2MEV1

Structural refinement and analysis of mengo virus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
268
structure length
268
Chain Sequence
GVENAEKGVTENTDATADFVAQPVYLPENQTKVAFFYDRSSPIGAFAVKSGSLESGFAPFSNKACPNSVILTPGPQFDPAYDQLRPQRLTEIWGNGNEETSEVFPLKTKQDYSFCLFSPFVYYKCDLEVTLSPHTSGAHGLLVRWCPTGTPTKPTTQVLHEVSSLSEGRTPQVYSAGPGTSNQISFVVPYNSPLSVLPAVWYNGHKRFDNTGDLGIAPNSDFGTLFFAGTKPDIKFTVYLRYKNMRVFCPRPTVFFPWPTSGDKIDMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
total genus 43
structure length 268
sequence length 268
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev100
1VBB2 1K5MC 1TME1 4WM8C 1PO23 5DDJ2 2RS13 2XBO3 1C8M1 1AR82 4IV1C 4Q4X1 1NA1C 2RMU3 5L7OA 1R1A1 4GB33 5ACA3 1RUD3 3VBRA 1CD3G 1TMF2 1H8TA 1RUF2 3ZXAC 1PO11 5BNPB 1DDLA 1OOPC 4NWWA 4IV1A 1HX6A 1BEV1 1ZBE2 1ZBA1 4RS5B 1HRV2 1AR72 1AUYA 2WFF3 2WS92 3VBUC 5FMOL 5C9AC 4FSJA 1B35C 1IHMA 4Q4V3 1OOPA 1VRH1 4JGYC 1V9U2 2FZ2A 1RUI1 3NAPC 4YVWA 3JB4C 2HWC3 2RMU2 3VBUA 1FPN2 1BBT2 2RS33 1NCRC 4QPIA 1QQP2 1B35A 5CFDB 1AL23 2ZTNA 4WM7A 1RUJ1 3VDDC 5BNOB 1QJX3 4IV3B 2HWD3 1QJU1 3S6PA 4Q4Y1 1RHI3 1PGL2 4RR3B 5JZGC 3TN93 1RUE2 2Y26A 1POV0 4RFT0 4RHV1 1AL0G 1PIV2 1EV12 2WWSA 2R043 1RUC3 5FOJB 1HRI1 1MQTC 4CDWC 4GH4C 1PGW1 4CEWC 3J8F3 5A33A 2BFUL 3JBG1 1AYM1 3ZFFA 4RQPB 1RUG3 2RS51 5J98B 4CDXB 1RHI2 3JD73 1VBC1 5CFCC 1MQTA 4CDWA 2HWF2 3VBSA 1AR93 1COV1 2WLPA 1ASJ3 4CDUB 5D8AB 1VBE1 1NCQB 4Q4W1 3ZFGB 5BNNB 2FZ1A 2HWB3 1VBB3 2X5IB 5DDJ3 3VBFC 2MEV3 1D4M1 1FMD2 4LLFA 2RM22 2HWE1 2BBVA 1AR61 1AR83 1VAKA 5ABJA 1MEC1 3DPRB 3FBMA 2R071 1TMF3 5A32B 1FOD1 3VBFA 1ND3A 1RMU3 5K0UB 1RUF3 1QJZA 5FMOS 1ND2B 1ASJ2 4N43B 1HRV3 5L7OC 2WS93 3VBHB 2PLV3 2HWB2 1PO21 4CDQB 2R062 1PVC2 2GH8A 2XBO1 2RS11 3VBRC 2RR12 2MEV2 5C8CB 1H8TC 1HXS2 1W39A 1V9U3 5BNPA 1R091 1VBD2 5AC91 4N53B 1RVF2 4GB31 5ACA1 4RS5A 1RUD1 1FPN3 1BBT3 1QQP3 1RMU2 1F2NA 4BCUA 2WZR2 4Y4YA 5CFDC 1M06G 3ZFEB 1TME3 4YVWC 2WFF1 2PLV2 4QPIC 5BNOC 2GSYA 4AEDB 4Q4V1 2QQPA 5CFDA 1RUH2 1GFF2 4RR3C 1RUE3 4WM7C 2HWC1 1R081 4SBVA 4GMP3 1PIV3 1EV13 4CEYB 1OHFA 2BFUS 5BNOA 1AL21 1K5MB 4WM8B 4RR3A 1QJY2 1EAH2 1Z7S1 1TME2 1QJX1 2HWD1 1C8M2 1NA1B 1RUI3 1VBA1 3TN91 2HWF3 4Q4X2 1R1A2 1SMVA 1NY71 2R041 3VBFB 3ZFFC 1PO12 1RUC1 4RQPA 5BNNC 1ZBA2 1BEV2 5C9AB 1FMD3 4CDXA 3VBSC 2RM23 3J8F1 3IDEA 4FTSA 4JGYB 1F8VA 1RUG1 3NAPB 4CDUA 5D8AA 1NCQA 1VRH2 3JD71 5BNNA 1RUI2 2X5IA 1AR91 1NCRB 2ZAHA 1BMV1 4JGZB 3VBOB 1AYN1 5ABJC 1ND2C 3DPRA 4FTBA 1VBB1 1OPOA 5J96B 2R063 1PVC3 5DDJ1 3VDDB 2RR13 2XPJA 1ND3C 3VBHC 5A32A 1Z7S2 1HXS3 1RUJ2 5K0UA 3JBG3 1AR81 1POV3 5JZGB 1VBD3 1ND2A 1QJU2 1RVF3 4Q4Y2 4N43A 4N53C 2ZZQA 1TMF1 1RUF1 3VBHA 4CDQA 4QPGB 2WZR3 5C8CA 4RHV2 1ZBE1 3LOBA 1HRV1 5BNPC 4GH4B 4CEWB 1AR71 2WS91 1HRI2 4N53A 1D4M3 3ZFEC 4RS5C 1PGW2 2IZWA 5C4WB 1RUH3 1V9U1 3JBG2 1AYM2 4AEDC 5CFCB 2TBVA 4Z92B 1NOVA 2RS52 2RMU1 4PDWB 1FPN1 1VBC2 3ZFEA 1BBT1 1QQP1 1COV2 