XM3A 1Q1VA 4BQOA 4EM2A 2Y0SA 5C4JJ 1LEAA 4OIRF 2KIUA 2L9NA 3L1PA 3RYPA 2L4MA 1D1BA 3E0JB 4M73A 3OOUA 4MGRA 1ZG5A 3GLXA 1SAUA 4PK4A 2WA0A 2C6YA 1TQPA 4P1WA 3HG9A 2EV5A 1LEBA 2QLZA 3OSGA 1ULYA 2BBYA 1DQUA 2M45A 3G6EI 1R49A 3D5SC 1DUXC 4WXCA 1BR2A 3E97A 3K1PA 1V5FA 5ILVA 4WXDA 2WAFA 4XSZF 4M9ZA 3LQRA 1H9TA 4GXOA 1IDYA 1S9HA 3J7ZI 4IO9F 3GTKJ 2QM3A 4L9JA 5HS8A 4E7KA 5L3DA 1GXQA 4UUSA 4G9YA 3V7SA 1FJLA 2OCEA 1KQ8A 2ZFUA 3OR1C 1XPXA 1WHUA 3HPGA 4OINF 3ROUA 4HYEA 3UNGC 5FGMA 2IGOA 2L54A 5EJCA 4CZZA 3HTUA 2HFHA 3BG3A 1EH6A 5HOOA 2Y9ZA 2QZ8A 3S16J 3KZZA 3PUBA 4LB6B 3CJRB 2H09A 3BROA 2MD5A 4HX7A 2HKXA 4TV7A 1WCMJ 1HXDA 2LDUA 2O6GE 1UB9A 3TDUC 2N8GA 3HEFA 3CC2I 2IGKA 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 4FASD 1OLTA 2AO9A 2CSOA 1LB2A 1TW3A 3GF2A 1WI3A 2LKPA 2VKDA 1MMNA 5E1WA 3DKWA 2QKLB 4EMSA 1Q1HA 3FXJA 4B1RA 3IH4A 1T98A 4XONA 3MKYB 1Z3YA 3U9GA 3RI4A 3W6VA 2ZO4A 4ETSA 4BACA 4D5CA 2DTRA 4XOPA 3KP4A 3JSOA 4HNTA 1RIOH 2M30A 2F2EA 3LSRA 1TNSA 2CH0A 3X2QH 4I02A 2NXNB 4A3GJ 5IOYA 3CF5F 1R22A 4P55A 1S7AA 3K1MA 4LITA 4L5EA 3O8GA 3K0LA 3RKXA 1JKRC 1XSXA 1NG6A 1LFBA 1ZGAA 2CRGA 2ZCWA 5ICGA 1FIPA 4U0YA 2JWTA 3EETA 3BTJA 2CUFA 2Y69H 2KJBA 1WZ2A 1OPCA 1HDPA 1WWXA 4BU2A 1UCRA 3HOTA 3BT9A 3DU5A 3KYDB 5K5QA 2NVQJ 3B6CA 4PFOA 5A2QZ 4FHTA 2O3FA 4IVNA 2GXAA 2Q2EB 3HXLA 4IHWA 2ECCA 2W48A 2LF7A 4G12A 2ZSIB 2ZBKA 3L00A 2ESHA 1TP4A 3CCRI 3ISPA 2XUBA 3G73A 5LEJA 3S3MA 3LSKA 4MQVA 1N75A 2VBZA 2QKMB 5HDGA 4G6TB 1Y8QB 2X6XA 4N4NB 4CH7A 5DM7F 2P0WA 4F91B 4LG0A 4I2OA 5FB2A 5HLGA 3DBLB 1FPQA 3CUQB 3DTIA 4ZYHA 2OUMA 3JREA 5JI6A 5L3BA 2LBFA 1TTYA 1B6AA 2V9VA 3LMMA 3LSGA 2X85A 3H3VK 1O57A 1SAXA 1IZ1A 5M5WJ 4Z2YA 1ZKGA 5TRDA 4IOCF 1VQLI 1BW6A 3QWLA 4NB5A 3O8HA 1LKXA 3QU3A 4B3AA 3AG2H 3PSFA 4I0AA 3J7AO 1M1EB 2CS3A 4C3IJ 3BTLA 3GTOJ 1E3HA 4DW6A 2KT0A 3DPUA 1ZR4A 1T95A 2EIJH 2WB1N 4YEJA 3FBNB 5JLXA 5J4VA 3OYHA 1ETKA 4HEA2 3ZN0A 1SMYF 1Z7UA 2AXTC 3G1OA 2DT5A 1H0MA 2K7LA 3DEUA 3B6AA 4ON0A 2OC6A 2NNNA 2XRNA 3J81Z 3OYDA 2GOXB 3TW6A 3IUOA 2NRAC 2K9SA 1SD6A 5LFAA 4IRIA 2VQCA 4O6JA 5CKTA 1ERDA 1GHCA 5D5VB 1YG2A 2FOKA 3BP8A 2BZTA 3HRTA 2E1CA 3ERED 1VQ9I 2BY1A 2CFXA 3JRGA 1JGGA 4KT5C 2PMZN 4R79A 5HNHA 1EJ9A 1O7FA 4H4KC 4UUTA 2STWA 1U5TB 3SZGA 4ENMA 2Z33A 4XR6A 1AU7A 3I4MJ 5IOZA 2RNGA 4H0EA 4LG3A 4XNFA 1JT0A 5FD5A 4M3DA 3WGGA 2ELJA 1YHQI 1TWCJ 5E1ZB 1XTAA 4CXFA 2YX7A 4CCKA 3WE3A 3CP8A 4IEJA 1LVKA 3FXOA 2IS4A 3LA2A 2CO5A 3GFIA 2M34A 5IYDJ 1O7LA 2RQQA 4I01A 2K9NA 4FETA 4CICA 5J6XA 2QCOA 2JA5J 3S1RJ 2EA4A 3OV8A 2AQEA 4A3KJ 1OCRH 1W0UA 2L7MP 3BZCA 5E8GA 1IRFA 3TGNA 1NH3A 4L9TA 2R7ZJ 2Y75A 3QP6A 4M6YA 3S93A 3S17J 3LFKA 2XIGA 2DXIA 4BQAA 1QPMA 4RM2A 1ZH5A 1XX5A 3N97A 3I3LA 2CUEA 4Y17A 1FYLA 4MFDA 3H0DA 2DA2A 2O61A 2MC4A 4XLPF 3PNVA 2JVGA 2CW0F 2OTLI 1XD7A 1B59A 3FM3A 3NWTA 1FBSA 3S8PA 3SJMA 1KQ9A 1UMQA 2A05A 4I98B 1GXPA 4L18B 4F93B 2BYVE 4I0BA 1F36A 2ZMEC 3LAJA 3CTAA 2VE8A 1BI1A 1UELB 5LLQA 1G3SA 4CSWA 2MH2A 3FIWA 3DCFA 4BHCA 2CQXA 4ESBA 4RDUA 2JMWA 3I71A 4AIKA 2KKOA 1ZYRF 3E6CC 1MMDA 3Q0WA 2VKEA 2DK5A 5IP9J 1MW7A 3EYIA 4RM3A 3BY6A 3I56I 1WJAA 2H8RA 4M9XA 3F6VA 1ZRFA 3ERMA 3A01A 5F0FA 2HXOA 2DTZA 4UHTA 4X1EA 2L3DA 2Z1DA 3Q0VA 3K4BA 3UKGA 2WAQN 3M8JA 2O03A 3I4NJ 3TBIA 2GLOA 1BOBA 1ZGJA 5HLIA 4M6VA 2M0MA 4W1UA 2G9WA 4MFEA 2RN7A 2PEXA 5M3MJ 4AIDA 4ZDOA 2D45A 2E19A 5ED4A 1LPQA 4HQMA 2ID6A 3GUDA 1HKQA 2O8KA 3CLQA 1KYZA 3MWMA 5D4SA 1S29A 3TO7A 2HOSA 2ZKZA 2PJRA 1EKEA 2FRHA 2EINH 3Q9SA 4PZJA 3CCJI 3PO2J 3FDYA 2IT0A 2Y0SN 1WH5A 2QQ9A 3GVAA 4A3JJ 2LR8A 2ISZA 3W2VA 4IQ4A 4KN7X 4XKBA 1U5TC 4E6KG 1MIJA 5D8KB 3HSEA 2H94A 5L3CA 3DLLF 2KZGA 2VPRA 3IHUA 3RKYA 4M3GA 1A31A 3U1KA 4KT6A 4NDLA 3K9TA 1MSFC 2R92J 3ABTA 2MLGA 1IUYA 3HOSA 3AFHA 4GGGA 3PSIA 1Y6IA 4P5OA 1KZHA 1X4OA 4BE1A 4M3BA 1O3QA 2XV4S 5ICFA 1IXRC 3SDGA 4HRIA 2V1NA 1R5GA 5FRNA 3CESA 3H35A 3PJRA 1Z21A 3H0GJ 3S2HJ 5FKLA 3PNTA 5KK1A 1YJ9I 1IW7F 1IN7A 2GIVA 1IXSB 4KITB 2KP6A 3J7AY 1GT0C 3GXOA 1X1AA 5CVUA 1VQKI 4RAFA 2EV6A 2F4MB 1FLIA 1CF7A 1QVTA 3G1MA 1ORKA 2L9VA 2CMPA 4IQJA 2DAOA 1XCVA 1R4NB 2GA2A 3CMMA 3IRQA 1A6IA 4HDUA 1B8IB 3OYKA 5BOXA 3TP0A 4JYKA 2A61A 2DMTA 4YFNF 3WU1B 1IGNA 2E1OA 3CJTB 2JVHA 3JRHA 4EGZA 1HW5A 1LQ1A 2TDXA 5DDGA 4MHGA 2MC3A 1DDNA 1R6RA 3JW4A 1ACIA 3DLAA 4P96A 3CC4I 4LFUA 3BDDA 1H88C 2EH3A 4JK1X 1YIJI 4I6ZA 1P4AA 4IHSA 2E5NA 2JN6A 2PG4A 3GO5A 2B9SA 2FMLA 3BQYA 2LD5A 3IV5A 2X1DA 3A1YA 2X1CA 3W3CA 2JZYA 1Z6RA 3OS0A 1LFUP 2R7SA 5F08A 1MDMB 1XGMA 2BHZA 2ELHA 1D1CA 2PJRB 3HYIA 1V5GA 1MJBA 2AS5F 3IRRA 2O9LA 2IBDA 5HDNA 3WGIA 1F9NA 3H9GA 3ZMTA 2VUMJ 3TDZC 2KPMA 4EGYA 3D5RC 3GFJA 1GVJA 2LKSA 1X1PA 3BJOA 1S3JA 2GQQA 3ZR8X 4E70A 3FBIB 5FLVA 4AWXB 4OIOF 4C3HJ 2QBYA 1VI0A 3R0JA 5IT9K 1S7OA 1FSEA 2JUCA 4HLYA 3Q3SA 3ZCOA 2TCTA 2P5KA 1JXSA 2HQRA 3DTKA 1AA7A 2VOOA 2HYGD 3GLLA 4F3QA 3MZ8A 3R61A 3FHZA 2CGPA 3K6GA 3GFLA 2XAUA 1H89C 1YW7A 2HTSA 4PCQA 1U2WA 1OYYA 1TC3C 3CDIA 3FM5A 4FX4A 4PUSA 4W97A 1YITI 2FF4A 3B73A 4S05A 2DFIA 4V2GA 4A0ZA 5E3NA 1RI7A 2YS9A 3BC8A 3C18A 2PX9A 1T08B 1R71A 2LH9A 2PQ8A 5HS7A 4ANJA 3MN2A 3PFYA 4OIPF 3JTHA 1IXCA 4KIGA 4DYCA 1B8IA 4WWCA 2HXIA 3GZ6A 5IYBJ 4PJ0C 4D9JA 3RKQA 1CF7B 4UUSB 1MNMC 4IL6C 1OQYA 3RQ4A 1LNWA 2BE5F 2ICWG 1IJWC 1C0WA 1B9NA 2DBBA 1G4DA 4F52A 4PFPA 4OAYA 4IX7A 1IF1A 2XSJC 3DF8A 1MBEA 2R7OA 4OAZA 2R5YA 3H1CA 2CWEA 4RGRA 2KZVA 4HQEA 3ZQHA 2DYRH 1W1WE 3MCZA 2E35A 4A3CJ 3QODA 2AXLA 2JA2A 3HRUA 3E6MA 4P9UA 3EDPA 1KU2A 4JX5A 1USSA 1Z7LA 2O0YA 2MFZA 3VYSB 1HKSA 2IJLA 1EH7A 4KJZA 2Q8KA 3LNQA 1EH8A 2QENA 3NAUA 4K2EA 1U78A 2R93J 2GWRA 4B3XA 3CO6C 2Z2SB 2H6CA 1GUUA 2L02A 5EYRA 2DPDA 4IKFA 4LG0B 4BE0A 1XB4A 5LHHA 4ZC3A 3OYJA 3HZJA 3T8RA 2GBYA 1Z05A 3ZMVA 1TQMA 2DW4A 1FTZA 2D1VA 5F04A 2QBYB 3DFGA 3BG6A 4A5MA 3JRDA 2L01A 2K85A 3VOEA 5E18F 4FISA 3U21A 1T0FA 4RB3C 1BC7C 2CV2A 2A6HF 3EQLF 1FT9A 1ZRDA 1DGRM 2WV0A 4HPQA 5GAGJ 3V7CA 5K5RA 2DODA 3TL4X 2HTJA 2MH9A 3A0HC 2LY1A 4XSXF 4L0ZB 3HTSB 2DA5A 3W2WA 4AVZA 2QQBA 3AAFA 4GRIA 4QPOA 4RAGA 4HNUA 5J3LA 1XMAA 5GAEJ 2HS5A 3CD6I 1BR4A 3DU6A 4CO8A 1R4MB 2EZHA 4CA0A 3W6JB 3S1MJ 3M07A 5TGTA 3JAMZ 2EZIA 4U88A 2HQ5A 4HZFA 3P9IA 3SHFA 3VODA 2EFOA 3KP6A 3LL7A 2R7RA 2LY2A 2EFNA 3BCBA 4D5FA 3AL0C 2G0EA 1B4AA 1Y8RB 3KP7A 2EA2A 3KLOA 2GA1A 2VJ5A 5F1RA 2OZUA 2IS1A 2KMUA 3MZHA 4BEHB 1BIBA 1KU3A 2V1XA 2VONA 5C4XJ 2R7WA 1ZGWA 3I59A 3KYLA 2PMUA 5CVRA 2LP0A 2BVMA 4XMYA 3GTLJ 3P7NA 1FZPB 5DTDA 5HLHA 4HAMA 1MKMA 2RDPA 2X9DA 2L9RA 2XPUA 3LFUA 3L2QA 1R23A 2IEKA 2FNAA 4IF4A 4UV8A 1YW8A 2J5OA 4BE2A 4Q5SF 2CUZA 4IJAA 3HL2A 4NUBA 3VDXA 4BHPA 3IP4B 5DEQA 2V6CA 2DA6A 5HLTA 2F5VA 1MBGA 1L3LA 3UR3C 3RPUA 3VWBA 4A0XA 1QRYA 1R58A 4HV5A 2COMA 1MMAA 2M7AA 4BJ6C 9ANTA 4XORA 3J80Z 4YIRX 5H2FC 2F5EA 5IP7J 2FMYA 3QQAA 1BA5A 1OISA 2M2EA 4HDVA 3WG9A 2OF7A 2JTVA 3P9CA 4LJZF 2GAUA 2QSFX 5LGUA 4ASNA 1BI2A 1I3AA 1A36A 2FX0A 2H1LA 4Z6YA 4D1QA 4XN0A 3Q9VA 4FQGA 4RGSA 3WTUC 4AIJA 1IN6A 1R1VA 3AG4H 3QU6A 3C2BA 4IHYA 3E1SA 4U7BA 2M5WA 1JUMA 1N25A 5GAHJ 5IPAA 4S04A 2A5WA 4BGDA 3GEZA 1IN4A 5D4RA 3L2VA 2M4KA 1YFHA 4IHXA 3MKLA 3GYHX 2WADA 1QZEA 4UXNA 2FU4A 1BOAA 1QHGA 1FIAA 3OL4A 5CQEA 4Y15A 3B02A 4BXUA 2JT1A 1ITYA 3K2ZA 1YX3A 4OWRB 3G2BA 1E2XA 4MNUA 2QSHX 3RSNA 2WAEA 3COAC 2KISA 2E2JJ 1TWFJ 3QYEA 2MBFA 2XAHA 3CCMI 1JTXA 3C2HA 4II2A 2VE9A 3MAJA 2D2WA 4M71A 5LRRA 1ZELA 3EUHA 3OYLA 1XN7A 4G6DA 5GADJ 2HOTA 4M74A 1V54H 1TBXA 2E2HJ 4QTRA 1YLFA 1FMWA 3A02A 1I39A 3WTSC 3S1QJ 2HDWA 1XDSA 3L09A 2NVYJ 2PJPA 3JRIA 4RGXA 3VPRA 2IA0A 4LIUA 1T6SA 1WKMA 3K1NA 4XRSA 1HA8A 5CPRB 4AVPA 2DFFA 1QU3A 2ESNA 4IXAA 4DZJA 3ZQQA 1U3EM 4M72A 4WF2A 5GP9A 3OYGA 3FHNA 3S32A 4FCYA 4YELA 2PBIA 3RPQA 1X3ZB 3HSFA 2STTA 2EJRA 3FXUA 3FMSA 5BNGA 2QA4I 2IGMA 2KL4A 4AYBA 4E7HA 2B7EA 1BI0A 1MJ9A 1OCZH 1S72I 5IT9Z 2VIXA 3M8EA 2DMUA 1BM9A 3AG3H 4KN4X 4XLEA 5K7ZA 3MQ0A 2XAFA 3IH3A 4PJJA 4BBRJ 4XIDA 4XK4A 2G7UA 1FYMA 5E17F 3MMYB 5E3OA 2R7TA 5GTIC 2R7VA 2XGCA 3KIOA 4B43A 4DGWB 4A3DJ 4EV0A 1FBUA 4RGUA 3U1DA 1UAAA 4N4OB 1XGNA 1VZ0A 4EJTA 2R7UA 1RC9A 2L2OA 1W7PB 2HOEA 3TP3A 2NVUB 4Y52J 