2BPA2 1VB2A 1NG0A 1C8NA 4AEDA 1VBE2 4Q4W2 1QJY3 1EAH3 3M8LA 3CJIB 1D4M2 1C8M3 1PGL1 4CEYA 1WCDJ 1R093 2HWE2 1AR62 4YVSB 4IV3C 5AC93 1MEC2 2VQ0A 4Q4X3 1K5MA 1R1A3 1RUE1 4WM8A 2R072 4GMP1 1FOD2 1PIV1 1EV11 2RS31 1PO13 5L7OB 4IV3A 1BEV3 1NA1A 1ZBA3 3VBRB 2BUKA 1H8TB 1PO22 1HQNA 2RS12 2XBO2 4IV1B 1VRH3 1RHI1 2DF7A 4GMP0 4RQPC 1R092 2HWF1 5AC92 1R083 3JB8A 4CDXC 4GB32 5ACA2 5C9AA 1RUD2 4JGZC 3VBOC 1RB8G 1OOPB 4Y5Z0 4JGYA 4YVWB 4CDUC 5D8AC 3NAPA 1NCQC 3ZFGC 3VBUB 1FMD1 1VB4A 1Z7S3 2X5IC 1RUJ3 2RM21 4QPIB 1B35B 2WFF2 1NCRA 4JGZA 1QJU3 3VBOA 4Q4Y3 1VBA3 4Q4V2 3DPRC 4WM7B 1A6CA 3ZFGA 3VDDA 2HWC2 1E57A 1R082 4RHV3 5K0UC 1ASJ1 4QPGC 2RS32 5JZGA 5LK7B 1AL22 1HRI3 4N43C 2HWB1 2R061 1PVC1 1X33A 2MEV1 2RR11 1HXS1 4CDQC 5C4WC 1POV1 1AYM3 1QJX2 1VBD1 4QPGA 5C8CC 2HWD2 1RVF1 2RS53 4GH4A 1VBC3 1VBA2 4FTEA 4CEWA 3TN92 5A33B 4PDWC 1COV3 1RMU1 1AYN3 2WZR1 3ZFFB 3HAGA 5GKAC 1NY72 5C4WA 1VBE3 2R042 4Q4W3 1MQTB 1RUC2 4CDWB 1CJDA 3VBSB 5CFCA 2PLV1 4PDWA 3CJIC 2HWE3 1AR63 3J8F2 1RUH1 1MEC3 4NWVA 4YVSC 1RUG2 2R073 3JD72 1FOD3 5ABJB 1AR92 1BMV2 3CJIA 4EJRA 1ZBE3 1AYN2 4CEYC 1AR73 4YVSA 1QJY1 1EAH1 1ND3B 1X36A
chains in the Genus database with same CATH superfamily
1VBB2 4K8RB 2GMEA 2AUYA 1PO23 4HVQA 2XBO3 4FPGA 2VNVA 4OZXA 2PAEA 2HBUA 5H9QA 4X6RB 2QQOA 1UWWA 2DTYA 2YC4A 5BYNA 2JG9A 3AZVA 2VUAA 2W52A 5FO7B 5LA0A 1F4HA 4QD2A 1O3RA 2XG3A 3OPZA 4IERA 5FPUA 2RMU3 4L8QA 3AKQA 3LIHA 1SFYA 3KCYA 3VD5A 4DOUA 5HV0A 3MO4A 3VBRA 2B45X 1HN0A 3D82A 5GALA 1WCSA 3ITQA 3TEZA 1H8TA 4O9EA 1RUF2 2W5FA 3KMHA 1RL3A 2ZEZA 2ADEA 3D0JA 1Q8OA 1OMIA 1RJ8A 1OOPC 2CHHA 2R30A 2QKDA 2WWUA 2FD8A 4JDMA 3ETQA 1ZBE2 1BEV1 4NAMA 2W9XA 1H1AA 1QXRA 5GZGA 1AUYA 3GYDA 3P1IA 2ERFA 5CVRA 3DXTA 5FMOL 3BTAA 4AWDA 5C9AC 3HMYA 1U12A 2YMZA 2RE9A 3K4ZA 3B69A 4IEPA 4Q0SA 3VZNA 1SBEA 2CGOA 4BH9A 5FPBA 1YHFA 1OOPA 2GNDA 3NKGA 1ULPA 1V9U2 2J1TA 4W65A 1RUI1 3RJ2X 2BBAA 5K8SA 2FZ2A 3RZJA 1AXZA 3NAPC 5FJHA 3ZN4A 3ZSJA 2RJLA 3EYPA 3UGFA 1HB3A 1WD4A 2OQ7A 5A3UA 1UOGA 5EWSA 4Y1ZA 4ARXA 2BNMA 5A3MA 3VD4A 2XUEA 3KCXA 2Q8EA 1DIWA 3N4MA 1YC61 1GWLA 1YLLA 3HIFA 4QQHA 3TNPB 3VLBB 4IEVA 1ZZ6A 5IVJA 4TLFA 1NLQA 1ULGA 4QQPA 3H1WA 3G7DA 4OI1A 3WNPA 4D6RA 2WFPA 3JU9A 1L7RA 1TG7A 1UY4A 4BOWA 2H0BA 2PHFA 3AVRA 3PTRB 1YCIA 2BNNA 2EAAA 4IV3B 2NMNA 5KXDA 2D6PA 2JENA 3UJQA 2LTNA 1RHI3 2R0FA 3BKZA 4RR3B 5FYCA 2IXJA 1ZREA 3CDZB 1MS1A 1UIKA 2AZ5A 4XDPA 4XPVA 4DY5A 2BWAA 3N35A 4BQ3A 1HLCA 1JZ7A 1RIRA 2Y26A 1POV0 1AL0G 2D6LX 4NMIA 4UT5A 1EV12 2WWSA 2R043 1IGOA 2BWCA 4L99A 4CA9A 2ZGSA 3R4SA 4LE4A 1DQ2A 1G9DA 5FOJB 4UAPA 1W9YA 1FV3A 2YPJA 1MQTC 3NNFA 4RD7A 4CDWC 2VW2A 1PGW1 3T2QA 2D3RA 1UZWA 5A33A 1GOHA 1UO9A 4YSFA 2YGLA 4RQPB 3SEPA 5FZGA 3WT3A 2Y0IA 2VXJA 2RS51 1Q3EA 5A3PA 1PK6A 3THDA 2XR4A 2DTWA 3JD73 5SV8A 3TAYA 1MQTA 1KS4A 4CDWA 1QH7A 3SCGA 2BGPA 4K1ZA 1F35A 5L9BA 3WDXA 1ASJ3 1LB2A 3AYCA 4XZUG 4XF0A 1PGSA 2JE7A 1RGSA 5LA9A 4Q4W1 1CONA 3MI8A 2HWB3 2YG0A 3M2MA 4FXGB 2SLIA 5DDJ3 2MEV3 3CKHA 2ARBA 1D4M1 2VC9A 5DUXA 3N9PA 1DHKB 2RM22 4CXYA 4JKMA 3KVAA 1AR83 1YXWA 5ABJA 1Q8PA 5CADA 3JXSA 2VU9A 3FBMA 2IXLA 1O91A 1UYXA 3MIGA 1H8VA 1GZ9A 4D0QA 4F3JA 4NIDA 3JUUA 3CO2A 4RL7A 2CTVA 5F5AA 4Z2WA 3NNJA 4IE4A 4K6BA 4XYXA 4GWMA 3VKMA 4CCCA 3LZZA 3MW2A 3E97A 3WVJA 5FMOS 2LUWA 2DUPA 4DO0A 1DF0A 4AE2A 5HCFA 3S5AA 4PBOA 2O8QA 1Q43A 4HKOA 4QX5A 2JDZA 1L7QA 4XDOA 2WNUC 1FYUA 3O7OA 2PLV3 3ZYPA 4CDQB 4JQTA 2RS11 3MUY1 2RR12 5C8CB 2QNKA 2BOIA 5CIRA 3HT2A 3P3NA 2CDPA 3MDPA 1BJQA 3O5SA 4IXLA 1K12A 4LT5A 1BYHA 1S2EA 2F6BA 1W99A 1H6YA 4AGVA 3UGHA 4XUNA 5JPMB 2G19A 4XTPA 3EQEA 3FX3A 2QQUA 5FCCA 2ARXA 5A7PA 4JDOA 4IEUA 4NPLA 4BCUA 1LJ7A 1PZ7A 4LEJA 3FL7A 2VW1A 4YZ4A 3ACIA 2Z2SB 2NYYA 4FPJA 3S30A 1TME3 4HSJA 5JMCA 1DQ1A 3BTYA 3LA7A 3RYKA 3T1LA 1OPMA 4HSLA 1HDKA 3CHXA 3HD8B 1DYOA 1G9CA 4LA3A 1E5IA 4AI8A 3M7AA 4H7MA 2GSYA 5JXJA 1RUH2 2B39A 4OI0A 4B1LA 1GBGA 4AEMA 1C5HA 5A1FA 5IAXA 4AFBA 4FCAA 1CR7A 5FZ1A 5IJRA 1NXD1 2IVJA 1OKOA 1PIV3 2NLRA 4BQYA 3E6BA 4E2SA 4CEYB 3DYOA 2D6MA 5FQ0A 1OHFA 4CUGA 3IPVB 5LBCA 2P4EA 1WWYA 2XL9A 1AL21 4YPJA 4XOGA 4B3NA 2LROA 5FLJA 4WM8B 1CZSA 1QMJA 4CP0A 4NIIA 2BU9A 5EP9A 5DZFA 2PAKA 4IESA 1GNYA 1QJX1 2K46A 3C7GA 3EBRA 2B9UA 4AVAA 4XFBA 2DURA 1HB2A 3PJQA 3HQRA 2YBPA 3H3ZA 3R05A 5GLTA 3TN91 2HWF3 5FZLA 1JZ2A 2JX9A 3O1TA 2FDHA 5E88A 4IDZA 1GQGA 3I97A 1UMZA 3BOPA 1SMVA 3SXWA 5IVCA 2WRAA 3WQ1A 3S7EA 3EB7A 2UWCA 5KHJA 3RGBA 3VDCA 4MVTA 2AREA 1PO12 2ZZJA 1RUC1 3POYA 4I0BA 3S7IA 1N1SA 4YARA 4E4HA 2GNTA 1HV1A 1A3KA 1L7LA 1AHSA 3AMQA 3NV1A 1FMD3 2W68A 2XOMA 3Q8EA 4ZS3A 1ZRIA 3A22A 4LBLA 4AG4A 1RXGA 3J8F1 3IDEA 4FTSA 4TYSA 2EA7A 2WDBA 3SH5A 4JGYB 2X10A 5EXOA 1S0BA 4CCOA 1YQ5A 2WUHA 3WNXA 1DGRN 1U5IA 3HBKA 4LBQA 4O65A 4LHSA 1W6NA 2OKXA 5FTTC 1ONAA 4QHBA 4QGNA 3POEA 4GWNA 2A3WA 2AGSA 1CAVB 1QF3A 3HNYM 3A0NA 2JIJA 3LEMA 1XC6A 2VZRA 2WQ4A 4IQPA 1V00A 3BCWA 2HEYF 5ANQA 4BISA 3OB8A 2QUOA 3BYWA 3T4HB 2D40A 1S1AA 1ND2C 3HEIA 3NQHA 1LCLA 2VBPA 4FTBA 5LRSA 2WZEA 3EHKA 1LGBA 2GH2A 2NMOA 2Y34A 5D21A 3I49A 4Z1VA 4XMIA 5FZCA 5IVEA 3K2OA 3C7FA 3T1MA 5L9VA 1POV3 1ULOA 1CIYA 2FMDA 3AMPA 1ND2A 1Q8SA 3ME2A 4Q4Y2 4N43A 3B02A 3IKWA 1S0CA 2H6CA 2ZS6B 4N53C 4YW2A 3DYPA 1TMF1 1G9AA 3O1UA 4YM0A 4CUCA 2WZR3 2GN3A 2BDRA 3S0MA 2GDFA 3MW4A 5ISLA 5FUIA 3KGLA 1HRV1 1NQJA 3FLRA 5F5IA 4XJUA 3AZZA 2C9AA 2W39A 2WS91 4N53A 3IB3A 4HMZA 4W6XA 4OQ9A 3AC0A 4DEVA 1XPWA 2IZWA 5EFUA 1CN1A 3Q8CA 4XBQA 2BGCA 2JG8B 5E89A 4QMAA 2CNAA 2FCTA 4AEDC 5CFCB 4MXWA 3HQXA 1FI2A 3O1RA 2YGMA 4BM8A 2GC0A 1ZZ8A 2VCAA 3L2YA 2RMU1 5CAZA 4Q1RA 1VBC2 5FKCA 1BBT1 1VAVA 1QQP1 2VTXA 3ASIA 4MLOA 4ISQA 3WQ0A 1TQ5A 1KDMA 2GAUA 2VTFA 1IOAA 3M3EA 4W4ZA 3B5LB 1DZQA 2I2SA 4AEDA 5J36A 2ZABA 2QDNA 1O4ZA 1SBFA 1KD7A 3M8LA 1OQ1A 3NJYA 4JC1A 1XBFA 2W94A 5FUPA 2C24A 2YHJA 2KA3A 3N9QA 2XJSA 1O59A 5FZKA 1YFXA 2BZDA 4R4ZA 4YW1A 1PGL1 1XE8A 5FY0A 