4XOTA 2AQFA 4RA2A 5E79C 5BMZA 4C9YA 3LSJA 3T8TA 4E7ZA 4CYCB 2E34A 4BY1J 5DS9A 1R5HA 2CQKA 1WJEA 3H3ZA 4LB5A 1Y0NA 3BG9A 1F4KA 1P4WA 2EWNA 2E1NA 2EB7A 1QPIA 1MD0A 3ESWB 3L2RA 2GOMA 1S7EA 4C2TA 1SFEA 5GPCA 1VFCA 3CUQA 2ZXJA 1S8NA 3HDDA 3WE2A 4D7MA 3I64A 2JRMA 2V7FA 2GIZA 1WH7A 1IN5A 1X2NA 2A6TA 2P6SA 2IXSA 1KONA 3SZPA 1R1UA 4A3FJ 5F6FA 2UXXA 5F27A 1FYKA 1EA3A 3M8FA 3K7AJ 5CYVA 3F3XA 2F4IA 4IRGA 4ZDLA 3K4KA 4M9SA 5J40A 1WJBA 3KX2A 3AKZA 3KZIC 1IRXA 1P9QC 3GMEA 1Z77A 5J1YA 3WU0A 2LK2A 3QYFA 1PVEA 1UHSA 2XRLA 1ENHA 1YS7A 3TOBA 2V79A 4KIBA 1XCBA 1DU6A 2HOAA 4NC7A 1X1CA 3WTZA 4J00A 4LOCA 2DPUA 3LSPA 2VJJA 1FOKA 1D0YA 1TT5B 3ZQIA 2WV1A 1BJZA 4BKXA 2DCEA 2QWWA 2WBMA 2VN2A 3KP3A 3T0YA 4HSTA 4CHUA 1ON1A 1SC7A 1YE9A 1KU7A 2Z16A 3FXLA 2MG4A 2Y30A 1RR7A 2IA2A 4DOZA 3L2WA 1DP7P 5KNLA 4OIQF 1I1SA 1HSTA 3GTPJ 2P7VB 1E0EA 5E8IA 4LLLA 4XLFA 5EEGA 1B9MA 4Q48A 5F0CA 1IC8A 1LDDA 1YRNA 1O3RA 2D1HA 2LFBA 1JUSA 4WK8F 4RB0A 3DPTA 3FMRA 4CDGA 1XGSA 4XKWA 3CUQC 2DYSH 3OIQA 5J1UA 3BPXA 1IV8A 5CJ9A 4CGZA 1D5VA 1ZAOA 4I7HA 2DA1A 2F5DA 4GFBA 4O5VA 2KRCA 4U0WA 3ZQLA 1RR8C 3BR1A 3CQZJ 3VEPA 2IGNA 3ABKH 3KP5A 2LY9A 1VQ5I 2F6CA 2LKXA 3MKWB 3ZMDA 4E4HA 1ETXA 1IDZA 3IKTA 4Q47A 3I4PA 1YO5C 2LG4A 1KGSA 4Y3OA 5BPDA 2P81A 2HPMA 1UFMA 2CQQA 4G8XA 4U0VA 3TOAA 1IUFA 3EUHC 3JSPA 2BY0A 2Q2EA 3H3UA 2XC7A 2EIMH 4LMYA 5HVQC 5JR3A 5TJJA 2DDBA 2OD5A 1UJ8A 1XG1A 5D5UB 1SFXA 3F8BA 5LBQA 2LOOA 1SANA 5BPIA 2KLOA 4R8HA 1G3TA 2WC2A 5E1XA 3EYYA 5E3LA 1B1BA 4I09A 4KISA 2H6BA 2K5CA 1WGXA 2Z3YA 2JPBA 5KCMA 3VYTB 2P5LC 3PUFA 1VQMI 1U8BA 2BXZA 1AKHB 3FXRA 3ONQA 1YJNI 1DPUA 4MO7A 3ULQB 1HSJA 3FXKA 1NHAA 2JPCA 3OIOA 5DD8A 3CDHA 2ZC2A 4XLAA 1SD4A 5L3EA 3H5AA 2FOWA 4JP0A 1GLNA 4HA8A 4B48A 3IWZA 5EGOA 4F55A 1HW2A 3GTJJ 2OQRA 4ZYAA 1LJ9A 1HBXG 3FWEA 2O8XA 3O2PE 3A01B 1ZQ3P 4HG2A 4UUVA 5AIQA 2VXZA 3BR0A 3FXQA 1RETA 2NNYA 3CC7I 3AG1H 3K70C 2LVSA 1ZG3A 4LGWA 1LE8B 1OR7C 3FXMA 4BBSJ 4EJOA 1GDTA 2L4AA 2Z99A 3EUAA 3HOVJ 1BR1A 3CCYA 4MTEA 3VSKA 5FD6A 5LGNA 3SYTA 2M1BA 4E7JA 4CYDA 2IPQX 1TLHB 2M8GX 3DXJF 2ZXHA 1IAWA 1D5YA 1FBQA 4YIIA 3M1CA 2DLLA 1G59A 3E6BA 1Z91A 5B3SH 4X6AJ 3BTIA 1U0JA 2F5CA 3CMAI 1FOYA 4P9FA 2R4GA 2X51A 4IHTA 2EBIA 2BXYA 1VQ8I 5FKKA 3ZMSA 3V8KA 3J7YJ 2EPFA 3KETA 5TISC 2K9LA 1MBJA 2E36A 1U5TA 5EF6A 2XAJA 4ENJA 1RRJA 4UVCA 1MH3A 4QWQA 3HOUJ 3EUKL 4BYYA 3F8MA 3M7GA 2DMNA 4MEXF 5LD2C 2XF6A 1Y1WJ 3DTEA 1EV7A 2BVLA 2L9SA 3CDLA 2VB6A 4AIHA 3HOXJ 2LLKA 1K79A 2VJIA 4MEYF 5DV5A 1BL0A 2JA8J 2K40A 1Y56A 3D5LA 3F0CA 3K4CA 2FXAA 4V19K 1U8RA 2A69F 1RKTA 4G7HF 2MW8A 2LMDA 1RUOA 3E7LA 5D5WB 1G3WA 2LRDA 1I5ZA 4EEFG 2B63J 2E60A 1YS6A 2P4WA 2EILH 1HDDC 3GTGJ 5DUKA 3ZPLA 5EG0A 3CCEI 4HF0A 3L9FA 3R6SA 3HIFA 2R5ZA 2V4JC 4ESJA 2LSOA 3IAM2 1YOVB 1ZARA 1V4RA 4YG2F 1HOMA 3BWGA 3RCOA 1J0RA 2JJ7A 2XSDC 1DGWY 3IKVA 1XS9A 4KIFA 2COBA 1F1ZA 1V5EA 2RAEA 1BIAA 4YRVA 4QIWN 2L7ZA 3OYNA 1NK2P 2ZNZA 2HVQA 5CQGA 5ICCA 1GVDA 1TQIA 3M3YJ 2Y2ZA 3IC7A 2NS8A 2R3SA 3D1NI 2DN0A 3I54A 2DA4A 3HJEA 5HDKA 4FTHA 1AOYA 2Z9OA 3G3ZA 3OIPA 3F6OA 3HGYA 4HOBA 1VF9A 3DEWA 3V42A 3HSRA 1J5YA 4ZJZA 5EDNA 4RS8A 2X1EA 4DNCA 2WY8Q 5KAIC 1WFXA 1G6NA 2PMHA 1W36C 2BEOA 1AHDP 3PM1A 4Y13A 3LA3A 1PUFA 3M9AA 5D8LB 3HM5A 3E5UA 3P5JA 1VTNC 1IN8A 4D0PA 2ACJA 1DP3A 3BG7A 2XKOA 3I9V2 4PSWA 5JHFA 5EZHA 2R0QC 1Y1VJ 5K7FA 2I5UA 4G7ZF 2VQHA 2NVXJ 2KHMA 5B1AH 4A2UA 5BQTA 2GM4A 3F9KA 1D1AA 2MD0A 1WJ5A 2NS0A 1J2XA 3S3OA 2VL8A 4BXXJ 2E1MC 2K4JA 3DQVC 1P7JA 3DP7A 1JHHA 2PN6A 1MNEA 4IOAF 2BW3B 3F21A 3LSMA 1QHHD 3F8CA 3KEQA 2R7FA 2CFOA 2HR3A 2K4BA 2YR2A 3BR3A 3HBLA 4HX4A 3JTGA 2JA7J 1WJDA 1ZLJA 1JTYA 5EGOB 3Q5FA 1E3OC 1R7JA 1I27A 4CCLA 2R7XA 3PQJA 5JHUA 1B72A 2BGCA 4U7DA 1I1GA 4KUMA 4WCGA 5EZGA 2BY2A 3I58A 1XMXA 3TO6A 2W4SA 3BPVA 4A12A 2XPWA 3PIOF 1TL8A 3ZQCA 5HNFA 3VYUB 1T56A 3N4MA 4ZTFA 5J4YA 1JKOC 3WTTC 4DJAA 4B8XA 2ECBA 5FLMJ 4G7OF 4C2UA 1QBJA 4F92B 1R36A 2HQNA 1RNLA 3E5QA 2EZKA 2VASA 4A69C 3K10A 3K70D 1X2MA 1YQAA 4ITVA 2HVSA 5CLSA 1W5TA 1YX5A 1UG0A 4FE4A 1FTTA 2DA3A 3H9JA 3VB2A 1N77A 4ZZLA 1SVLA 4CCMA 2DA7A 4NNJA 3W2AA 1P92A 5FRMA 2WY7Q 2VLAA 2DFHA 4C2MJ 2P8TA 4E7SA 1Y0UA 2ZB9A 1JKQC 1KYWA 2P5VA 2W1OA 3S2DJ 3I5UA 1NK3P 4KFCA 3SQNA 2VJ4A 3FKIJ 1LVAA 5B66C 3KZYA 2QEXI 3WTVC 2CUJA 2EFQA 3JRCA 3ABUA 2E7XA 4BUPA 3CCLI 3V8JA 2VKVA 3VYRB 3OWTA 2W82A 3NRVA 3GX4X 3QOEA 5K5OA 4RMNA 2PMZA 4PJNA 5D5XB 2OAZA 3LA7A 3OYEA 1E3PA 2VBXA 5AONA 4AUXA 1GV2A 2JUGA 2HEOA 1SVOA 2DOEA 3BZ6A 2ZSHB 4I76A 1O3SA 3QYBA 5H20A 4KICA 1RUNA 1D8JA 4KYWA 3QPHA 4LLGF 3F72A 2DQLA 4PJLA 3KE2A 3HC7A 4BJ5C 4MIMA 1HQCA 3ZMZA 5JVGF 1DU0A 3QPSA 4PGGA 2CU7A 1TWGJ 1FY7A 2YX4A 4O3MA 2HZDA 3FF5A 3S2WA 3SFIA 5J8FA 1ZREA 1YYVA 4LLNA 4XL9A 1T2KA 1VQNI 3Q0UA 2D5VA 4V2FA 3DPLC 3FK7A 2ME6A 1MNDA 2UV1A 4GYIA 2LTPA 3MVPA 3V7RA 3TW7A 2YU3A 5EEHA 3WU2C 1KU9A 2QVOA 2X6WA 2TRTA 2X6YA 5ERIA 3RDIA 3HHHA 3HOZJ 2RQPA 1BW5A 3GCMA 2OBPA 2QQ8A 4DBRA 5C3EJ 3ECOA 4JQFA 4RLQA 5JVTA 3EPZA 4JOMA 2DFEA 4A5NA 4HF1A 1OYIA 3CMYA 2IA1A 2RKHA 2DU9A 5E20A 2EQRA 1SD5A 2M8EA 2XGXA 2VKHA 4D7NA 3V4GA 2HNHA 3J80K 3HOWJ 1K83J 2K9QA 1PYVA 2XGDA 2F4OB 5F1JA 2VT3A 4E7IA 2L7FP 3CZ6A 2QUFA 3O3KA 3MKZA 2CG4A 1MBFA 1T39A 1AKHA 4IRHA 3WODF 4MTDA 1K4SA 1SFUA 2XHKA 1A35A 1P6RA 1OCCH 4L0YB 4A0YA 2E7WA 1JJ6C 4DQ2A 2WAQA 2DK8A 3JRAA 5M5YJ 3REOA 2K3FA 1OFCX 3NWSA 2XROA 3L2UA 3PL8A 4QPQA 2VC1A 1ON2A 4UY8I 3LOCA 4HBLA 4XN3A 5CVJA 4GO1A 2XAGA 2UZKA 4L5IA 2A5YB 3K4LA 2M7BA 1P4XA 4CCJA 3CCSI 4ESFA 2FJ1A 1YIOA 4NC8A 4U87A 3ELKA 3ASOH 4CYCA 1H9GA 1WQ2A 4M6XA 1MGTA 2V1UA 1PUFB 1ZN2A 4F7ZA 2VBWA 2KJCA 2IAIA 5FFZA 3RZDJ 3AL0B 1A5JA 4II3A 2ID3A 3KPHA 1KQ0A 4A6EA 1IRZA 1SFKA 6PAXA 2HYJA 1RESA 2MSYA 2YU9J 5A2QK 3ZRGA 1VQPI 3ZMUA 3RKWA 4WXHA 3U2RA 4EJVA 2FEZA 4LK0F 1HC8A 5L3GA 3GTMJ 2Q0OA 3CLOA 1JI8A 1JHFA 3T1BA 3K69A 3K4NA 2W7NA 1FOXA 3DEEA 1X58A 3HKZN 2HVRA 1TZLA 5FKMA 1VNDA 2FQ4A 1QZYA 2X4HA 1J9IA 3LSIA 2QYOA 3GWZA 3QRFF 4S0HB 4BH9A 3VSLA 1HLVA 4RAZA 3S14J 2VQLA 4C30A 1ZK8A 1JJ8C 1B72B 4WX9A 1F5TA 2W25A 1X19A 3ZQGA 2J5PA 4A3BJ 2LBFB 1H8AC 1FP2A 2DDAA 2OU2A 3QPTA 2H1KA 3HB9A 2PI0A 3JR9A 3RIRA 2DT6A 2OV7A 2MGQA 1SD7A 2LF8A 2A07F 1XDUA 4BDZA 2ZMEA 3H5NA 2FBHA 3OS2A 2DOFA 4RBOA 3TQNA 3C7JA 3BCAA 1ETYA 4AU7A 4DYRA 4EM0B 1SVMA 4KA4A 1FEXA 2I8DA 2M9HA 1ZLKA 4CCOA 4CZCA 2K9MA 4ZDPA 1UZCA 1PP8F 3TO9A 3FISA 4J01A 3NEUA 5DCMA 1U9NA 4BNCA 5ILUA 2M4GA 2OQGA 1P7IA 1K61A 1I6HJ 3M4OJ 2CW8A 2M87A 1Z0XA 2OPTA 1YJWI 3F8NA 3CP2A 2YUSA 3A2KA 1JGSA 4XBFA 3LSHA 4CUGA 4X0GA 3CMEI 2NS7A 1OCPA 2V6EA 1YRNB 1USTA 1S5LC 4NQWA 2RNJA 2GXGA 4EM1A 4UV9A 4XRSG 4BXFA 2R5YB 1X3WB 1TW2A 4N9HA 3S3NA 4XLNF 4YIFA 1L0OC 4YFXF 4EJUA 2E2IJ 3H92A 4M3EA 1J59A 4FT8A 1JE8A 4IZZA 3CO7C 3WHCA 3MZYA 1FP1D 2VC0A 4XRFA 2KQRA 1BBYA 1LDKB 2CYYA 1TT0A 4R1HA 5CVIA 3SZTA 4B44A 2ADUA 4BY7J 1ZRCA 4XRMA 3QP5A 1D8KA 2QQAA 2W85A 1ETQA 2CW7A 3HKZA 2XVCA 1YW9A 3J81K 4NBQA 4XKVA 1N78A 4J19A 3C3WA 1NG7A 4CCNA 1LUJB 4ZYGA 1QO0D 3K4JA 1UHWA 4KMFA 5KHDA 3SFZA 2A3SA 2CV0A 1TWAJ 2XASA 3GZNB 1R5ID 1OCTC 2CJJA 3QPLA 2ZFWA 1UG2A 3CCUI 1EF4A 4OOIA 2XF5A 1OMIA 3HRMA 2P7CB 3S15J 1PJRA 3KLNA 2E5ZA 5JLWA 4B47A 2A6EF 1JUPA 3OYBA 2KFDA 1SFOJ 4JX4A 4BHBA 4YFKF 2IW5A 4ENKA 3ASNH 3PFIA 2HU9A 3CJNA 2LC2A 3LSTA 2HQAA 3WHBA 2VXDA 4UNOA 4RB2C 1AWCA 1QGPA 2EZLA 4IPAA 5J1RA 3BR6A 2A68F 5K7HA 4N9IA 1ETWA 5J8CA 2Y9YA 2X6OA 5FKNA 1T38A 2VBYA 4RLFA 3OYFA 3HUGA 3WTXC 1PP7U 3L7WA 3LWFA 1HCRA 3DWLE 3KCCA 1MBHA 1Z1DA 4UVBA 1WRJA 3QAHA 1WPKA 2P6TA 3MEXA 3E6DA 1F43A 3OYAA 1W5SA 1QVUA 4HV6A 2X48A 4BQQA 2DJIA 2E71A 4Y33A 1W0TA 2PFBA 5ICEA 1HKTA 1QNTA 2FNPA 4BQNA 1IRGA 4MQ9F 1IO2A 1XC5A 2BV6A 4BAYA 2FBKA 3K4MA 5HODA 1X1BA 5EG0B 5M5XJ 2IS2A 2EFPA 1OYWA 3WTYC 3OYIA 3H5RA 3OR2C 5E3MA 1MJAA 1W7PA 3OY9A 3R60A 4PJMA 4MLOA 2KIFA 2R7DA 2RVCA 2XDVA 3A0BC 2IVMA 4XLCA 5J47A 2EFWA 1T0FC 1WJCA 1X4PA 2V9PA 3OSFA 1D0XA 1V3FA 2H8WA 3WTWC 2DI3A 2VODA 1APLC 1BI3A 3T5XA 2BW3A 4UVAA 3KEOA 3G4SI 3TMOA 5AIPA 3BG5A 3ZQFA 3KP2A 3OMYA 3CJQB 2NOGA 3I0TA 4OMYA 4ABZA 1J09A 4GDFA 2MYSA 4EVIA 2K3PA 3R0AA 1ZTRA 2DT7B 4HLXA 2V26A 