5A7WA 1R093 2ENRA 4YVSB 4IV3C 3NSTA 2LRPA 1V0AA 2VQ0A 2ZGKA 5CU1A 2ZHKA 3LFIA 4CXWA 5EQUA 1NX9A 2V4VA 2FDIA 1RUE1 2R072 2PTMA 2HLEA 4DZGA 3ZXLA 2ETEA 4GMP1 1J3PA 4TZDA 4Q27A 2JG9B 3USSA 3VB9A 4BQ4A 1UNBA 2VMGA 3WDVA 1JS9A 1GSLA 4IV3A 4Q26A 1BEV3 3B93A 3W21A 3POJA 4BZ4A 4ES9A 4H3WA 3PU8A 3VBRB 1NE4A 1P8JA 1K3IA 2VZSA 1H8TB 3VZLA 2ZGPA 4XJAA 2GC2A 4S2GA 4DEQA 2PHUA 1XYPA 4RYDA 3I2DA 2P3YA 4CU9A 5FY4A 2ORZA 1GP4A 4IEXA 4JHTA 2WINB 4YZ3A 5JOXA 1PMJX 3E5UA 5FREA 1RHI1 1SLCA 1Y3TA 2DF7A 1YO8A 1UPIA 3IN9A 3J9SA 4L92A 4RQPC 5GZEA 1FNZA 4Z8BA 1OT5A 4I0WB 5C3OA 1R083 2A6WA 1EPWA 2WQZC 1WMXA 5C5UA 4GB32 4Q2FA 4FOYA 3EXUA 5ACA2 1QNWA 1UQXA 3WNOA 2W47A 3LAGA 5FYTA 2P17A 1W03A 2QZ3A 3VBOC 1WLTA 1OOPB 4YYOA 4DFSA 4ZU4A 4JCKA 1H4HA 1SCSA 1QOSA 4Q8KA 2JDMA 5C7GA 1WA6X 4PQ9A 4GULA 1CAXA 5C3SA 3KSCA 5FR3A 4Y3OA 3WNNA 5FPLA 4OHVA 5HXVA 1LOCA 2WFF2 5C3QA 1NCRA 3OUIA 4EZHA 3Q8AA 5G04L 4GKYA 3VBOA 3W59A 3HOBA 2JWPA 5E16A 1VBA3 1GOFA 3OEBA 4FFHA 4G9SB 3HN1A 1LGNA 4L2NA 2GP3A 4ZZ8A 4YM3A 1A6CA 3RZKA 1H2LA 2WSUA 1MS9A 3DCQA 4QM8A 2VZUA 2X53S 3AKSA 2HWC2 1E57A 3VDDA 5I91A 1ASJ1 4V1PA 3ST7A 1SPPA 1K45A 3VV1A 1UZYA 4H2AA 1JYIA 4Y33A 3EMRA 5JZGA 2FCUA 4R9BA 2HWB1 4COWA 3TEWA 2YB7A 3Q8FA 4MOAA 2MEV1 4LTAA 2MHFA 1HXS1 2D44A 2RJKA 2WAOA 4QAWA 5DUUA 5FP3A 3V65A 4CDQC 1UU4A 4D3WA 3I2HA 5C8CC 1QWRA 2QBXA 3U07A 4D7TA 3LDBA 4TWTA 4I2OA 1OH4A 1RVF1 1W6OA 2RS53 4HVOA 3T0DA 2ZGLA 3RVHA 2I74A 1S0GA 1XXNA 4FTEA 1G86A 4CEWA 1SDDB 2P3KA 3MGUA 4PDWC 4QM9A 5A33B 1AYN3 5FPZA 5IUQA 3ZO0B 5D1IA 5FFOC 3KWVA 3SEEA 4YW3A 1XE0A 1AJKA 3ZMOA 1PK6B 3BB6A 4XFGA 2F4LA 4Q4W3 2RDRA 4S2HA 4QU2A 3VZOA 4XXPA 5HCHA 1MQTB 2V73A 4BK5A 1CJDA 3KD4A 4CDWB 2YXSA 2ATFA 4JKLA 4URTA 3U4XA 4V2WA 1E5HA 2PLV1 3H3LA 5JSPA 3A21A 4PDWA 1D0GA 2B9VA 5E6HA 1GQHA 2YFZA 4D8MA 3NMBA 1RUG2 3IT8A 3LDRA 2JKXA 2C1FA 4KQ7A 4MGTA 1Q8QA 1J59A 4AI3A 3K75B 2A7AA 5FY7A 4FBFA 4HETA 2XKPA 3AL5A 1I9RA 5ABJB 5IK4A 1O3TA 3OPWA 3RMYA 4GAZA 3T2TA 1GR3A 1YQ6A 1ZBE3 5F3IA 4CEYC 4AVCA 3POSA 2CAVA 4LO6B 4Z2AA 1QJY1 1EAH1 4QDRA 2TEPA 4GMP0 4QB6A 4YGCA 3J7MA 1TME1 4XUQA 4WM8C 2UYBA 4HFSA 2RS13 3WP5A 1OQEA 1DYPA 1KQRA 3JQXA 1C8M1 4XJWA 3KT4A 1LU1A 4Q0UA 3KF5A 2QCSB 3HNMA 2ZBJA 4LE3A 4IV1C 1ZA4A 5GLUA 5A1AA 3CJXA 3LE0A 4Q4X1 5DZEA 1W2NA 3BIWE 2TNFA 4L0PA 1R1A1 5LBEA 2XVLA 4KNCA 4FQ4A 5L7OA 1UXZA 2JD4A 2BQPA 1YFYA 3PUSA 1CGPA 4AL9A 2X8KA 2A6ZA 2DUOA 3TNQA 3LDKA 2J22A 3INAA 3PUHA 3K46A 4FI9A 2VW0A 2P34A 2FCVA 4IEYA 3JZVA 4DUVA 1A8DA 3KT7A 4TTGA 1B09A 1DDLA 3DECA 4NWWA 3FMGA 5CKQA 4IV1A 3B7MA 1ZBA1 3D3AA 1UYZA 2QDRA 2E63A 4HOOA 3SCFA 1T6BX 3U75A 4XCAA 4NR1A 3ZR5A 3RWNA 3VBUC 2VTXJ 3VN4A 1YEWA 1LTEA 4Z07A 1N1TA 2JB8A 4JX0A 4LKDA 4OHYA 1UY3A 5FY8A 4AHXA 1VRH1 4HN0A 4JGYC 1LEDA 1WLWA 5FZAA 5ANNA 2J1EA 2X29A 4LUKA 4Y26A 3JB4C 4YVWA 4QXHA 2A71A 4MYEA 3AJZA 3FE5A 5EJZB 1PZ8A 2G9ZA 5BXXA 4F83A 5KXBA 5FUNA 3VBUA 2GALA 1QEXA 1FPN2 2RS33 2EIBA 4QPIA 