1TNTA 1W5CC 3H9QA 3L2CA 2W57A 3RQIA 3BTCA 1LFPA 5D6FA 5DUIA 1V55H 2MABA 1ETVA 5IT3A 4OMZA 3G71I 2LREA 4GYGA 3SDBA 3LQQA 4A6DA 3GFMA 4PDKA 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 3HOYJ 3CCVI 1WVRA 2ISYA 1MMSA 5KAFC 2QSGX 2BHYA 3ZP5A 2CQ7A 2HI3A 3RYRA 1I50J 4BEHA 1PUEE 4BL0B 1U6GA 1D3YA 2L7KA 2HDDA 3P9KA 2KDZA 3C2GA 5IP6A 5FLXK 3CUOA 3KYCB 3JAMK 1I3QJ 2QGUA 2IS6A 1G3YA 1ZHFA 2K27A 2WTEA 3ZOBA 3MD2A 5CVVA 4QSHA 4EJWA 2RV8A 4QLCU 2DJNA 2B0LA 3PIPF 2KDOA 5H6QA 5C44J 1T33A 2HWVA 4HX8A 3F23A 3SEZA 3FKJA 3R4KA 3I55I 4ZYDA 1FOWA 3CF2A 1HW1A 5KVRA 1LDJA 5DCMB 2DMPA 3IH2A 4M3FA 5L3FA 4JX6A 3DBRB 3OOPA 2BOLA 1P2FA 3M1EA 4JBAA 3E5XA 4B4CA 3FZVA 3TEDA 2ZNYA 3SEQA 1MBKA 1Z9CA 1VQ6I 4XQFA 2Y48A 4AD9A 2FUG2 2XAQA 1MDMA 3VFZA 1T8IA 1OR7A 2LNBA 4RAYA 1FX7A 4L9NA 3JRBA 2HPIA 5FLXZ 1A6QA 3F22A 4XLHA 1VQ7I 3ABMH 3GBGA 4NQWB 3BOQA 2K02A 3RTRA 1RZ4A 4C3JJ 1ETOA 1RPWA 1Z3XA 1O4XA 1O3TA 5DM6F 4HNVA 4FE7A 3A4CA 1WI9A 4HW0A 5FFXA 1YTYA 1S6LA 1Z67A 4HSRA 4E7LA 4A3LJ 3F8FA 1UHMA 4FX0A 2XPVA 4NC6A 1I6XA 2KIQA 2OA4A 2DMQA 2GXBA 3BJ6A 5FKOA 2CQNA 3OYMA 2ETHA 5IYCJ 3HUGB 2XB0X 3IWFA 1GV5A 2H27A 1POGA 5LHGA 4BS9A 2Z5UA 4XICA 2HZTA 1R1TA 4A3IJ 3ZXSA 2E1MB 5EEAA 4A3MJ 2IRFG 2VPLA 2ZJ2A 2Y31A 5LGTA 4Q4ZF 2OJED 2EIKH 4LIVA 4DYQA 2NYXA 5M3FJ 1SEUA 3G1LA 1K6YA 4EATA 1Y39A 3K2AA 1W36D 2Y0MA 2OTJI 4PGHA 2ZJPF 4IHVA 2LYCA 3A03A 3BLYA 2JSPA 2EK5A 1K4TA 2FSWA 3PNYA 1TWHJ 1IG7A 2HDCA 2UWMA 4ENNA 3DKYA 1QA6A 4ZZDA 3ZN1A 4ZH4F 4A3EJ 2WB1A 2KIMA 3C1DA 2NVTJ 4G6QA 3GW2A 1K78A 1W4MA 3GZ5A 1G8XA 2V9KA 1XSVA 5GPAA 3ZGKA 2FD5A 1DPRA 5FO5A 2OZ6A 2O7OA 5GTHC 4OU0A 2L5QA 2ZJQF 2X0LA 2VT2A 2KRHA 4LK1F 1RKWA 4GCVA 2JK3A 2JSCA 1BN5A 2I10A 1X1DA 3ECHA 2XB5A 3HHGA 1XSDA 1MMGA 2F48A 2XGEA 3V8LA 3OS1A 3ZQ7A 5LEKA 1JT6A 1U9OA 4Y4RA 5IY5H 2AHQA 2UXNA 3FX3A 4KNYA 1X3UA 3I59B 1CGPA 2FBIA 3N05A 1QQIA 4AYBN 3TKYA 2YPRA 3ABLH 2ZXWH 1WJFA 3DBHB 3IL2A 4XKCA 4G94A 1YI2I 1R9TJ 3CCQI 1E17A 3GTQJ 2DQRA 1R00A 5D6EA 2W84A 1MZBA 1SMTA 1FC3A 1WSUA 1A04A 4AC0A 4AM3A 2NAZA 1FMVA 1VQOI 2HKOA 2Q1ZB 2IP2A 1Z6TA 2ZXIA 3IAS2 3LAPA 1MH4A 1CQTA 2OCCH 3WG7H 3PQKA 2GZWA 3KEYA 2G7HA 5DD4A 3HPHA 2FA5A 3OL3A 2QF7A 2WWYA 3RPUD 4HF2A 5DYMA 4UB6C 1J7KA 2XKPA 3O6BB 2BY3A 3BR2A 3OYCA 4BDYA 1IV6A 4LD5A 2DOAA 2RC4A 2EV0A 1D0ZA 1FNNA 2JA6J 5LRSA 2W24A 4L9VA 2PLYA 3RZOJ 2VOPA 3SXYA 3WGHA 5K1YA 3DV8A 2FE3A 5B1BH 2NOJB 2M3AA 3DKXA 3HGGA 4L5JA 1OKRA 1OJLA 2DO7A 3MFKA 5JFRA 3BZKA 4KDPA 1G2HA 1QZZA 1XGOA 2VQGA 4I99C 5DCFA 5ILSA 1BJAA 1K6OA 2M0CA 2CV1A 3PO3J 2YSRA 5F64A 1LE8A 3BQZA 5FROA 4DZPA 1VQ4I 1JKPC 2UUZA 3BR5A 5HS9A 3NARA 1ONVA 2F5FA 2XF7A 2R5ZB 2RGVA 1ODDA 1K78B 5BS6A 2ELKA 4ZTJA 4NHJA 1REPC 4DIQA 3HRSA
chains in the Genus database with same CATH topology
1VNDA 5F08A 2DA1A 2FQ4A 4GFBA 3ZQLA 3BR1A 2ME0A 3CQZJ 1ZR2A 2LY9A 2LKXA 1IDZA 1ETXA 4S0HB 3JRFA 5F0HA 2O9LA 2IBDA 3S1NJ 4Y7NJ 1HLVA 3S14J 2P81A 1ZK8A 1JJ8C 1B72B 2CQQA 2VI6A 3ZQGA 2VUMJ 4A3BJ 1H8AC 1IUFA 4A93J 5FLVA 4C3HJ 1VI0A 2H1KA 3HB9A 3JR9A 2MGQA 2L0KA 5FJ8J 1MSEC 3Q3SA 1NTCA 1XG1A 2TCTA 1HF0A 4RBOA 1ETYA 3FK6A 4DYRA 1SANA 1FEXA 2M9HA 1Q1VA 5E3LA 1H89C 1WGXA 5C4JJ 3FISA 1U8BA 1TC3C 1U9NA 1P7IA 1AKHB 1K61A 4W97A 1I6HJ 4MO7A 3L1PA 3M4OJ 4V2GA 3OIOA 5E3NA 1Z0XA 2OPTA 2YS9A 3OOUA 2YUSA 2NS7A 1OCPA 4JP0A 1YRNB 3OSGA 5EGOA 3MN2A 4XRSG 2R5YB 4DYCA 3GTJJ 1B8IA 2HXIA 2E2IJ 1IDYA 5IYBJ 3A01B 3RKQA 4M3EA 4UUSB 1ZQ3P 1MNMC 3GTKJ 3BR0A 3WHCA 1IJWC 1RETA 4UUSA 4BY7J 1FJLA 4XRMA 2LVSA 1LE8B 1ETQA 4BBSJ 1GDTA 4J19A 1MBEA 2R5YA 3BG3A 3S16J 2Y9ZA 3HOVJ 3ZQHA 3CCYA 4A3CJ 1TWAJ 1OCTC 2CJJA 3QPLA 2M8GX 4JX5A 1UG2A 1D5YA 1EF4A 1WCMJ 3S15J 4X6AJ 3BTIA 2N8GA 5JLWA 1JUPA 3HEFA 3LNQA 4JX4A 1SFOJ 1U78A 2EBIA 3NAUA 2R93J 5FKKA 3WHBA 1GUUA 5EYRA 1MBJA 2AO9A 5EF6A 1MH3A 1WI3A 2EZLA 3HOUJ 5J1RA 3BR6A 5K7HA 1ETWA 2Y9YA 2X6OA 2DMNA 5FKNA 4B1RA 3IH4A 1Y1WJ 2GBYA 1HCRA 3CDLA 1FTZA 3W6VA 5F04A 1MBHA 3HOXJ 2LLKA 4D5CA 1WPKA 3JRDA 1BL0A 2JA8J 1F43A 2K40A 4FISA 3LSRA 1QVUA 2X48A 1W0TA 3F0CA 4A3GJ 5IOYA 1RKTA 2MW8A 1XC5A 4L5EA 3O8GA 3E7LA 1JKRC 5HODA 5EG0B 5M5XJ 2B63J 4EEFG 1LFBA 2DA5A 1HDDC 2CRGA 3GTGJ 5E3MA 1FIPA 5EG0A 2JWTA 4MLOA 3BTJA 2R5ZA 2CUFA 5J3LA 1HOMA 3OSFA 1HDPA 1APLC 2JJ7A 2XSDC 3BT9A 2NVQJ 3B6CA 2EZHA 4IHWA 1XS9A 2COBA 2ECCA 2W48A 3BG5A 3ZQFA 3S1MJ 2NOGA 2EZIA 4G12A 2HQ5A 4ABZA 2RAEA 4QIWN 2L7ZA 1NK2P 4D5FA 1ZTRA 2G0EA 1GVDA 3M3YJ 2Y2ZA 2NS8A 3RQIA 3D1NI 3BTCA 2DN0A 2DA4A 4FTHA 3HGYA 1VF9A 3DEWA 5C4XJ 1ETVA 1ZGWA 5EDNA 2LP0A 3GTLJ 3JREA 5DTDA 2X9DA 2L9RA 2XPUA 3HOYJ 1AHDP 2IEKA 3LSGA 3PM1A 3H3VK 5M5WJ 1PUFA 3HM5A 1ZKGA 1BW6A 2HI3A 2DA6A 3O8HA 1I50J 1MBGA 4B3AA 5EZHA 4C3IJ 2HDDA 3BTLA 1QRYA 1Y1VJ 5K7FA 2KDZA 2R0QC 3GTOJ 4DW6A 2NVXJ 2KT0A 5IP6A 1ZR4A 2WB1N 2GM4A 9ANTA 5JLXA 1I3QJ 1ETKA 3G1OA 4BXXJ 3ZOBA 1P7JA 4QSHA 5IP7J 3B6AA 3QQAA 1BA5A 2M2EA 2DJNA 2OF7A 5C44J 1T33A 3TW6A 3BR3A 3HBLA 2K9SA 2JA7J 2FX0A 1JTYA 5EGOB 1E3OC 2DMPA 3IH2A 4M3FA 4JX6A 3C2BA 1B72A 4IHYA 1JUMA 5IPAA 4B4CA 3JRGA 1JGGA 4IHXA 5EZGA 3MKLA 3TEDA 2PMZN 1MBKA 4UUTA 2XPWA 3ZQCA 1FIAA 1AU7A 1ITYA 1T56A 3I4MJ 5IOZA 1JKOC 1JT0A 2ECBA 4M3DA 3JRBA 5FLMJ 2E2JJ 1TWFJ 3GBGA 1TWCJ 2EZKA 1JTXA 4C3JJ 1ETOA 4A69C 1RPWA 1O4XA 2HOTA 1X2MA 4HNVA 4FE7A 2E2HJ 4IEJA 4FE4A 4QTRA 1FTTA 3A02A 3S1QJ 2DA3A 4A3LJ 2DA7A 2M34A 2NVYJ 5IYDJ 3JRIA 2XPVA 3VPRA 2K9NA 2DMQA 4C2MJ 5FKOA 4XRSA 2QCOA 2JA5J 5IYCJ 3S1RJ 2XB0X 2ZB9A 4DZJA 4A3KJ 1JKQC 1W0UA 2L7MP 5GP9A 3S2DJ 2R7ZJ 1NK3P 1GV5A 4FCYA 3FKIJ 1POGA 3S17J 4XICA 3JRCA 4A3IJ 4A3MJ 5EEAA 2CUEA 5BNGA 2VKVA 2Y31A 4MFDA 2DA2A 2DMUA 5K7ZA 5M3FJ 4DYQA 3IH3A 4BBRJ 4XIDA 3G1LA 4XK4A 3K2AA 3SJMA 1UMQA 4IHVA 3A03A 1GV2A 4AUXA 5E3OA 1F36A 2XGCA 4I76A 4A3DJ 1TWHJ 1IG7A 3FIWA 3DCFA 2CQXA 4RDUA 2JMWA 3Q0WA 4A3EJ 3TP3A 2NVTJ 2VKEA 4Y52J 5IP9J 5GPAA 3LSJA 4CYCB 4MIMA 2FD5A 4BY1J 2O7OA 5DS9A 1DU0A 2H8RA 3QPSA 2CU7A 1TWGJ 5F0FA 3A01A 2HXOA 2DTZA 3UKGA 4X1EA 3Q0VA 3BG9A 1RKWA 2JK3A 1QPIA 2WAQN 3SFIA 3I4NJ 2I10A 2GLOA 4M6VA 2XB5A 1S7EA 3Q0UA 4V2FA 4W1UA 2D5VA 2XGEA 4MFEA 3FK7A 2ME6A 5M3MJ 2LTPA 1JT6A 5GPCA 1U9OA 3MVPA 3TW7A 1VFCA 2E19A 2AHQA 3HDDA 4D7MA 2ID6A 2TRTA 1WH7A 4AYBN 2O8KA 3HOZJ 1BW5A 1X2NA 5C3EJ 1R9TJ 2HOSA 3GTQJ 3PO2J 4A3FJ 3CMYA 5F27A 2Y0SN 1WH5A 4AC0A 4A3JJ 3K7AJ 2LR8A 2EQRA 4D7NA 2VPRA 3HOWJ 1K83J 2K9QA 4M3GA 2XGDA 5F1JA 1CQTA 1MH4A 4NDLA 2L7FP 1Z77A 5J1YA 2LK2A 1MSFC 2R92J 1UHSA 2XRLA 1ENHA 2QF7A 1MBFA 4M3BA 1DU6A 1AKHA 2HOAA 3SDGA 4LOCA 1JJ6C 3BR2A 3LSPA 3JRAA 3H0GJ 5M5YJ 1IV6A 3S2HJ 1OFCX 5FKLA 3ZQIA 2WV1A 3LOCA 1BJZA 2JA6J 4BKXA 3RZOJ 1GT0C 2FJ1A 1QVTA 3G1MA 1ORKA 4CYCA 2MG4A 2Y30A 1RR7A 1PUFB 1A6IA 3HGGA 1OJLA 1B8IB 2IAIA 3TP0A 3RZDJ 3GTPJ 4JYKA 2DMTA 1G2HA 1IGNA 1A5JA 2E1OA 2ID3A 3JRHA 1IRZA 5F0CA 2HYJA 1IC8A 1RESA 2MSYA 1YRNA 2YU9J 2M0CA 3PO3J 2LFBA 1LE8A 3BQZA 4DZPA 1JUSA 1H88C 2EH3A 1JKPC 4I6ZA 3BR5A 3NARA 3GTMJ 2JN6A 2R5ZB 2LD5A 3BQYA 5J1UA 3IV5A 2ELKA 1X58A 3HKZN 5FKMA 1LFUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VND A;  5F08 A;  2DA1 A;  2FQ4 A;  4GFB A;  3ZQL A;  3BR1 A;  2ME0 A;  3CQZ J;  1ZR2 A;  2LY9 A;  2LKX A;  1IDZ A;  1ETX A;  4S0H B;  3JRF A;  5F0H A;  2O9L A;  2IBD A;  3S1N J;  4Y7N J;  1HLV A;  3S14 J;  2P81 A;  1ZK8 A;  1JJ8 C;  1B72 B;  2CQQ A;  2VI6 A;  3ZQG A;  2VUM J;  4A3B J;  1H8A C;  1IUF A;  4A93 J;  5FLV A;  4C3H J;  1VI0 A;  2H1K A;  3HB9 A;  3JR9 A;  2MGQ A;  2L0K A;  5FJ8 J;  1MSE C;  3Q3S A;  1NTC A;  1XG1 A;  2TCT A;  1HF0 A;  4RBO A;  1ETY A;  3FK6 A;  4DYR A;  1SAN A;  1FEX A;  2M9H A;  1Q1V A;  5E3L A;  1H89 C;  1WGX A;  5C4J J;  3FIS A;  1U8B A;  1TC3 C;  1U9N A;  1P7I A;  1AKH B;  1K61 A;  4W97 A;  1I6H J;  4MO7 A;  3L1P A;  3M4O J;  4V2G A;  3OIO A;  5E3N A;  1Z0X A;  2OPT A;  2YS9 A;  3OOU A;  2YUS A;  2NS7 A;  1OCP A;  4JP0 A;  1YRN B;  3OSG A;  5EGO A;  3MN2 A;  4XRS G;  2R5Y B;  4DYC A;  3GTJ J;  1B8I A;  2HXI A;  2E2I J;  1IDY A;  5IYB J;  3A01 B;  3RKQ A;  4M3E A;  4UUS B;  1ZQ3 P;  1MNM C;  3GTK J;  3BR0 A;  3WHC A;  1IJW C;  1RET A;  4UUS A;  4BY7 J;  1FJL A;  4XRM A;  2LVS A;  1LE8 B;  1ETQ A;  4BBS J;  1GDT A;  4J19 A;  1MBE A;  2R5Y A;  3BG3 A;  3S16 J;  2Y9Z A;  3HOV J;  3ZQH A;  3CCY A;  4A3C J;  1TWA J;  1OCT C;  2CJJ A;  3QPL A;  2M8G X;  4JX5 A;  1UG2 A;  1D5Y A;  1EF4 A;  1WCM J;  3S15 J;  4X6A J;  3BTI A;  2N8G A;  5JLW A;  1JUP A;  3HEF A;  3LNQ A;  4JX4 A;  1SFO J;  1U78 A;  2EBI A;  3NAU A;  2R93 J;  5FKK A;  3WHB A;  1GUU A;  5EYR A;  1MBJ A;  2AO9 A;  5EF6 A;  1MH3 A;  1WI3 A;  2EZL A;  3HOU J;  5J1R A;  3BR6 A;  5K7H A;  1ETW A;  2Y9Y A;  2X6O A;  2DMN A;  5FKN A;  4B1R A;  3IH4 A;  1Y1W J;  2GBY A;  1HCR A;  3CDL A;  1FTZ A;  3W6V A;  5F04 A;  1MBH A;  3HOX J;  2LLK A;  4D5C A;  1WPK A;  3JRD A;  1BL0 A;  2JA8 J;  1F43 A;  2K40 A;  4FIS A;  3LSR A;  1QVU A;  2X48 A;  1W0T A;  3F0C A;  4A3G J;  5IOY A;  1RKT A;  2MW8 A;  1XC5 A;  4L5E A;  3O8G A;  3E7L A;  1JKR C;  5HOD A;  5EG0 B;  5M5X J;  2B63 J;  4EEF G;  1LFB A;  2DA5 A;  1HDD C;  2CRG A;  3GTG J;  5E3M A;  1FIP A;  5EG0 A;  2JWT A;  4MLO A;  3BTJ A;  2R5Z A;  2CUF A;  5J3L A;  1HOM A;  3OSF A;  1HDP A;  1APL C;  2JJ7 A;  2XSD C;  3BT9 A;  2NVQ J;  3B6C A;  2EZH A;  4IHW A;  1XS9 A;  2COB A;  2ECC A;  2W48 A;  3BG5 A;  3ZQF A;  3S1M J;  2NOG A;  2EZI A;  4G12 A;  2HQ5 A;  4ABZ A;  2RAE A;  4QIW N;  2L7Z A;  1NK2 P;  4D5F A;  1ZTR A;  2G0E A;  1GVD A;  3M3Y J;  2Y2Z A;  2NS8 A;  3RQI A;  3D1N I;  3BTC A;  2DN0 A;  2DA4 A;  4FTH A;  3HGY A;  1VF9 A;  3DEW A;  5C4X J;  1ETV A;  1ZGW A;  5EDN A;  2LP0 A;  3GTL J;  3JRE A;  5DTD A;  2X9D A;  2L9R A;  2XPU A;  3HOY J;  1AHD P;  2IEK A;  3LSG A;  3PM1 A;  3H3V K;  5M5W J;  1PUF A;  3HM5 A;  1ZKG A;  1BW6 A;  2HI3 A;  2DA6 A;  3O8H A;  1I50 J;  1MBG A;  4B3A A;  5EZH A;  4C3I J;  2HDD A;  3BTL A;  1QRY A;  1Y1V J;  5K7F A;  2KDZ A;  2R0Q C;  3GTO J;  4DW6 A;  2NVX J;  2KT0 A;  5IP6 A;  1ZR4 A;  2WB1 N;  2GM4 A;  9ANT A;  5JLX A;  1I3Q J;  1ETK A;  3G1O A;  4BXX J;  3ZOB A;  1P7J A;  4QSH A;  5IP7 J;  3B6A A;  3QQA A;  1BA5 A;  2M2E A;  2DJN A;  2OF7 A;  5C44 J;  1T33 A;  3TW6 A;  3BR3 A;  3HBL A;  2K9S A;  2JA7 J;  2FX0 A;  1JTY A;  5EGO B;  1E3O C;  2DMP A;  3IH2 A;  4M3F A;  4JX6 A;  3C2B A;  1B72 A;  4IHY A;  1JUM A;  5IPA A;  4B4C A;  3JRG A;  1JGG A;  4IHX A;  5EZG A;  3MKL A;  3TED A;  2PMZ N;  1MBK A;  4UUT A;  2XPW A;  3ZQC A;  1FIA A;  1AU7 A;  1ITY A;  1T56 A;  3I4M J;  5IOZ A;  1JKO C;  1JT0 A;  2ECB A;  4M3D A;  3JRB A;  5FLM J;  2E2J J;  1TWF J;  3GBG A;  1TWC J;  2EZK A;  1JTX A;  4C3J J;  1ETO A;  4A69 C;  1RPW A;  1O4X A;  2HOT A;  1X2M A;  4HNV A;  4FE7 A;  2E2H J;  4IEJ A;  4FE4 A;  4QTR A;  1FTT A;  3A02 A;  3S1Q J;  2DA3 A;  4A3L J;  2DA7 A;  2M34 A;  2NVY J;  5IYD J;  3JRI A;  2XPV A;  3VPR A;  2K9N A;  2DMQ A;  4C2M J;  5FKO A;  4XRS A;  2QCO A;  2JA5 J;  5IYC J;  3S1R J;  2XB0 X;  2ZB9 A;  4DZJ A;  4A3K J;  1JKQ C;  1W0U A;  2L7M P;  5GP9 A;  3S2D J;  2R7Z J;  1NK3 P;  1GV5 A;  4FCY A;  3FKI J;  1POG A;  3S17 J;  4XIC A;  3JRC A;  4A3I J;  4A3M J;  5EEA A;  2CUE A;  5BNG A;  2VKV A;  2Y31 A;  4MFD A;  2DA2 A;  2DMU A;  5K7Z A;  5M3F J;  4DYQ A;  3IH3 A;  4BBR J;  4XID A;  3G1L A;  4XK4 A;  3K2A A;  3SJM A;  1UMQ A;  4IHV A;  3A03 A;  1GV2 A;  4AUX A;  5E3O A;  1F36 A;  2XGC A;  4I76 A;  4A3D J;  1TWH J;  1IG7 A;  3FIW A;  3DCF A;  2CQX A;  4RDU A;  2JMW A;  3Q0W A;  4A3E J;  3TP3 A;  2NVT J;  2VKE A;  4Y52 J;  5IP9 J;  5GPA A;  3LSJ A;  4CYC B;  4MIM A;  2FD5 A;  4BY1 J;  2O7O A;  5DS9 A;  1DU0 A;  2H8R A;  3QPS A;  2CU7 A;  1TWG J;  5F0F A;  3A01 A;  2HXO A;  2DTZ A;  3UKG A;  4X1E A;  3Q0V A;  3BG9 A;  1RKW A;  2JK3 A;  1QPI A;  2WAQ N;  3SFI A;  3I4N J;  2I10 A;  2GLO A;  4M6V A;  2XB5 A;  1S7E A;  3Q0U A;  4V2F A;  4W1U A;  2D5V A;  2XGE A;  4MFE A;  3FK7 A;  2ME6 A;  5M3M J;  2LTP A;  1JT6 A;  5GPC A;  1U9O A;  3MVP A;  3TW7 A;  1VFC A;  2E19 A;  2AHQ A;  3HDD A;  4D7M A;  2ID6 A;  2TRT A;  1WH7 A;  4AYB N;  2O8K A;  3HOZ J;  1BW5 A;  1X2N A;  5C3E J;  1R9T J;  2HOS A;  3GTQ J;  3PO2 J;  4A3F J;  3CMY A;  5F27 A;  2Y0S N;  1WH5 A;  4AC0 A;  4A3J J;  3K7A J;  2LR8 A;  2EQR A;  4D7N A;  2VPR A;  3HOW J;  1K83 J;  2K9Q A;  4M3G A;  2XGD A;  5F1J A;  1CQT A;  1MH4 A;  4NDL A;  2L7F P;  1Z77 A;  5J1Y A;  2LK2 A;  1MSF C;  2R92 J;  1UHS A;  2XRL A;  1ENH A;  2QF7 A;  1MBF A;  4M3B A;  1DU6 A;  1AKH A;  2HOA A;  3SDG A;  4LOC A;  1JJ6 C;  3BR2 A;  3LSP A;  3JRA A;  3H0G J;  5M5Y J;  1IV6 A;  3S2H J;  1OFC X;  5FKL A;  3ZQI A;  2WV1 A;  3LOC A;  1BJZ A;  2JA6 J;  4BKX A;  3RZO J;  1GT0 C;  2FJ1 A;  1QVT A;  3G1M A;  1ORK A;  4CYC A;  2MG4 A;  2Y30 A;  1RR7 A;  1PUF B;  1A6I A;  3HGG A;  1OJL A;  1B8I B;  2IAI A;  3TP0 A;  3RZD J;  3GTP J;  4JYK A;  2DMT A;  1G2H A;  1IGN A;  1A5J A;  2E1O A;  2ID3 A;  3JRH A;  1IRZ A;  5F0C A;  2HYJ A;  1IC8 A;  1RES A;  2MSY A;  1YRN A;  2YU9 J;  2M0C A;  3PO3 J;  2LFB A;  1LE8 A;  3BQZ A;  4DZP A;  1JUS A;  1H88 C;  2EH3 A;  1JKP C;  4I6Z A;  3BR5 A;  3NAR A;  3GTM J;  2JN6 A;  2R5Z B;  2LD5 A;  3BQY A;  5J1U A;  3IV5 A;  2ELK A;  1X58 A;  3HKZ N;  5FKM A;  1LFU P; 
#chains in the Genus database with same CATH topology
 4KMU X;  1ZG1 A;  5B5E C;  2ME0 A;  1ZR2 A;  3JCU C;  4DBQ A;  1FWZ A;  1W7P D;  2JQ7 A;  4UB8 C;  5LHI A;  1J75 A;  1BC8 C;  3JRF A;  4ZYE A;  5F0H A;  3KFW X;  3S1N J;  5H6R A;  4Y7N J;  4PSX A;  1STZ A;  4B09 A;  2VI6 A;  3ML6 A;  1PDN C;  4RB1 A;  3W6K B;  2JRT A;  4A93 J;  1K7A A;  2MA3 A;  4BJT A;  1OCO H;  2ZJR F;  3BJA A;  2HYF A;  3RJP A;  2W00 A;  4N0B A;  2L0K A;  2R7Q A;  5FJ8 J;  2V1D A;  2HGC A;  3H36 A;  1MSE C;  1KA8 A;  2O5R A;  2RRE A;  1NTC A;  3E3V A;  1HF0 A;  2KRF A;  3FK6 A;  2ZME B;  4EQQ A;  4XM3 A;  1Q1V A;  4BQO A;  4EM2 A;  2Y0S A;  5C4J J;  1LEA A;  4OIR F;  2KIU A;  2L9N A;  3L1P A;  3RYP A;  2L4M A;  1D1B A;  3E0J B;  4M73 A;  3OOU A;  4MGR A;  1ZG5 A;  3GLX A;  1SAU A;  4PK4 A;  2WA0 A;  2C6Y A;  1TQP A;  4P1W A;  3HG9 A;  2EV5 A;  1LEB A;  2QLZ A;  3OSG A;  1ULY A;  2BBY A;  1DQU A;  2M45 A;  3G6E I;  1R49 A;  3D5S C;  1DUX C;  4WXC A;  1BR2 A;  3E97 A;  3K1P A;  1V5F A;  5ILV A;  4WXD A;  2WAF A;  4XSZ F;  4M9Z A;  3LQR A;  1H9T A;  4GXO A;  1IDY A;  1S9H A;  3J7Z I;  4IO9 F;  3GTK J;  2QM3 A;  4L9J A;  5HS8 A;  4E7K A;  5L3D A;  1GXQ A;  4UUS A;  4G9Y A;  3V7S A;  1FJL A;  2OCE A;  1KQ8 A;  2ZFU A;  3OR1 C;  1XPX A;  1WHU A;  3HPG A;  4OIN F;  3ROU A;  4HYE A;  3UNG C;  5FGM A;  2IGO A;  2L54 A;  5EJC A;  4CZZ A;  3HTU A;  2HFH A;  3BG3 A;  1EH6 A;  5HOO A;  2Y9Z A;  2QZ8 A;  3S16 J;  3KZZ A;  3PUB A;  4LB6 B;  3CJR B;  2H09 A;  3BRO A;  2MD5 A;  4HX7 A;  2HKX A;  4TV7 A;  1WCM J;  1HXD A;  2LDU A;  2O6G E;  1UB9 A;  3TDU C;  2N8G A;  3HEF A;  3CC2 I;  2IGK A;  3NQO A;  2MLK A;  3I53 A;  3D0S A;  1FSH A;  4FAS D;  1OLT A;  2AO9 A;  2CSO A;  1LB2 A;  1TW3 A;  3GF2 A;  1WI3 A;  2LKP A;  2VKD A;  1MMN A;  5E1W A;  3DKW A;  2QKL B;  4EMS A;  1Q1H A;  3FXJ A;  4B1R A;  3IH4 A;  1T98 A;  4XON A;  3MKY B;  1Z3Y A;  3U9G A;  3RI4 A;  3W6V A;  2ZO4 A;  4ETS A;  4BAC A;  4D5C A;  2DTR A;  4XOP A;  3KP4 A;  3JSO A;  4HNT A;  1RIO H;  2M30 A;  2F2E A;  3LSR A;  1TNS A;  2CH0 A;  3X2Q H;  4I02 A;  2NXN B;  4A3G J;  5IOY A;  3CF5 F;  1R22 A;  4P55 A;  1S7A A;  3K1M A;  4LIT A;  4L5E A;  3O8G A;  3K0L A;  3RKX A;  1JKR C;  1XSX A;  1NG6 A;  1LFB A;  1ZGA A;  2CRG A;  2ZCW A;  5ICG A;  1FIP A;  4U0Y A;  2JWT A;  3EET A;  3BTJ A;  2CUF A;  2Y69 H;  2KJB A;  1WZ2 A;  1OPC A;  1HDP A;  1WWX A;  4BU2 A;  1UCR A;  3HOT A;  3BT9 A;  3DU5 A;  3KYD B;  5K5Q A;  2NVQ J;  3B6C A;  4PFO A;  5A2Q Z;  4FHT A;  2O3F A;  4IVN A;  2GXA A;  2Q2E B;  3HXL A;  4IHW A;  2ECC A;  2W48 A;  2LF7 A;  4G12 A;  2ZSI B;  2ZBK A;  3L00 A;  2ESH A;  1TP4 A;  3CCR I;  3ISP A;  2XUB A;  3G73 A;  5LEJ A;  3S3M A;  3LSK A;  4MQV A;  1N75 A;  2VBZ A;  2QKM B;  5HDG A;  4G6T B;  1Y8Q B;  2X6X A;  4N4N B;  4CH7 A;  5DM7 F;  2P0W A;  4F91 B;  4LG0 