2W2IA 1XB9A 2ZX4A 4ZU7A 4O61A 1U5ZA 1AL23 3RQ0A 3POBA 4MADA 4RFRB 2OPWA 5IAVA 2BOJA 2Q30A 2ZTNA 3MHZA 3RS6A 2JECA 2QQJA 1KJRA 3VD9A 4P02B 3N9NA 4WM7A 2UURA 4YRDA 4N90A 3ZSEA 5FQ0B 1LOAA 3OJBA 4XFCA 4LULA 1OA2A 1QJX3 4Q29A 5EYYA 4K7JA 1QJU1 3GGLA 3I2JA 4XHBA 3I7DA 3WSOA 4P08A 3WP4A 5F32A 1U5XA 2P6HA 5FYBA 3TN93 5KC5A 3GBFA 3H0OA 3G6JB 2W87A 2DWRA 3BIEA 5FZ9A 4LBQD 2VVEA 2WA3A 2GMPA 2L9LA 4RHV1 1LEMA 4MGIE 2EXHA 1KRIA 4YGBA 2J42A 1WW5A 2ET1A 2OS2A 1RUC3 4AI0A 3UV9A 3DGTA 4RSUA 1J1TA 3SITA 4IL7A 3OTFA 1VALA 2BRTA 2JIGA 4M00A 2X09A 4MSVA 3NNMA 5EPAA 4AZZA 3J8F3 1MPXA 1TVGA 2BVBA 3AJYA 4QGMA 1XQNA 5LATA 3ZFFA 3PVEA 1QDOA 1VJ2A 4IE0A 2JG8C 1DP0A 2ZX1A 3DL3A 4OUMA 3F2ZA 3ALQA 4UBGA 5CFCC 1WLDA 1I5PA 4CUAA 2ZPXA 4KBBA 1JH5A 1OLME 4OHXA 4Y4RA 4M0NA 4LBQB 3LWCA 3N7KA 1W6NB 1VBE1 2E6VA 3E5QA 4OVEA 4WVWA 5J37A 3H8UA 4EQVA 4M3CF 1WW6A 1KFUL 2JG8A 3WW1A 5DAVA 1ZRCA 4ZHNA 4G4FA 5BPXA 2VVDA 3MW3A 2A6XA 1UPSA 2VECA 4LLFA 1FX5A 4EE2A 1DBNA 1SBDA 4UFIA 2BBVA 3AP6A 1AR61 1Z0HA 4OLLA 5IW0A 3V0AA 1LRHA 3AKTA 4PHZA 3LA3A 3AMNA 2ZA9A 4FFIA 2NZ9A 1REFA 3M3IA 1BVP1 3FZ3A 1TMF3 3GCXA 4PF5A 1ND3A 1OBNA 2D6NA 4UFMA 4V2VA 3PUAA 3C7EA 5DAPA 1X8EA 1ND2B 4XUTA 2JG9C 4L9BA 3TOJA 1LOFA 2ZGRA 4HXCA 3AB0A 4N43B 3FHIB 4OHWA 1HRV3 4XHXA 1XJAA 5FYYA 4AAPA 1GNZA 2IFRA 3USUA 4R8HA 1JYWA 2ZX3A 4FOVA 3OD4A 1ENQA 2HJIA 1GZWA 1W8HA 2WS93 2X05A 3AFGA 5JXHA 5LK7B 4FVVA 1PM4A 1PVC2 2R062 3MIBA 3KZ4C 3VBRC 1I1EA 3WXPA 2BVVA 4LBJA 2NQYA 1H8TC 4XFFA 3B94A 1W39A 2AACA 1G8WA 3I3QA 1JOBA 1ZRRA 2OW4A 3JQWA 5BNPA 1R091 1VBD2 2VUDA 3WG4A 4N53B 2R32A 3DYMA 4RS5A 3IDBB 1RUD1 4B29A 1GP5A 3PVBB 1BBT3 4K20A 1QQP3 2XVGA 3S5QA 4MXWB 2Y6KA 1H30A 1X9TA 5FYIA 5CFDC 1M06G 3BTXA 4DB5A 4IGQA 5K7PA 1RYYA 4Y22A 1WBFA 4LBOA 2WBKA 2O1QA 1ZYBA 1F15A 3SH3A 4L97A 2DBNA 2D6KA 1SLIA 4HBNA 2J1AA 4AEDB 1QNYA 3URFA 3DUIA 4Q4V1 4UOJA 5TSWA 5FWJA 5CFDA 4XZPA 1SLBA 2QQVA 2XQXA 5FYZA 1RUE3 1LODA 4Y1XA 1R081 3M3CA 2O0OA 4SBVA 1VMJA 2XXZA 4GMP3 4K40A 4E2GA 2Z5WA 5EV7A 5A7WB 1CQ9A 4QX3A 4UW3A 2ZGQA 4CCMA 3MFAA 2XJPA 1RITA 5EHDA 3GJBA 2P3IA 3T0AA 2A70A 3VHOA 2CWMA 3BALA 4XETA 4NROA 2E31A 1ACCA 2YPDA 4AVSA 5KR7A 2HWD1 4R9AA 4XUPA 4IEQA 1W0OA 2VOKA 3VKOA 2VNRA 1GUIA 1UOJA 1VBA1 3DV8A 4CP2A 2EF6A 2WQ8A 2IFWA 4AQTA 1J3RA 2V09A 5IYYA 3HT1A 4C1WA 4BIOA 1DGRA 3KCCA 1MVEA 2JKBA 4NVPA 1WMEA 2ZHLA 3OCPA 4Y1YA 3T2OA 4AQ2A 5KWRA 1DGLA 4M0HA 4EN9B 5CEHA 2XLGA 3I2GA 1QGLA 4OI2A 3ZYHA 2VH9A 3AKRA 1SCRA 3OGVA 4AHZA 1PK6C 5DAWA 4E8DA 4BQ2A 5JAXA 1UKRA 4QKDA 4Y1UA 2B46X 1S0DA 2DYCA 3MIEA 4A44A 3LSDA 1CPNA 5FZ0A 3SISA 1UW8A 3WW4A 2E26A 2CGNA 3RYPA 1CAXB 4QX2A 4D7YA 4CDUA 5D8AA 2JXAA 2YC0A 4DRVA 1OUSA 5FXVA 4DIQA 3WX5A 1BK1A 1N1YA 2K0GA 3H7YA 2ZEYA 4EV0A 1AR91 1NCRB 2K9ZA 3SLIA 1BMV1 3T08A 3ZKUA 1C1FA 1DYKA 1F5JA 3VBOB 3TRSB 1AYN1 2CY6A 4D6SA 5ABJC 5KHHA 3IBMA 3U37A 2VCMA 3ZM8A 1MZEA 4CP9A 2WR9A 1IPSA 3DPRA 1VBB1 3AYAA 1OPOA 1GZCA 4N8MA 2G1MA 3RFRA 1JUHA 3VDDB 2E9QA 4QU1A 2XPJA 1HJGA 2DCZA 2P2KA 1ZA7A 3VBHC 1HXS3 5JOWA 1H2MA 1RUJ2 3GHMA 1SPPB 1V6LA 1CZVA 3I59A 1ULFA 3NW4A 5JZGB 1E5RA 2VQAA 3POFA 2W91A 3T30A 1RVF3 2PN5A 3EJKA 3UKNA 1IKPA 1ZZBA 2ZZQA 4OHZA 3RZGA 1X82A 1RUF1 2XL7A 4NRQA 3VBHA 2IXCA 5H9RA 3PDQA 3SHRA 1W0PA 1C4RA 1PX4A 1W6OB 4AFDA 1DFQA 1OLRA 1ZBE1 3EO6A 3I2IA 1JW6A 4IGPA 1J58A 4NHMA 4XF4A 2QQWA 2G4IA 4KGGA 4NN0A 4CEWB 2YYOA 1HB1A 2Y60A 1HRI2 2OPKA 4ZXKA 3ZPYA 5FZIA 1GNHA 1D7PM 4AQ6A 5FV3A 4Q5OA 4N7IA 3MYXA 2YU1A 4IE7A 2JDKA 5FLIA 5JPNB 1OLMA 1V9U1 1YWKA 4FXKB 2JB4A 5A1LA 2F17A 1LESA 1AYM2 3JBG2 3N9MA 2TBVA 3LPGA 3PURA 3FUOA 4Y1VA 4PDWB 4EN7B 1UOBA 4E9KA 5BNQA 3ZXKA 1LNSA 5FYMA 3OUHA 1COV2 4AOCA 2BPA2 1AXKA 1SDWA 2AENA 3OGJA 3PTYA 2Y6HA 1JXNA 3THPA 1VB2A 3NV3A 2QQIA 3WDTA 3R0RA 4MH0E 1CAUA 1GZTA 2R7EB 3ILRA 4QKFA 4LJHA 4C0HA 3B3QE 1QJY3 1EAH3 5JXGA 4SLIA 1EYBA 1JOPA 2ZGUA 1CAWA 3ENRA 1SACA 4BXSV 2HYKA 1SFPA 1QOOA 2XWJB 1C8M3 2XDVA 1HKDA 2R16A 3APBA 4QWNA 1REDA 2Q1ZB 3MIFA 1WCDJ 4OYUA 2HWE2 2WN2A 3C2UA 1OI6A 4FPYA 2QQNA 2VZ1A 3KM5A 1MEC2 5H9SA 4N7UA 2K2SA 3WW2A 4Q4X3 4PCRA 1K5MA 1R1A3 1V6NA 5FZBA 5F2SA 4FAGA 3D6EA 5C3PA 4QQ2A 1QOTA 1FOD2 1EV11 5C71A 3NNLA 1HN1A 5H9PA 3T09A 1S4CA 2RS31 3QACA 2YBKA 5F8PA 5L7OB 3ZSMA 1NA1A 1ZBA3 3KVBA 4D94A 2DBIA 3VHNA 1JMUB 3ZDVA 2JE8A 2ZX2A 2BUKA 4XTMA 4JZRA 4XUOA 1PO22 4LNVA 1HQNA 4CZSA 4D69A 2XBO2 3VDBA 4X6QB 2W3JA 2PELA 4IV1B 3TB0A 1VRH3 1HJFA 4P9YA 2YDEA 3ES4A 5AC92 4Q0QA 3OPTA 1PNGA 1QKQA 1OXCA 1ALYA 4R52A 2OIIA 1CZTA 3FFZA 4JGZC 5J09A 5CNAA 3RZLA 4YWAA 1DZTA 4H14A 4ASLA 4NHYA 3OGSA 2PHDA 4PI2A 1Y9QA 4WVVA 1I3HA 4YVWB 3WNLA 4P14A 3TEXA 3VBUB 1Z7S3 2V72A 3IM0A 2RM21 2BNOA 4MX3A 4QPIB 1YFUA 4XIOA 3UESA 2VMIA 1YRZA 2DVGA 1Y43B 1UZVA 4JGZA 1V6KA 1QJU3 2A6VA 2WO2A 4ONUA 2KD7A 1H2NA 2JICA 1ULEA 3AZWA 4WM7B 2FDKA 3POWA 2R1BA 4LIVA 2YBSA 4RA0A 3RI8A 3I54A 1UD1A 2OUJA 3MUZ1 4RHV3 4ES8A 5T5JA 4Y5TA 5FIXA 4BLIA 5AVAA 3BI3A 3MPPG 4OCTA 4OUSA 4EROA 2DCYA 4PQQA 3ILNA 2W46A 3ZXFA 1FAYA 3J4UH 2CSGA 4N43C 4AGGA 5IK7A 3JCIA 3KV4A 2RR11 2ZGTA 4FFGA 4KWLA 5DQ0A 1UX7A 3IMMA 4KU8A 5B4XA 5FYSA 1GICA 3U11A 1UY0A 3N7MA 4P5YA 2ZGOA 5GZDA 1YIPA 2J1VA 1W06A 3GNEA 4BXFA 4TXWA 3UK9A 4DXZA 4NO4A 1NQDA 4J6GA 1ZM1A 2Q8DA 4GH4A 3O1MA 4XDQA 1GQPA 3WQBA 4KU7A 1W05A 5JOYA 2VR4A 2YY1A 1FATA 4KL1A 4XCBA 3UJOA 1W6QA 4B7KA 3S57A 3ZFFB 5GKAC 4WVMA 1NY72 2D5FA 3BVCA 4NHXA 2Y8KA 3RZMA 5CB7A 1VBE3 2R042 4BMBA 4XQWA 1OFSA 1LOEA 2ES3A 4UF0A 5KHIA 2FDFA 1RC6A 1W0NA 1W6PA 2XJTA 3ECQA 2VNOA 1VR3A 1OLQA 1W04A 4MGYE 4DNYA 4YNIA 5DZGA 5F7UA 3CJIC 4IW3A 4K8FA 2VGDA 1AR63 4B4PA 1O4TA 1RUH1 4XQ4A 3SKJE 1W9SA 3H9AA 1K5JA 2RDQA 2W1QA 2PYTA 3M3QA 3JD72 4WZCA 2VMCA 5IT6A 1ZNPA 1W8ZA 4KWJA 4YZ2A 3V0AB 5BV6A 1XNCA 3ZIXA 5FDBA 5CG8A 3CJIA 4AVTA 2J1RA 2D7FA 2IVIB 4XXAA 5B4NA 5JUVA 1C3HA 1DQ5A 3N36A 3FHAA 1ND3B 4YW7A 1H1MA 3WHUA 1JYTA 3VD3A 1MZ5A 4DPNA 2CV6A 5DDJ2 1W9WA 