A;  4I2O A;  5FB2 A;  5HLG A;  3DBL B;  1FPQ A;  3CUQ B;  3DTI A;  4ZYH A;  2OUM A;  3JRE A;  5JI6 A;  5L3B A;  2LBF A;  1TTY A;  1B6A A;  2V9V A;  3LMM A;  3LSG A;  2X85 A;  3H3V K;  1O57 A;  1SAX A;  1IZ1 A;  5M5W J;  4Z2Y A;  1ZKG A;  5TRD A;  4IOC F;  1VQL I;  1BW6 A;  3QWL A;  4NB5 A;  3O8H A;  1LKX A;  3QU3 A;  4B3A A;  3AG2 H;  3PSF A;  4I0A A;  3J7A O;  1M1E B;  2CS3 A;  4C3I J;  3BTL A;  3GTO J;  1E3H A;  4DW6 A;  2KT0 A;  3DPU A;  1ZR4 A;  1T95 A;  2EIJ H;  2WB1 N;  4YEJ A;  3FBN B;  5JLX A;  5J4V A;  3OYH A;  1ETK A;  4HEA 2;  3ZN0 A;  1SMY F;  1Z7U A;  2AXT C;  3G1O A;  2DT5 A;  1H0M A;  2K7L A;  3DEU A;  3B6A A;  4ON0 A;  2OC6 A;  2NNN A;  2XRN A;  3J81 Z;  3OYD A;  2GOX B;  3TW6 A;  3IUO A;  2NRA C;  2K9S A;  1SD6 A;  5LFA A;  4IRI A;  2VQC A;  4O6J A;  5CKT A;  1ERD A;  1GHC A;  5D5V B;  1YG2 A;  2FOK A;  3BP8 A;  2BZT A;  3HRT A;  2E1C A;  3ERE D;  1VQ9 I;  2BY1 A;  2CFX A;  3JRG A;  1JGG A;  4KT5 C;  2PMZ N;  4R79 A;  5HNH A;  1EJ9 A;  1O7F A;  4H4K C;  4UUT A;  2STW A;  1U5T B;  3SZG A;  4ENM A;  2Z33 A;  4XR6 A;  1AU7 A;  3I4M J;  5IOZ A;  2RNG A;  4H0E A;  4LG3 A;  4XNF A;  1JT0 A;  5FD5 A;  4M3D A;  3WGG A;  2ELJ A;  1YHQ I;  1TWC J;  5E1Z B;  1XTA A;  4CXF A;  2YX7 A;  4CCK A;  3WE3 A;  3CP8 A;  4IEJ A;  1LVK A;  3FXO A;  2IS4 A;  3LA2 A;  2CO5 A;  3GFI A;  2M34 A;  5IYD J;  1O7L A;  2RQQ A;  4I01 A;  2K9N A;  4FET A;  4CIC A;  5J6X A;  2QCO A;  2JA5 J;  3S1R J;  2EA4 A;  3OV8 A;  2AQE A;  4A3K J;  1OCR H;  1W0U A;  2L7M P;  3BZC A;  5E8G A;  1IRF A;  3TGN A;  1NH3 A;  4L9T A;  2R7Z J;  2Y75 A;  3QP6 A;  4M6Y A;  3S93 A;  3S17 J;  3LFK A;  2XIG A;  2DXI A;  4BQA A;  1QPM A;  4RM2 A;  1ZH5 A;  1XX5 A;  3N97 A;  3I3L A;  2CUE A;  4Y17 A;  1FYL A;  4MFD A;  3H0D A;  2DA2 A;  2O61 A;  2MC4 A;  4XLP F;  3PNV A;  2JVG A;  2CW0 F;  2OTL I;  1XD7 A;  1B59 A;  3FM3 A;  3NWT A;  1FBS A;  3S8P A;  3SJM A;  1KQ9 A;  1UMQ A;  2A05 A;  4I98 B;  1GXP A;  4L18 B;  4F93 B;  2BYV E;  4I0B A;  1F36 A;  2ZME C;  3LAJ A;  3CTA A;  2VE8 A;  1BI1 A;  1UEL B;  5LLQ A;  1G3S A;  4CSW A;  2MH2 A;  3FIW A;  3DCF A;  4BHC A;  2CQX A;  4ESB A;  4RDU A;  2JMW A;  3I71 A;  4AIK A;  2KKO A;  1ZYR F;  3E6C C;  1MMD A;  3Q0W A;  2VKE A;  2DK5 A;  5IP9 J;  1MW7 A;  3EYI A;  4RM3 A;  3BY6 A;  3I56 I;  1WJA A;  2H8R A;  4M9X A;  3F6V A;  1ZRF A;  3ERM A;  3A01 A;  5F0F A;  2HXO A;  2DTZ A;  4UHT A;  4X1E A;  2L3D A;  2Z1D A;  3Q0V A;  3K4B A;  3UKG A;  2WAQ N;  3M8J A;  2O03 A;  3I4N J;  3TBI A;  2GLO A;  1BOB A;  1ZGJ A;  5HLI A;  4M6V A;  2M0M A;  4W1U A;  2G9W A;  4MFE A;  2RN7 A;  2PEX A;  5M3M J;  4AID A;  4ZDO A;  2D45 A;  2E19 A;  5ED4 A;  1LPQ A;  4HQM A;  2ID6 A;  3GUD A;  1HKQ A;  2O8K A;  3CLQ A;  1KYZ A;  3MWM A;  5D4S A;  1S29 A;  3TO7 A;  2HOS A;  2ZKZ A;  2PJR A;  1EKE A;  2FRH A;  2EIN H;  3Q9S A;  4PZJ A;  3CCJ I;  3PO2 J;  3FDY A;  2IT0 A;  2Y0S N;  1WH5 A;  2QQ9 A;  3GVA A;  4A3J J;  2LR8 A;  2ISZ A;  3W2V A;  4IQ4 A;  4KN7 X;  4XKB A;  1U5T C;  4E6K G;  1MIJ A;  5D8K B;  3HSE A;  2H94 A;  5L3C A;  3DLL F;  2KZG A;  2VPR A;  3IHU A;  3RKY A;  4M3G A;  1A31 A;  3U1K A;  4KT6 A;  4NDL A;  3K9T A;  1MSF C;  2R92 J;  3ABT A;  2MLG A;  1IUY A;  3HOS A;  3AFH A;  4GGG A;  3PSI A;  1Y6I A;  4P5O A;  1KZH A;  1X4O A;  4BE1 A;  4M3B A;  1O3Q A;  2XV4 S;  5ICF A;  1IXR C;  3SDG A;  4HRI A;  2V1N A;  1R5G A;  5FRN A;  3CES A;  3H35 A;  3PJR A;  1Z21 A;  3H0G J;  3S2H J;  5FKL A;  3PNT A;  5KK1 A;  1YJ9 I;  1IW7 F;  1IN7 A;  2GIV A;  1IXS B;  4KIT B;  2KP6 A;  3J7A Y;  1GT0 C;  3GXO A;  1X1A A;  5CVU A;  1VQK I;  4RAF A;  2EV6 A;  2F4M B;  1FLI A;  1CF7 A;  1QVT A;  3G1M A;  1ORK A;  2L9V A;  2CMP A;  4IQJ A;  2DAO A;  1XCV A;  1R4N B;  2GA2 A;  3CMM A;  3IRQ A;  1A6I A;  4HDU A;  1B8I B;  3OYK A;  5BOX A;  3TP0 A;  4JYK A;  2A61 A;  2DMT A;  4YFN F;  3WU1 B;  1IGN A;  2E1O A;  3CJT B;  2JVH A;  3JRH A;  4EGZ A;  1HW5 A;  1LQ1 A;  2TDX A;  5DDG A;  4MHG A;  2MC3 A;  1DDN A;  1R6R A;  3JW4 A;  1ACI A;  3DLA A;  4P96 A;  3CC4 I;  4LFU A;  3BDD A;  1H88 C;  2EH3 A;  4JK1 X;  1YIJ I;  4I6Z A;  1P4A A;  4IHS A;  2E5N A;  2JN6 A;  2PG4 A;  3GO5 A;  2B9S A;  2FML A;  3BQY A;  2LD5 A;  3IV5 A;  2X1D A;  3A1Y A;  2X1C A;  3W3C A;  2JZY A;  1Z6R A;  3OS0 A;  1LFU P;  2R7S A;  5F08 A;  1MDM B;  1XGM A;  2BHZ A;  2ELH A;  1D1C A;  2PJR B;  3HYI A;  1V5G A;  1MJB A;  2AS5 F;  3IRR A;  2O9L A;  2IBD A;  5HDN A;  3WGI A;  1F9N A;  3H9G A;  3ZMT A;  2VUM J;  3TDZ C;  2KPM A;  4EGY A;  3D5R C;  3GFJ A;  1GVJ A;  2LKS A;  1X1P A;  3BJO A;  1S3J A;  2GQQ A;  3ZR8 X;  4E70 A;  3FBI B;  5FLV A;  4AWX B;  4OIO F;  4C3H J;  2QBY A;  1VI0 A;  3R0J A;  5IT9 K;  1S7O A;  1FSE A;  2JUC A;  4HLY A;  3Q3S A;  3ZCO A;  2TCT A;  2P5K A;  1JXS A;  2HQR A;  3DTK A;  1AA7 A;  2VOO A;  2HYG D;  3GLL A;  4F3Q A;  3MZ8 A;  3R61 A;  3FHZ A;  2CGP A;  3K6G A;  3GFL A;  2XAU A;  1H89 C;  1YW7 A;  2HTS A;  4PCQ A;  1U2W A;  1OYY A;  1TC3 C;  3CDI A;  3FM5 A;  4FX4 A;  4PUS A;  4W97 A;  1YIT I;  2FF4 A;  3B73 A;  4S05 A;  2DFI A;  4V2G A;  4A0Z A;  5E3N A;  1RI7 A;  2YS9 A;  3BC8 A;  3C18 A;  2PX9 A;  1T08 B;  1R71 A;  2LH9 A;  2PQ8 A;  5HS7 A;  4ANJ A;  3MN2 A;  3PFY A;  4OIP F;  3JTH A;  1IXC A;  4KIG A;  4DYC A;  1B8I A;  4WWC A;  2HXI A;  3GZ6 A;  5IYB J;  4PJ0 C;  4D9J A;  3RKQ A;  1CF7 B;  4UUS B;  1MNM C;  4IL6 C;  1OQY A;  3RQ4 A;  1LNW A;  2BE5 F;  2ICW G;  1IJW C;  1C0W A;  1B9N A;  2DBB A;  1G4D A;  4F52 A;  4PFP A;  4OAY A;  4IX7 A;  1IF1 A;  2XSJ C;  3DF8 A;  1MBE A;  2R7O A;  4OAZ A;  2R5Y A;  3H1C A;  2CWE A;  4RGR A;  2KZV A;  4HQE A;  3ZQH A;  2DYR H;  1W1W E;  3MCZ A;  2E35 A;  4A3C J;  3QOD A;  2AXL A;  2JA2 A;  3HRU A;  3E6M A;  4P9U A;  3EDP A;  1KU2 A;  4JX5 A;  1USS A;  1Z7L A;  2O0Y A;  2MFZ A;  3VYS B;  1HKS A;  2IJL A;  1EH7 A;  4KJZ A;  2Q8K A;  3LNQ A;  1EH8 A;  2QEN A;  3NAU A;  4K2E A;  1U78 A;  2R93 J;  2GWR A;  4B3X A;  3CO6 C;  2Z2S B;  2H6C A;  1GUU A;  2L02 A;  5EYR A;  2DPD A;  4IKF A;  4LG0 B;  4BE0 A;  1XB4 A;  5LHH A;  4ZC3 A;  3OYJ A;  3HZJ A;  3T8R A;  2GBY A;  1Z05 A;  3ZMV A;  1TQM A;  2DW4 A;  1FTZ A;  2D1V A;  5F04 A;  2QBY B;  3DFG A;  3BG6 A;  4A5M A;  3JRD A;  2L01 A;  2K85 A;  3VOE A;  5E18 F;  4FIS A;  3U21 A;  1T0F A;  4RB3 C;  1BC7 C;  2CV2 A;  2A6H F;  3EQL F;  1FT9 A;  1ZRD A;  1DGR M;  2WV0 A;  4HPQ A;  5GAG J;  3V7C A;  5K5R A;  2DOD A;  3TL4 X;  2HTJ A;  2MH9 A;  3A0H C;  2LY1 A;  4XSX F;  4L0Z B;  3HTS B;  2DA5 A;  3W2W A;  4AVZ A;  2QQB A;  3AAF A;  4GRI A;  4QPO A;  4RAG A;  4HNU A;  5J3L A;  1XMA A;  5GAE J;  2HS5 A;  3CD6 I;  1BR4 A;  3DU6 A;  4CO8 A;  1R4M B;  2EZH A;  4CA0 A;  3W6J B;  3S1M J;  3M07 A;  5TGT A;  3JAM Z;  2EZI A;  4U88 A;  2HQ5 A;  4HZF A;  3P9I A;  3SHF A;  3VOD A;  2EFO A;  3KP6 A;  3LL7 A;  2R7R A;  2LY2 A;  2EFN A;  3BCB A;  4D5F A;  3AL0 C;  2G0E A;  1B4A A;  1Y8R B;  3KP7 A;  2EA2 A;  3KLO A;  2GA1 A;  2VJ5 A;  5F1R A;  2OZU A;  2IS1 A;  2KMU A;  3MZH A;  4BEH B;  1BIB A;  1KU3 A;  2V1X A;  2VON A;  5C4X J;  2R7W A;  1ZGW A;  3I59 A;  3KYL A;  2PMU A;  5CVR A;  2LP0 A;  2BVM A;  4XMY A;  3GTL J;  3P7N A;  1FZP B;  5DTD A;  5HLH A;  4HAM A;  1MKM A;  2RDP A;  2X9D A;  2L9R A;  2XPU A;  3LFU A;  3L2Q A;  1R23 A;  2IEK A;  2FNA A;  4IF4 A;  4UV8 A;  1YW8 A;  2J5O A;  4BE2 A;  4Q5S F;  2CUZ A;  4IJA A;  3HL2 A;  4NUB A;  3VDX A;  4BHP A;  3IP4 B;  5DEQ A;  2V6C A;  2DA6 A;  5HLT A;  2F5V A;  1MBG A;  1L3L A;  3UR3 C;  3RPU A;  3VWB A;  4A0X A;  1QRY A;  1R58 A;  4HV5 A;  2COM A;  1MMA A;  2M7A A;  4BJ6 C;  9ANT A;  4XOR A;  3J80 Z;  4YIR X;  5H2F C;  2F5E A;  5IP7 J;  2FMY A;  3QQA A;  1BA5 A;  1OIS A;  2M2E A;  4HDV A;  3WG9 A;  2OF7 A;  2JTV A;  3P9C A;  4LJZ F;  2GAU A;  2QSF X;  5LGU A;  4ASN A;  1BI2 A;  1I3A A;  1A36 A;  2FX0 A;  2H1L A;  4Z6Y A;  4D1Q A;  4XN0 A;  3Q9V A;  4FQG A;  4RGS A;  3WTU C;  4AIJ A;  1IN6 A;  1R1V A;  3AG4 H;  3QU6 A;  3C2B A;  4IHY A;  3E1S A;  4U7B A;  2M5W A;  1JUM A;  1N25 A;  5GAH J;  5IPA A;  4S04 A;  2A5W A;  4BGD A;  3GEZ A;  1IN4 A;  5D4R A;  3L2V A;  2M4K A;  1YFH A;  4IHX A;  3MKL A;  3GYH X;  2WAD A;  1QZE A;  4UXN A;  2FU4 A;  1BOA A;  1QHG A;  1FIA A;  3OL4 A;  5CQE A;  4Y15 A;  3B02 A;  4BXU A;  2JT1 A;  1ITY A;  3K2Z A;  1YX3 A;  4OWR B;  3G2B A;  1E2X A;  4MNU A;  2QSH X;  3RSN A;  2WAE A;  3COA C;  2KIS A;  2E2J J;  1TWF J;  3QYE A;  2MBF A;  2XAH A;  3CCM I;  1JTX A;  3C2H A;  4II2 A;  2VE9 A;  3MAJ A;  2D2W A;  4M71 A;  5LRR A;  1ZEL A;  3EUH A;  3OYL A;  1XN7 A;  4G6D A;  5GAD J;  2HOT A;  4M74 A;  1V54 H;  1TBX A;  2E2H J;  4QTR A;  1YLF A;  1FMW A;  3A02 A;  1I39 A;  3WTS C;  3S1Q J;  2HDW A;  1XDS A;  3L09 A;  2NVY J;  2PJP A;  3JRI A;  4RGX A;  3VPR A;  2IA0 A;  4LIU A;  1T6S A;  1WKM A;  3K1N A;  4XRS A;  1HA8 A;  5CPR B;  4AVP A;  2DFF A;  1QU3 A;  2ESN A;  4IXA A;  4DZJ A;  3ZQQ A;  1U3E M;  4M72 A;  4WF2 A;  5GP9 A;  3OYG A;  3FHN A;  3S32 A;  4FCY A;  4YEL A;  2PBI A;  3RPQ A;  1X3Z B;  3HSF A;  2STT A;  2EJR A;  3FXU A;  3FMS A;  5BNG A;  2QA4 I;  2IGM A;  2KL4 A;  4AYB A;  4E7H A;  2B7E A;  1BI0 A;  1MJ9 A;  1OCZ H;  1S72 I;  5IT9 Z;  2VIX A;  3M8E A;  2DMU A;  1BM9 A;  3AG3 H;  4KN4 X;  4XLE A;  5K7Z A;  3MQ0 A;  2XAF A;  3IH3 A;  4PJJ A;  4BBR J;  4XID A;  4XK4 A;  2G7U A;  1FYM A;  5E17 F;  3MMY B;  5E3O A;  2R7T A;  5GTI C;  2R7V A;  2XGC A;  3KIO A;  4B43 A;  4DGW B;  4A3D J;  4EV0 A;  1FBU A;  4RGU A;  3U1D A;  1UAA A;  4N4O B;  1XGN A;  1VZ0 A;  4EJT A;  2R7U A;  1RC9 A;  2L2O A;  1W7P B;  2HOE A;  3TP3 A;  2NVU B;  4Y52 J;  4XOT A;  2AQF A;  4RA2 A;  5E79 C;  5BMZ A;  4C9Y A;  3LSJ A;  3T8T A;  4E7Z A;  4CYC B;  2E34 A;  4BY1 J;  5DS9 A;  1R5H A;  2CQK A;  1WJE A;  3H3Z A;  4LB5 A;  1Y0N A;  3BG9 A;  1F4K A;  1P4W A;  2EWN A;  2E1N A;  2EB7 A;  1QPI A;  1MD0 A;  3ESW B;  3L2R A;  2GOM A;  1S7E A;  4C2T A;  1SFE A;  5GPC A;  1VFC A;  3CUQ A;  2ZXJ A;  1S8N A;  3HDD A;  3WE2 A;  4D7M A;  3I64 A;  2JRM A;  2V7F A;  2GIZ A;  1WH7 A;  1IN5 A;  1X2N A;  2A6T A;  2P6S A;  2IXS A;  1KON A;  3SZP A;  1R1U A;  4A3F J;  5F6F A;  2UXX A;  5F27 A;  1FYK A;  1EA3 A;  3M8F A;  3K7A J;  5CYV A;  3F3X A;  2F4I A;  4IRG A;  4ZDL A;  3K4K A;  4M9S A;  5J40 A;  1WJB A;  3KX2 A;  3AKZ A;  3KZI C;  1IRX A;  1P9Q C;  3GME A;  1Z77 A;  5J1Y A;  3WU0 A;  2LK2 A;  3QYF A;  1PVE A;  1UHS A;  2XRL A;  1ENH A;  1YS7 A;  3TOB A;  2V79 A;  4KIB A;  1XCB A;  1DU6 A;  2HOA A;  4NC7 A;  1X1C A;  3WTZ A;  4J00 A;  4LOC A;  2DPU A;  3LSP A;  2VJJ A;  1FOK A;  1D0Y A;  1TT5 B;  3ZQI A;  2WV1 A;  1BJZ A;  4BKX A;  2DCE A;  2QWW A;  2WBM A;  2VN2 A;  3KP3 A;  3T0Y A;  4HST A;  4CHU A;  1ON1 A;  1SC7 A;  1YE9 A;  1KU7 A;  2Z16 A;  3FXL A;  2MG4 A;  2Y30 A;  1RR7 A;  2IA2 A;  4DOZ A;  3L2W A;  1DP7 P;  5KNL A;  4OIQ F;  1I1S A;  1HST A;  3GTP J;  2P7V B;  1E0E A;  5E8I A;  4LLL A;  4XLF A;  5EEG A;  1B9M A;  4Q48 A;  5F0C A;  1IC8 A;  1LDD A;  1YRN A;  1O3R A;  2D1H A;  2LFB A;  1JUS A;  4WK8 F;  4RB0 A;  3DPT A;  3FMR A;  4CDG A;  1XGS A;  4XKW A;  3CUQ C;  2DYS H;  3OIQ A;  5J1U A;  3BPX A;  1IV8 A;  5CJ9 A;  4CGZ A;  1D5V A;  1ZAO A;  4I7H A;  2DA1 A;  2F5D A;  4GFB A;  4O5V A;  2KRC A;  4U0W A;  3ZQL A;  1RR8 C;  3BR1 A;  3CQZ J;  3VEP A;  2IGN A;  3ABK H;  3KP5 A;  2LY9 A;  1VQ5 I;  2F6C A;  2LKX A;  3MKW B;  3ZMD A;  4E4H A;  1ETX A;  1IDZ A;  3IKT A;  4Q47 A;  3I4P A;  1YO5 C;  2LG4 A;  1KGS A;  4Y3O A;  5BPD A;  2P81 A;  2HPM A;  1UFM A;  2CQQ A;  4G8X A;  4U0V A;  3TOA A;  1IUF A;  3EUH C;  3JSP A;  2BY0 A;  2Q2E A;  3H3U A;  2XC7 A;  2EIM H;  4LMY A;  5HVQ C;  5JR3 A;  5TJJ A;  2DDB A;  2OD5 A;  1UJ8 A;  1XG1 A;  5D5U B;  1SFX A;  3F8B A;  5LBQ A;  2LOO A;  1SAN A;  5BPI A;  2KLO A;  4R8H A;  1G3T A;  2WC2 A;  5E1X A;  3EYY A;  5E3L A;  1B1B A;  4I09 A;  4KIS A;  2H6B A;  2K5C A;  1WGX A;  2Z3Y A;  2JPB A;  5KCM A;  3VYT B;  2P5L C;  3PUF A;  1VQM I;  1U8B A;  2BXZ A;  1AKH B;  3FXR A;  3ONQ A;  1YJN I;  1DPU A;  4MO7 A;  3ULQ B;  1HSJ A;  3FXK A;  1NHA A;  2JPC A;  3OIO A;  5DD8 A;  3CDH A;  2ZC2 A;  4XLA A;  1SD4 A;  5L3E A;  3H5A A;  2FOW A;  4JP0 A;  1GLN A;  4HA8 A;  4B48 A;  3IWZ A;  5EGO A;  4F55 A;  1HW2 A;  3GTJ J;  2OQR A;  4ZYA A;  1LJ9 A;  1HBX G;  3FWE A;  2O8X A;  3O2P E;  3A01 B;  1ZQ3 P;  4HG2 A;  4UUV A;  5AIQ A;  2VXZ A;  3BR0 A;  3FXQ A;  1RET A;  2NNY A;  3CC7 I;  3AG1 H;  3K70 C;  2LVS A;  1ZG3 A;  4LGW A;  1LE8 B;  1OR7 C;  3FXM A;  4BBS J;  4EJO A;  1GDT A;  2L4A A;  2Z99 A;  3EUA A;  3HOV J;  1BR1 A;  3CCY A;  4MTE A;  3VSK A;  5FD6 A;  5LGN A;  3SYT A;  2M1B A;  4E7J A;  4CYD A;  2IPQ X;  1TLH B;  2M8G X;  3DXJ F;  2ZXH A;  1IAW A;  1D5Y A;  1FBQ A;  4YII A;  3M1C A;  2DLL A;  1G59 A;  3E6B A;  1Z91 A;  5B3S H;  4X6A J;  3BTI A;  1U0J A;  2F5C A;  3CMA I;  1FOY A;  4P9F A;  2R4G A;  2X51 A;  4IHT A;  2EBI A;  2BXY A;  1VQ8 I;  5FKK A;  3ZMS A;  3V8K A;  3J7Y J;  2EPF A;  3KET A;  5TIS C;  2K9L A;  1MBJ A;  2E36 A;  1U5T A;  5EF6 A;  2XAJ A;  4ENJ A;  1RRJ A;  4UVC A;  1MH3 A;  4QWQ A;  3HOU J;  3EUK L;  4BYY A;  3F8M A;  3M7G A;  2DMN A;  4MEX F;  5LD2 C;  2XF6 A;  1Y1W J;  3DTE A;  1EV7 A;  2BVL A;  2L9S A;  3CDL A;  2VB6 A;  4AIH A;  3HOX J;  2LLK A;  1K79 A;  2VJI A;  4MEY F;  5DV5 A;  1BL0 A;  2JA8 J;  2K40 A;  1Y56 A;  3D5L A;  3F0C A;  3K4C A;  2FXA A;  4V19 K;  1U8R A;  2A69 F;  1RKT A;  4G7H F;  2MW8 A;  2LMD A;  1RUO A;  3E7L A;  5D5W B;  1G3W A;  2LRD A;  1I5Z A;  4EEF G;  2B63 J;  2E60 A;  1YS6 A;  2P4W A;  2EIL H;  1HDD C;  3GTG J;  5DUK A;  3ZPL A;  5EG0 A;  3CCE I;  4HF0 A;  3L9F A;  3R6S A;  3HIF A;  2R5Z A;  2V4J C;  4ESJ A;  2LSO A;  3IAM 2;  1YOV B;  1ZAR A;  1V4R A;  4YG2 F;  1HOM A;  3BWG A;  3RCO A;  1J0R A;  2JJ7 A;  2XSD C;  1DGW Y;  3IKV A;  1XS9 A;  4KIF A;  2COB A;  1F1Z A;  1V5E A;  2RAE A;  1BIA A;  4YRV A;  4QIW N;  2L7Z A;  3OYN A;  1NK2 P;  2ZNZ A;  2HVQ A;  5CQG A;  5ICC A;  1GVD A;  1TQI A;  3M3Y J;  2Y2Z A;  3IC7 A;  2NS8 A;  2R3S A;  3D1N I;  2DN0 A;  3I54 A;  2DA4 A;  3HJE A;  5HDK A;  4FTH A;  1AOY A;  2Z9O A;  3G3Z A;  3OIP A;  3F6O A;  3HGY A;  4HOB A;  1VF9 A;  3DEW A;  3V42 A;  3HSR A;  1J5Y A;  4ZJZ A;  5EDN A;  4RS8 A;  2X1E A;  4DNC A;  2WY8 Q;  5KAI C;  1WFX A;  1G6N A;  2PMH A;  1W36 C;  2BEO A;  1AHD P;  3PM1 A;  4Y13 A;  3LA3 A;  1PUF A;  3M9A A;  5D8L B;  3HM5 A;  3E5U A;  3P5J A;  1VTN C;  1IN8 A;  4D0P A;  2ACJ A;  1DP3 A;  3BG7 A;  2XKO A;  3I9V 2;  4PSW A;  5JHF A;  5EZH A;  2R0Q C;  1Y1V J;  5K7F A;  2I5U A;  4G7Z F;  2VQH A;  2NVX J;  2KHM A;  5B1A H;  4A2U A;  5BQT A;  2GM4 A;  3F9K A;  1D1A A;  2MD0 A;  1WJ5 A;  2NS0 A;  1J2X A;  3S3O A;  2VL8 A;  4BXX J;  2E1M C;  2K4J A;  3DQV C;  1P7J A;  3DP7 A;  1JHH A;  2PN6 A;  1MNE A;  4IOA F;  2BW3 B;  3F21 A;  3LSM A;  1QHH D;  3F8C A;  3KEQ A;  2R7F A;  2CFO A;  2HR3 A;  2K4B A;  2YR2 A;  3BR3 A;  3HBL A;  4HX4 A;  3JTG A;  2JA7 J;  1WJD A;  1ZLJ A;  1JTY A;  5EGO B;  3Q5F A;  1E3O C;  1R7J A;  1I27 A;  4CCL A;  2R7X A;  3PQJ A;  5JHU A;  1B72 A;  2BGC A;  4U7D A;  1I1G A;  4KUM A;  4WCG A;  5EZG A;  2BY2 A;  3I58 A;  1XMX A;  3TO6 A;  2W4S A;  3BPV A;  4A12 A;  2XPW A;  3PIO F;  1TL8 A;  3ZQC A;  5HNF A;  3VYU B;  1T56 A;  3N4M A;  4ZTF A;  5J4Y A;  1JKO C;  3WTT C;  4DJA A;  4B8X A;  2ECB A;  5FLM J;  4G7O F;  4C2U A;  1QBJ A;  4F92 B;  1R36 A;  2HQN A;  1RNL A;  3E5Q A;  2EZK A;  2VAS A;  4A69 C;  3K10 A;  3K70 D;  1X2M A;  1YQA A;  4ITV A;  2HVS A;  5CLS A;  1W5T A;  1YX5 A;  1UG0 A;  4FE4 A;  1FTT A;  2DA3 A;  3H9J A;  3VB2 A;  1N77 A;  4ZZL A;  1SVL A;  4CCM A;  2DA7 A;  4NNJ A;  3W2A A;  1P92 A;  5FRM A;  2WY7 Q;  2VLA A;  2DFH A;  4C2M J;  2P8T A;  4E7S A;  1Y0U A;  2ZB9 A;  1JKQ C;  1KYW A;  2P5V A;  2W1O A;  3S2D J;  3I5U A;  1NK3 P;  4KFC A;  3SQN A;  2VJ4 A;  3FKI J;  1LVA A;  5B66 C;  3KZY