3LFMA 2D97A 2D3SA 4FO9A 2CL2A 4JRLA 1JYCA 3NO8A 4PLMA 3RPQA 1F5FA 3BGAA 3OYWA 4IETA 2NP0A 4ZU5A 3HN3A 3MEPA 2XJVA 1AR82 3USUB 1GZWB 3LEIA 4UFLA 1VMHA 3D5OA 3U0ZA 4EZ4A 1RUD3 1MVQA 1UYPA 4XE9A 5DG2A 3IAQA 2NPIA 2P5BA 3HPNA 3H8OA 3ZXAC 1OQDA 2VZOA 3NV4A 5DXDA 1PO11 2PFWA 4EYUA 5BNPB 5I8YA 1JYNA 1W9TA 4P9IA 2ILMA 4YGEA 1HX6A 3BPZA 4RS5B 4DUWA 1WCKA 2E33A 3LPFA 2LW8A 2OVUA 5A3TA 2DVAA 4H55A 2VBDA 1JN2P 1N3PA 1AR72 4GXLA 4BYYA 2FHRA 2VAUA 3ILFA 4PLOA 4E27A 4I3PA 2DU1A 1IHMA 4FOWA 2J7MA 4Y20A 2HKXA 1AZDA 4Q4V3 3MF9A 5LASA 4CU8A 4E2QA 3ETPA 4UFHA 1YJLA 4Y22B 3SCHA 5FP4A 2VQTA 1CPMA 2VJXA 2I45A 3E6CC 4J1WA 5F1RA 1NCRC 5KHKA 2DU0A 1UYYA 4B4RA 1LHOA 4MGQA 3T4VA 5CFDB 4XBLA 2ZKNA 2OZJA 5CZKA 1Q8VA 3ZIWA 1C57A 3QD6A 4UW6A 3WV6A 5IVBA 3SNMA 1DZRA 4KBZA 3WG2A 3VDDC 5IVYA 2G9GA 2OXBA 1XOYA 4ZPIA 4DXRA 3WF4A 2HWD3 4NIHA 2AC1A 3ELNA 3S6PA 1JZ5A 4Q4Y1 2EXKA 3K77A 3ZYBA 4ZONA 4M4RA 5IK5A 2C5DA 2RHPA 5JZGC 1W9FA 5FWEA 3UT0A 1JU4A 4JTOA 3ZYGA 1YQ2A 5J48A 1N1VA 1PMIA 3GZUC 2DFBA 5JOZA 1FXZA 1FV2A 4RFT0 3GZTB 4NHLA 4EN0A 1PIV2 2V5YA 3ACFA 4NPMA 3GBWA 4P9XA 2PHLA 2OYZA 4COZA 2JDUA 1QY4A 1UAIA 2ZCWA 3WNKA 1RUOA 1IQAA 5F3EA 4CEWC 2JJ6A 4A3ZA 1WLCA 2OUHA 1BVVA 5FZFA 1W3VA 3PVNA 2BFUL 1STMA 5E8AA 1URXA 1OC1A 4UW5A 2DVDA 3WD5A 3FFQA 2BV4A 3FLPA 2UYAA 1VBC1 1SZBA 1ENXA 4AQSA 2HWF2 1NLRA 3VBSA 1AR93 2WLPA 4DXSA 2E32A 3DKWA 1G9FA 3LCPA 4YW6A 4M01A 2YC2A 3H42B 5D8AB 2VO5A 2RVAA 3ACLA 1YIFA 1UY2A 2RG4A 3AP7A 3K3NA 3KB5A 5FY5A 3O1VA 4XW3A 5JWPA 1VBB3 3H1YA 2LALA 4GALA 4M3CE 4YLZA 4ZY9A 1FNYA 5FJKA 1GYKA 1FMD2 5CG9A 4QX0A 3HQUA 1XNAA 5T54A 3W20A 4AEKA 2VMFA 1LKNA 3DPRB 1I6XA 1ULDA 3KV6A 4CP9B 4YZ5A 2BP6A 1T2XA 3GXUA 4HLTA 4LKFA 3VZJA 5I0RA 1F9KA 1SHWB 2R071 3ATGA 1LGCA 4MGKE 4KWUA 4AEJA 4CU6A 1U0AA 5C8WA 3R6SA 5FMCA 1RUF3 1JZ8A 3I59B 1SG3A 1W2UA 3NKTA 2LS6A 1S2KA 4IUGA 1O8PA 4MUVA 3I8TA 4XFAA 2W1WA 2VQUA 5E1RA 1S0IA 2BERA 2EVXA 3OBTA 5IATA 2C26A 1S0JA 5BNOB 5L7OC 3VBHB 3PMEA 3LIGA 5M0TA 2GH8A 5CA6A 1DQ6A 1OD3A 4L11A 3ACHA 4IGOA 2Q4SA 4DY3A 4GA9A 5KC6A 2VMHA 1V9U3 2F4PA 1C28A 4AHYA 5L19A 5FXWA 2Z79A 3GBGA 3E1F1 2JD9A 2KM2A 3KQ4B 5GZFA 4YFZA 2FQPA 4GB31 4QX8A 1XYNA 3BN6A 3UETA 1VMFA 2CWSA 5ACA1 3C7HA 1POQA 3OF1A 1SLTA 3AYDA 5FY1A 2PQSA 3IWZA 3KS7A 1RMU2 1F2NA 4LIUA 3X29B 2WZR2 1AJOA 3MZHA 1V6IA 3SKVA 4DQAA 3GF6A 1DQ4A 1S0EA 5DG1A 4YVWC 2Y6JA 5JMOA 4LO8A 3WCSA 3WDWA 5JIAA 2WFF1 4W6YA 3BUCA 2IXIA 4C90A 1DLCA 1W8TA 2Q0AA 3FLTA 4MZUA 1WMFA 4BPZA 4BJ0A 2E7QA 4KGQA 1WCUA 1CAUB 2CDOA 4NRMA 2YUEA 2EIGA 4LMFA 4OULA 4QPIC 5F5QA 2FDJA 1F31A 4BQWA 3N9OA 4FT8A 2QQPA 1BK0A 2VBBA 1VIWB 4C1XA 4KG0A 3QOPA 3WINE 3NL1A 1CAWB 1G7YA 5FBJA 1MS0A 2KXLA 2HWC1 4WM7C 3PL0A 4AF9A 4CYDA 4E4ZA 2WL1A 4A4AA 1EV13 3GM8A 3D8CA 5SV5A 5A6XA 2BFUS 3H8RA 5FBZA 4UW4A 5KHGA 1REEA 4NIAA 3ZXJA 1UCXA 5F6KA 3CNAA 1AF9A 3QLQA 3LB9A 5LY2A 3WG1A 4ATEA 1ZRDA 1K5MB 4XC9A 2GZWA 2VXRA 3UKVA 5F9TA 1L3JA 5LWBA 