A;  2QEX I;  3WTV C;  2CUJ A;  2EFQ A;  3JRC A;  3ABU A;  2E7X A;  4BUP A;  3CCL I;  3V8J A;  2VKV A;  3VYR B;  3OWT A;  2W82 A;  3NRV A;  3GX4 X;  3QOE A;  5K5O A;  4RMN A;  2PMZ A;  4PJN A;  5D5X B;  2OAZ A;  3LA7 A;  3OYE A;  1E3P A;  2VBX A;  5AON A;  4AUX A;  1GV2 A;  2JUG A;  2HEO A;  1SVO A;  2DOE A;  3BZ6 A;  2ZSH B;  4I76 A;  1O3S A;  3QYB A;  5H20 A;  4KIC A;  1RUN A;  1D8J A;  4KYW A;  3QPH A;  4LLG F;  3F72 A;  2DQL A;  4PJL A;  3KE2 A;  3HC7 A;  4BJ5 C;  4MIM A;  1HQC A;  3ZMZ A;  5JVG F;  1DU0 A;  3QPS A;  4PGG A;  2CU7 A;  1TWG J;  1FY7 A;  2YX4 A;  4O3M A;  2HZD A;  3FF5 A;  3S2W A;  3SFI A;  5J8F A;  1ZRE A;  1YYV A;  4LLN A;  4XL9 A;  1T2K A;  1VQN I;  3Q0U A;  2D5V A;  4V2F A;  3DPL C;  3FK7 A;  2ME6 A;  1MND A;  2UV1 A;  4GYI A;  2LTP A;  3MVP A;  3V7R A;  3TW7 A;  2YU3 A;  5EEH A;  3WU2 C;  1KU9 A;  2QVO A;  2X6W A;  2TRT A;  2X6Y A;  5ERI A;  3RDI A;  3HHH A;  3HOZ J;  2RQP A;  1BW5 A;  3GCM A;  2OBP A;  2QQ8 A;  4DBR A;  5C3E J;  3ECO A;  4JQF A;  4RLQ A;  5JVT A;  3EPZ A;  4JOM A;  2DFE A;  4A5N A;  4HF1 A;  1OYI A;  3CMY A;  2IA1 A;  2RKH A;  2DU9 A;  5E20 A;  2EQR A;  1SD5 A;  2M8E A;  2XGX A;  2VKH A;  4D7N A;  3V4G A;  2HNH A;  3J80 K;  3HOW J;  1K83 J;  2K9Q A;  1PYV A;  2XGD A;  2F4O B;  5F1J A;  2VT3 A;  4E7I A;  2L7F P;  3CZ6 A;  2QUF A;  3O3K A;  3MKZ A;  2CG4 A;  1MBF A;  1T39 A;  1AKH A;  4IRH A;  3WOD F;  4MTD A;  1K4S A;  1SFU A;  2XHK A;  1A35 A;  1P6R A;  1OCC H;  4L0Y B;  4A0Y A;  2E7W A;  1JJ6 C;  4DQ2 A;  2WAQ A;  2DK8 A;  3JRA A;  5M5Y J;  3REO A;  2K3F A;  1OFC X;  3NWS A;  2XRO A;  3L2U A;  3PL8 A;  4QPQ A;  2VC1 A;  1ON2 A;  4UY8 I;  3LOC A;  4HBL A;  4XN3 A;  5CVJ A;  4GO1 A;  2XAG A;  2UZK A;  4L5I A;  2A5Y B;  3K4L A;  2M7B A;  1P4X A;  4CCJ A;  3CCS I;  4ESF A;  2FJ1 A;  1YIO A;  4NC8 A;  4U87 A;  3ELK A;  3ASO H;  4CYC A;  1H9G A;  1WQ2 A;  4M6X A;  1MGT A;  2V1U A;  1PUF B;  1ZN2 A;  4F7Z A;  2VBW A;  2KJC A;  2IAI A;  5FFZ A;  3RZD J;  3AL0 B;  1A5J A;  4II3 A;  2ID3 A;  3KPH A;  1KQ0 A;  4A6E A;  1IRZ A;  1SFK A;  6PAX A;  2HYJ A;  1RES A;  2MSY A;  2YU9 J;  5A2Q K;  3ZRG A;  1VQP I;  3ZMU A;  3RKW A;  4WXH A;  3U2R A;  4EJV A;  2FEZ A;  4LK0 F;  1HC8 A;  5L3G A;  3GTM J;  2Q0O A;  3CLO A;  1JI8 A;  1JHF A;  3T1B A;  3K69 A;  3K4N A;  2W7N A;  1FOX A;  3DEE A;  1X58 A;  3HKZ N;  2HVR A;  1TZL A;  5FKM A;  1VND A;  2FQ4 A;  1QZY A;  2X4H A;  1J9I A;  3LSI A;  2QYO A;  3GWZ A;  3QRF F;  4S0H B;  4BH9 A;  3VSL A;  1HLV A;  4RAZ A;  3S14 J;  2VQL A;  4C30 A;  1ZK8 A;  1JJ8 C;  1B72 B;  4WX9 A;  1F5T A;  2W25 A;  1X19 A;  3ZQG A;  2J5P A;  4A3B J;  2LBF B;  1H8A C;  1FP2 A;  2DDA A;  2OU2 A;  3QPT A;  2H1K A;  3HB9 A;  2PI0 A;  3JR9 A;  3RIR A;  2DT6 A;  2OV7 A;  2MGQ A;  1SD7 A;  2LF8 A;  2A07 F;  1XDU A;  4BDZ A;  2ZME A;  3H5N A;  2FBH A;  3OS2 A;  2DOF A;  4RBO A;  3TQN A;  3C7J A;  3BCA A;  1ETY A;  4AU7 A;  4DYR A;  4EM0 B;  1SVM A;  4KA4 A;  1FEX A;  2I8D A;  2M9H A;  1ZLK A;  4CCO A;  4CZC A;  2K9M A;  4ZDP A;  1UZC A;  1PP8 F;  3TO9 A;  3FIS A;  4J01 A;  3NEU A;  5DCM A;  1U9N A;  4BNC A;  5ILU A;  2M4G A;  2OQG A;  1P7I A;  1K61 A;  1I6H J;  3M4O J;  2CW8 A;  2M87 A;  1Z0X A;  2OPT A;  1YJW I;  3F8N A;  3CP2 A;  2YUS A;  3A2K A;  1JGS A;  4XBF A;  3LSH A;  4CUG A;  4X0G A;  3CME I;  2NS7 A;  1OCP A;  2V6E A;  1YRN B;  1UST A;  1S5L C;  4NQW A;  2RNJ A;  2GXG A;  4EM1 A;  4UV9 A;  4XRS G;  4BXF A;  2R5Y B;  1X3W B;  1TW2 A;  4N9H A;  3S3N A;  4XLN F;  4YIF A;  1L0O C;  4YFX F;  4EJU A;  2E2I J;  3H92 A;  4M3E A;  1J59 A;  4FT8 A;  1JE8 A;  4IZZ A;  3CO7 C;  3WHC A;  3MZY A;  1FP1 D;  2VC0 A;  4XRF A;  2KQR A;  1BBY A;  1LDK B;  2CYY A;  1TT0 A;  4R1H A;  5CVI A;  3SZT A;  4B44 A;  2ADU A;  4BY7 J;  1ZRC A;  4XRM A;  3QP5 A;  1D8K A;  2QQA A;  2W85 A;  1ETQ A;  2CW7 A;  3HKZ A;  2XVC A;  1YW9 A;  3J81 K;  4NBQ A;  4XKV A;  1N78 A;  4J19 A;  3C3W A;  1NG7 A;  4CCN A;  1LUJ B;  4ZYG A;  1QO0 D;  3K4J A;  1UHW A;  4KMF A;  5KHD A;  3SFZ A;  2A3S A;  2CV0 A;  1TWA J;  2XAS A;  3GZN B;  1R5I D;  1OCT C;  2CJJ A;  3QPL A;  2ZFW A;  1UG2 A;  3CCU I;  1EF4 A;  4OOI A;  2XF5 A;  1OMI A;  3HRM A;  2P7C B;  3S15 J;  1PJR A;  3KLN A;  2E5Z A;  5JLW A;  4B47 A;  2A6E F;  1JUP A;  3OYB A;  2KFD A;  1SFO J;  4JX4 A;  4BHB A;  4YFK F;  2IW5 A;  4ENK A;  3ASN H;  3PFI A;  2HU9 A;  3CJN A;  2LC2 A;  3LST A;  2HQA A;  3WHB A;  2VXD A;  4UNO A;  4RB2 C;  1AWC A;  1QGP A;  2EZL A;  4IPA A;  5J1R A;  3BR6 A;  2A68 F;  5K7H A;  4N9I A;  1ETW A;  5J8C A;  2Y9Y A;  2X6O A;  5FKN A;  1T38 A;  2VBY A;  4RLF A;  3OYF A;  3HUG A;  3WTX C;  1PP7 U;  3L7W A;  3LWF A;  1HCR A;  3DWL E;  3KCC A;  1MBH A;  1Z1D A;  4UVB A;  1WRJ A;  3QAH A;  1WPK A;  2P6T A;  3MEX A;  3E6D A;  1F43 A;  3OYA A;  1W5S A;  1QVU A;  4HV6 A;  2X48 A;  4BQQ A;  2DJI A;  2E71 A;  4Y33 A;  1W0T A;  2PFB A;  5ICE A;  1HKT A;  1QNT A;  2FNP A;  4BQN A;  1IRG A;  4MQ9 F;  1IO2 A;  1XC5 A;  2BV6 A;  4BAY A;  2FBK A;  3K4M A;  5HOD A;  1X1B A;  5EG0 B;  5M5X J;  2IS2 A;  2EFP A;  1OYW A;  3WTY C;  3OYI A;  3H5R A;  3OR2 C;  5E3M A;  1MJA A;  1W7P A;  3OY9 A;  3R60 A;  4PJM A;  4MLO A;  2KIF A;  2R7D A;  2RVC A;  2XDV A;  3A0B C;  2IVM A;  4XLC A;  5J47 A;  2EFW A;  1T0F C;  1WJC A;  1X4P A;  2V9P A;  3OSF A;  1D0X A;  1V3F A;  2H8W A;  3WTW C;  2DI3 A;  2VOD A;  1APL C;  1BI3 A;  3T5X A;  2BW3 A;  4UVA A;  3KEO A;  3G4S I;  3TMO A;  5AIP A;  3BG5 A;  3ZQF A;  3KP2 A;  3OMY A;  3CJQ B;  2NOG A;  3I0T A;  4OMY A;  4ABZ A;  1J09 A;  4GDF A;  2MYS A;  4EVI A;  2K3P A;  3R0A A;  1ZTR A;  2DT7 B;  4HLX A;  2V26 A;  1TNT A;  1W5C C;  3H9Q A;  3L2C A;  2W57 A;  3RQI A;  3BTC A;  1LFP A;  5D6F A;  5DUI A;  1V55 H;  2MAB A;  1ETV A;  5IT3 A;  4OMZ A;  3G71 I;  2LRE A;  4GYG A;  3SDB A;  3LQQ A;  4A6D A;  3GFM A;  4PDK A;  3QOP A;  2FQ3 A;  2K86 A;  1XMK A;  3FMQ A;  3HOY J;  3CCV I;  1WVR A;  2ISY A;  1MMS A;  5KAF C;  2QSG X;  2BHY A;  3ZP5 A;  2CQ7 A;  2HI3 A;  3RYR A;  1I50 J;  4BEH A;  1PUE E;  4BL0 B;  1U6G A;  1D3Y A;  2L7K A;  2HDD A;  3P9K A;  2KDZ A;  3C2G A;  5IP6 A;  5FLX K;  3CUO A;  3KYC B;  3JAM K;  1I3Q J;  2QGU A;  2IS6 A;  1G3Y A;  1ZHF A;  2K27 A;  2WTE A;  3ZOB A;  3MD2 A;  5CVV A;  4QSH A;  4EJW A;  2RV8 A;  4QLC U;  2DJN A;  2B0L A;  3PIP F;  2KDO A;  5H6Q A;  5C44 J;  1T33 A;  2HWV A;  4HX8 A;  3F23 A;  3SEZ A;  3FKJ A;  3R4K A;  3I55 I;  4ZYD A;  1FOW A;  3CF2 A;  1HW1 A;  5KVR A;  1LDJ A;  5DCM B;  2DMP A;  3IH2 A;  4M3F A;  5L3F A;  4JX6 A;  3DBR B;  3OOP A;  2BOL A;  1P2F A;  3M1E A;  4JBA A;  3E5X A;  4B4C A;  3FZV A;  3TED A;  2ZNY A;  3SEQ A;  1MBK A;  1Z9C A;  1VQ6 I;  4XQF A;  2Y48 A;  4AD9 A;  2FUG 2;  2XAQ A;  1MDM A;  3VFZ A;  1T8I A;  1OR7 A;  2LNB A;  4RAY A;  1FX7 A;  4L9N A;  3JRB A;  2HPI A;  5FLX Z;  1A6Q A;  3F22 A;  4XLH A;  1VQ7 I;  3ABM H;  3GBG A;  4NQW B;  3BOQ A;  2K02 A;  3RTR A;  1RZ4 A;  4C3J J;  1ETO A;  1RPW A;  1Z3X A;  1O4X A;  1O3T A;  5DM6 F;  4HNV A;  4FE7 A;  3A4C A;  1WI9 A;  4HW0 A;  5FFX A;  1YTY A;  1S6L A;  1Z67 A;  4HSR A;  4E7L A;  4A3L J;  3F8F A;  1UHM A;  4FX0 A;  2XPV A;  4NC6 A;  1I6X A;  2KIQ A;  2OA4 A;  2DMQ A;  2GXB A;  3BJ6 A;  5FKO A;  2CQN A;  3OYM A;  2ETH A;  5IYC J;  3HUG B;  2XB0 X;  3IWF A;  1GV5 A;  2H27 A;  1POG A;  5LHG A;  4BS9 A;  2Z5U A;  4XIC A;  2HZT A;  1R1T A;  4A3I J;  3ZXS A;  2E1M B;  5EEA A;  4A3M J;  2IRF G;  2VPL A;  2ZJ2 A;  2Y31 A;  5LGT A;  4Q4Z F;  2OJE D;  2EIK H;  4LIV A;  4DYQ A;  2NYX A;  5M3F J;  1SEU A;  3G1L A;  1K6Y A;  4EAT A;  1Y39 A;  3K2A A;  1W36 D;  2Y0M A;  2OTJ I;  4PGH A;  2ZJP F;  4IHV A;  2LYC A;  3A03 A;  3BLY A;  2JSP A;  2EK5 A;  1K4T A;  2FSW A;  3PNY A;  1TWH J;  1IG7 A;  2HDC A;  2UWM A;  4ENN A;  3DKY A;  1QA6 A;  4ZZD A;  3ZN1 A;  4ZH4 F;  4A3E J;  2WB1 A;  2KIM A;  3C1D A;  2NVT J;  4G6Q A;  3GW2 A;  1K78 A;  1W4M A;  3GZ5 A;  1G8X A;  2V9K A;  1XSV A;  5GPA A;  3ZGK A;  2FD5 A;  1DPR A;  5FO5 A;  2OZ6 A;  2O7O A;  5GTH C;  4OU0 A;  2L5Q A;  2ZJQ F;  2X0L A;  2VT2 A;  2KRH A;  4LK1 F;  1RKW A;  4GCV A;  2JK3 A;  2JSC A;  1BN5 A;  2I10 A;  1X1D A;  3ECH A;  2XB5 A;  3HHG A;  1XSD A;  1MMG A;  2F48 A;  2XGE A;  3V8L A;  3OS1 A;  3ZQ7 A;  5LEK A;  1JT6 A;  1U9O A;  4Y4R A;  5IY5 H;  2AHQ A;  2UXN A;  3FX3 A;  4KNY A;  1X3U A;  3I59 B;  1CGP A;  2FBI A;  3N05 A;  1QQI A;  4AYB N;  3TKY A;  2YPR A;  3ABL H;  2ZXW H;  1WJF A;  3DBH B;  3IL2 A;  4XKC A;  4G94 A;  1YI2 I;  1R9T J;  3CCQ I;  1E17 A;  3GTQ J;  2DQR A;  1R00 A;  5D6E A;  2W84 A;  1MZB A;  1SMT A;  1FC3 A;  1WSU A;  1A04 A;  4AC0 A;  4AM3 A;  2NAZ A;  1FMV A;  1VQO I;  2HKO A;  2Q1Z B;  2IP2 A;  1Z6T A;  2ZXI A;  3IAS 2;  3LAP A;  1MH4 A;  1CQT A;  2OCC H;  3WG7 H;  3PQK A;  2GZW A;  3KEY A;  2G7H A;  5DD4 A;  3HPH A;  2FA5 A;  3OL3 A;  2QF7 A;  2WWY A;  3RPU D;  4HF2 A;  5DYM A;  4UB6 C;  1J7K A;  2XKP A;  3O6B B;  2BY3 A;  3BR2 A;  3OYC A;  4BDY A;  1IV6 A;  4LD5 A;  2DOA A;  2RC4 A;  2EV0 A;  1D0Z A;  1FNN A;  2JA6 J;  5LRS A;  2W24 A;  4L9V A;  2PLY A;  3RZO J;  2VOP A;  3SXY A;  3WGH A;  5K1Y A;  3DV8 A;  2FE3 A;  5B1B H;  2NOJ B;  2M3A A;  3DKX A;  3HGG A;  4L5J A;  1OKR A;  1OJL A;  2DO7 A;  3MFK A;  5JFR A;  3BZK A;  4KDP A;  1G2H A;  1QZZ A;  1XGO A;  2VQG A;  4I99 C;  5DCF A;  5ILS A;  1BJA A;  1K6O A;  2M0C A;  2CV1 A;  3PO3 J;  2YSR A;  5F64 A;  1LE8 A;  3BQZ A;  5FRO A;  4DZP A;  1VQ4 I;  1JKP C;  2UUZ A;  3BR5 A;  5HS9 A;  3NAR A;  1ONV A;  2F5F A;  2XF7 A;  2R5Z B;  2RGV A;  1ODD A;  1K78 B;  5BS6 A;  2ELK A;  4ZTJ A;  4NHJ A;  1REP C;  4DIQ A;  3HRS A; 
#chains in the Genus database with same CATH homology
 1VND A;  5F08 A;  2DA1 A;  2FQ4 A;  4GFB A;  3ZQL A;  3BR1 A;  2ME0 A;  3CQZ J;  1ZR2 A;  2LY9 A;  2LKX A;  1IDZ A;  1ETX A;  4S0H B;  3JRF A;  5F0H A;  2O9L A;  2IBD A;  3S1N J;  4Y7N J;  1HLV A;  3S14 J;  2P81 A;  1ZK8 A;  1JJ8 C;  1B72 B;  2CQQ A;  2VI6 A;  3ZQG A;  2VUM J;  4A3B J;  1H8A C;  1IUF A;  4A93 J;  5FLV A;  4C3H J;  1VI0 A;  2H1K A;  3HB9 A;  3JR9 A;  2MGQ A;  2L0K A;  5FJ8 J;  1MSE C;  3Q3S A;  1NTC A;  1XG1 A;  2TCT A;  1HF0 A;  4RBO A;  1ETY A;  3FK6 A;  4DYR A;  1SAN A;  1FEX A;  2M9H A;  1Q1V A;  5E3L A;  1H89 C;  1WGX A;  5C4J J;  3FIS A;  1U8B A;  1TC3 C;  1U9N A;  1P7I A;  1AKH B;  1K61 A;  4W97 A;  1I6H J;  4MO7 A;  3L1P A;  3M4O J;  4V2G A;  3OIO A;  5E3N A;  1Z0X A;  2OPT A;  2YS9 A;  3OOU A;  2YUS A;  2NS7 A;  1OCP A;  4JP0 A;  1YRN B;  3OSG A;  5EGO A;  3MN2 A;  4XRS G;  2R5Y B;  4DYC A;  3GTJ J;  1B8I A;  2HXI A;  2E2I J;  1IDY A;  5IYB J;  3A01 B;  3RKQ A;  4M3E A;  4UUS B;  1ZQ3 P;  1MNM C;  3GTK J;  3BR0 A;  3WHC A;  1IJW C;  1RET A;  4UUS A;  4BY7 J;  1FJL A;  4XRM A;  2LVS A;  1LE8 B;  1ETQ A;  4BBS J;  1GDT A;  4J19 A;  1MBE A;  2R5Y A;  3BG3 A;  3S16 J;  2Y9Z A;  3HOV J;  3ZQH A;  3CCY A;  4A3C J;  1TWA J;  1OCT C;  2CJJ A;  3QPL A;  2M8G X;  4JX5 A;  1UG2 A;  1D5Y A;  1EF4 A;  1WCM J;  3S15 J;  4X6A J;  3BTI A;  2N8G A;  5JLW A;  1JUP A;  3HEF A;  3LNQ A;  4JX4 A;  1SFO J;  1U78 A;  2EBI A;  3NAU A;  2R93 J;  5FKK A;  3WHB A;  1GUU A;  5EYR A;  1MBJ A;  2AO9 A;  5EF6 A;  1MH3 A;  1WI3 A;  2EZL A;  3HOU J;  5J1R A;  3BR6 A;  5K7H A;  1ETW A;  2Y9Y A;  2X6O A;  2DMN A;  5FKN A;  4B1R A;  3IH4 A;  1Y1W J;  2GBY A;  1HCR A;  3CDL A;  1FTZ A;  3W6V A;  5F04 A;  1MBH A;  3HOX J;  2LLK A;  4D5C A;  1WPK A;  3JRD A;  1BL0 A;  2JA8 J;  1F43 A;  2K40 A;  4FIS A;  3LSR A;  1QVU A;  2X48 A;  1W0T A;  3F0C A;  4A3G J;  5IOY A;  1RKT A;  2MW8 A;  1XC5 A;  4L5E A;  3O8G A;  3E7L A;  1JKR C;  5HOD A;  5EG0 B;  5M5X J;  2B63 J;  4EEF G;  1LFB A;  2DA5 A;  1HDD C;  2CRG A;  3GTG J;  5E3M A;  1FIP A;  5EG0 A;  2JWT A;  4MLO A;  3BTJ A;  2R5Z A;  2CUF A;  5J3L A;  1HOM A;  3OSF A;  1HDP A;  1APL C;  2JJ7 A;  2XSD C;  3BT9 A;  2NVQ J;  3B6C A;  2EZH A;  4IHW A;  1XS9 A;  2COB A;  2ECC A;  2W48 A;  3BG5 A;  3ZQF A;  3S1M J;  2NOG A;  2EZI A;  4G12 A;  2HQ5 A;  4ABZ A;  2RAE A;  4QIW N;  2L7Z A;  1NK2 P;  4D5F A;  1ZTR A;  2G0E A;  1GVD A;  3M3Y J;  2Y2Z A;  2NS8 A;  3RQI A;  3D1N I;  3BTC A;  2DN0 A;  2DA4 A;  4FTH A;  3HGY A;  1VF9 A;  3DEW A;  5C4X J;  1ETV A;  1ZGW A;  5EDN A;  2LP0 A;  3GTL J;  3JRE A;  5DTD A;  2X9D A;  2L9R A;  2XPU A;  3HOY J;  1AHD P;  2IEK A;  3LSG A;  3PM1 A;  3H3V K;  5M5W J;  1PUF A;  3HM5 A;  1ZKG A;  1BW6 A;  2HI3 A;  2DA6 A;  3O8H A;  1I50 J;  1MBG A;  4B3A A;  5EZH A;  4C3I J;  2HDD A;  3BTL A;  1QRY A;  1Y1V J;  5K7F A;  2KDZ A;  2R0Q C;  3GTO J;  4DW6 A;  2NVX J;  2KT0 A;  5IP6 A;  1ZR4 A;  2WB1 N;  2GM4 A;  9ANT A;  5JLX A;  1I3Q J;  1ETK A;  3G1O A;  4BXX J;  3ZOB A;  1P7J A;  4QSH A;  5IP7 J;  3B6A A;  3QQA A;  1BA5 A;  2M2E A;  2DJN A;  2OF7 A;  5C44 J;  1T33 A;  3TW6 A;  3BR3 A;  3HBL A;  2K9S A;  2JA7 J;  2FX0 A;  1JTY A;  5EGO B;  1E3O C;  2DMP A;  3IH2 A;  4M3F A;  4JX6 A;  3C2B A;  1B72 A;  4IHY A;  1JUM A;  5IPA A;  4B4C A;  3JRG A;  1JGG A;  4IHX A;  5EZG A;  3MKL A;  3TED A;  2PMZ N;  1MBK A;  4UUT A;  2XPW A;  3ZQC A;  1FIA A;  1AU7 A;  1ITY A;  1T56 A;  3I4M J;  5IOZ A;  1JKO C;  1JT0 A;  2ECB A;  4M3D A;  3JRB A;  5FLM J;  2E2J J;  1TWF J;  3GBG A;  1TWC J;  2EZK A;  1JTX A;  4C3J J;  1ETO A;  4A69 C;  1RPW A;  1O4X A;  2HOT A;  1X2M A;  4HNV A;  4FE7 A;  2E2H J;  4IEJ A;  4FE4 A;  4QTR A;  1FTT A;  3A02 A;  3S1Q J;  2DA3 A;  4A3L J;  2DA7 A;  2M34 A;  2NVY J;  5IYD J;  3JRI A;  2XPV A;  3VPR A;  2K9N A;  2DMQ A;  4C2M J;  5FKO A;  4XRS A;  2QCO A;  2JA5 J;  5IYC J;  3S1R J;  2XB0 X;  2ZB9 A;  4DZJ A;  4A3K J;  1JKQ C;  1W0U A;  2L7M P;  5GP9 A;  3S2D J;  2R7Z J;  1NK3 P;  1GV5 A;  4FCY A;  3FKI J;  1POG A;  3S17 J;  4XIC A;  3JRC A;  4A3I J;  4A3M J;  5EEA A;  2CUE A;  5BNG A;  2VKV A;  2Y31 A;  4MFD A;  2DA2 A;  2DMU A;  5K7Z A;  5M3F J;  4DYQ A;  3IH3 A;  4BBR J;  4XID A;  3G1L A;  4XK4 A;  3K2A A;  3SJM A;  1UMQ A;  4IHV A;  3A03 A;  1GV2 A;  4AUX A;  5E3O A;  1F36 A;  2XGC A;  4I76 A;  4A3D J;  1TWH J;  1IG7 A;  3FIW A;  3DCF A;  2CQX A;  4RDU A;  2JMW A;  3Q0W A;  4A3E J;  3TP3 A;  2NVT J;  2VKE A;  4Y52 J;  5IP9 J;  5GPA A;  3LSJ A;  4CYC B;  4MIM A;  2FD5 A;  4BY1 J;  2O7O A;  5DS9 A;  1DU0 A;  2H8R A;  3QPS A;  2CU7 A;  1TWG J;  5F0F A;  3A01 A;  2HXO A;  2DTZ A;  3UKG A;  4X1E A;  3Q0V A;  3BG9 A;  1RKW A;  2JK3 A;  1QPI A;  2WAQ N;  3SFI A;  3I4N J;  2I10 A;  2GLO A;  4M6V A;  2XB5 A;  1S7E A;  3Q0U A;  4V2F A;  4W1U A;  2D5V A;  2XGE A;  4MFE A;  3FK7 A;  2ME6 A;  5M3M J;  2LTP A;  1JT6 A;  5GPC A;  1U9O A;  3MVP A;  3TW7 A;  1VFC A;  2E19 A;  2AHQ A;  3HDD A;  4D7M A;  2ID6 A;  2TRT A;  1WH7 A;  4AYB N;  2O8K A;  3HOZ J;  1BW5 A;  1X2N A;  5C3E J;  1R9T J;  2HOS A;  3GTQ J;  3PO2 J;  4A3F J;  3CMY A;  5F27 A;  2Y0S N;  1WH5 A;  4AC0 A;  4A3J J;  3K7A J;  2LR8 A;  2EQR A;  4D7N A;  2VPR A;  3HOW J;  1K83 J;  2K9Q A;  4M3G A;  2XGD A;  5F1J A;  1CQT A;  1MH4 A;  4NDL A;  2L7F P;  1Z77 A;  5J1Y A;  2LK2 A;  1MSF C;  2R92 J;  1UHS A;  2XRL A;  1ENH A;  2QF7 A;  1MBF A;  4M3B A;  1DU6 A;  1AKH A;  2HOA A;  3SDG A;  4LOC A;  1JJ6 C;  3BR2 A;  3LSP A;  3JRA A;  3H0G J;  5M5Y J;  1IV6 A;  3S2H J;  1OFC X;  5FKL A;  3ZQI A;  2WV1 A;  3LOC A;  1BJZ A;  2JA6 J;  4BKX A;  3RZO J;  1GT0 C;  2FJ1 A;  1QVT A;  3G1M A;  1ORK A;  4CYC A;  2MG4 A;  2Y30 A;  1RR7 A;  1PUF B;  1A6I A;  3HGG A;  1OJL A;  1B8I B;  2IAI A;  3TP0 A;  3RZD J;  3GTP J;  4JYK A;  2DMT A;  1G2H A;  1IGN A;  1A5J A;  2E1O A;  2ID3 A;  3JRH A;  1IRZ A;  5F0C A;  2HYJ A;  1IC8 A;  1RES A;  2MSY A;  1YRN A;  2YU9 J;  2M0C A;  3PO3 J;  2LFB A;  1LE8 A;  3BQZ A;  4DZP A;  1JUS A;  1H88 C;  2EH3 A;  1JKP C;  4I6Z A;  3BR5 A;  3NAR A;  3GTM J;  2JN6 A;  2R5Z B;  2LD5 A;  3BQY A;  5J1U A;  3IV5 A;  2ELK A;  1X58 A;  3HKZ N;  5FKM A;  1LFU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...