4HN1A 3K4AA 1Z7S1 4J1XA 1UIJA 3CIHA 2Y38A 2ZHMA 4LORA 5IFPA 1DU3D 3LSEA 5ERLA 1NA1B 1UN1A 3CZUA 5EIYB 5IVVA 5A6YA 4X8PA 5I0UA 2Q8OA 4CPBA 3VZKA 5FAXA 5FO9B 5FZ4A 2CYFA 2VNGA 1O8SA 3THCA 1E5SA 4IE6A 4ASKA 4XBNA 3I3DA 4YFWA 3U10A 5JCTA 2YU2A 1U5YA 1O3QA 1SEFA 4XAEA 2PHRA 1BXHA 1R64A 3L9JT 4H7LA 3ZFFC 4D7SA 1CIWA 4QPYA 5EZWA 4WBBA 5BNNC 4P9GA 5JXIA 5K9YA 1BEV2 2O8OA 3I2FA 5LBBA 1PVXA 2UWBA 4QX1A 4A7KA 2VE1A 1ENSA 4CDXA 3ZSKA 4LO5B 2RM23 1JTZX 1JYXA 4S2DA 4BB3A 1JZ4A 1YNAA 5JI7A 1D2SA 4XJ9A 1TE1B 4DINB 5C33A 1RUG1 2OX0A 2WO7A 4KWKA 1NCQA 1XSRA 4PT6A 5BNNA 3CBNA 4PIYA 1RUI2 1EY2A 2X5IA 4LLOA 2ZMNA 2ZAHA 4XQDA 3GDBA 4JGZB 1G6NA 5BUVA 4FPFA 2W95A 3SMHA 5F39A 4AFAA 2B42B 1O5LA 2VZPA 4O9GA 3ZLIA 5J96B 4LHKA 3OGRA 4MV2A 2RR13 1ND3C 2A5ZA 5A32A 4K21A 4KH9A 5I93A 5K0UA 3JBG3 3W9AA 1JYVA 3RYRA 1LOFC 4E8CA 4PJYA 1QDCA 1NKGA 1WCQA 3I3BA 3MLLA 3UYJA 1O4YA 2JDHA 1W3XA 2VZ3A 3ZMNA 1VLNA 3WF3A 1JODA 2YZ4A 4PLNA 5F5CA 3E5XA 5KXCA 3M70A 4UBHA 3KV5A 3LOBA 5BNPC 4AI9A 4GH4B 4UXAA 3O0XA 3P6BA 4LXLA 4UYBA 4E4DX 5EJ1B 1KGYA 4BWOA 3ZFEC 5C3RA 1W6QB 2BYVE 4RS5C 4XURA 2QQLA 4G3YC 5GJ6A 4META 1PGW2 4WVMB 4A42A 1XSQA 4XABA 3BOWA 1IS5A 2ZJCA 4UI9L 2FBEA 3MIDA 1RUH3 4HZFA 4UF0B 3ZXGA 3V0BA 4Z92B 3TWIA 4ATFA 1LULA 3AM2A 4BQ5A 4NE9A 1W6PB 1NOVA 1PX3A 2OQ6A 2RS52 3KV9A 2OZ6A 4GIQA 1JZ6A 1OFNA 1FPN1 1ZZ7A 3ZFEA 5CKNA 5T5PA 4M3CA 4IE5A 4GQ7A 4UFJA 2P3JA 4ISRA 4BK4A 4XFHA 1C8NA 1N47A 1A78A 3ZKYA 3AXDA 1YYNA 2VULA 4Q4W2 5FZ8A 5I0SA 1Y7BA 5FY9A 2WNVA 5HPOA 4PIZA 3A7QA 4IEWA 1S0FA 1QJEA 3CJIB 4WZFA 4AFMA 5B2GB 3UKTA 1D4M2 5LA1A 4XFIA 5T5OA 5FRAA 1D2QA 3THTA 1JZ3A 3RMXA 5AC93 1NYWA 4PI0A 4FPCA 1OURA 2JDAA 4C8DA 4N9IA 3WY6A 1X7NA 4FPLA 5F3GA 3HJRA 3OYWB 2ZMLA 4YZ1A 1W2TA 4AI2A 1DGWA 2N7GA 1YI7A 5AFBA 3ZX7A 2Z4FA 1GV9A 1PO13 4QQOA 4IEOA 2W08A 4NAOA 1DGWX 3F95A 4LUMA 3OY8A 2A3XA 4FOQA 4YG0A 1AX0A 4LHLA 2RS12 1GKBA 4TLGA 4CCKA 2Z42A 2HYXA 2E51A 1XRUA 4LR4A 3ZXDA 1BKZA 4F8AA 3WCRA 1S55A 2ZGNA 1Y9MA 5FYUA 3V64A 3VUOA 3KT1A 3N9LA 1XNTA 5C9AA 2JDPA 4Y20B 4QX7A 1HIXA 2VMDA 1GLHA 3OBRA 5FOBB 1O3SA 2QE3A 3ZPOA 3VHRA 5A80A 4Y5Z0 4XF9A 4F7ZA 4FP3A 4CDUC 2VY0A 2WT2A 3OOXA 3NAPA 5D8AC 3VKFC 4FPKA 1VB4A 3NWKA 1C5IA 4A3XA 3NVCA 3ZN6A 4RGAA 4JTNA 3W58A 1WD3A 4AI1A 5FP7A 2Q8CA 3KGZA 4Q4Y3 5LBFA 2WKKA 3MLJA 1CJPA 4XAAA 3DPRC 5T5LA 3QCWA 3WOGA 3C8XA 5LA2A 1GWMA 4LO7A 4ASMB 3BTZA 4BQXA 1ZX5A 3N3HA 1A34A 4JHZA 3ZOIA 1ENRA 2FDGA 2KR2A 4QPGC 2RS32 5F2WA 3OD0A 4ZZ5A 5I0DA 4YW5A 1AL22 1VAMA 1GWKA 1H9PA 3AL6A 4INDA 1SLAA 1PVC1 2R061 5FPVA 3ZYJB 4CP1A 2ARAA 3ON7A 1X33A 4XIKA 1LHWA 2GP5A 3ZR6A 3E6DA 5A70A 4YG6A 2EICA 5FK7A 4MGSA 3WP6A 2BGOA 2YV8A 3GZAA 4QPGA 1QJX2 1VBD1 2WT0A 5C4WC 5CBLA 2YROA 2P37A 1CX4A 1US3A 1XNKA 2P6CA 4FPOB 3SC7X 1NUKA 2R0HA 3WEZA 1BLZA 2WT1A 1VBC3 4PBPA 1T6GC 2V5DA 3TN92 3IAPA 3M4FA 3O1SA 5A6ZA 5A7NA 3WDUA 1HW5A 4HVRA 2CU5A 2Y6FA 5FZHA 3NJXA 5C4WA 1YUDA 2VOVA 5FYHA 1JOJA 1ZZ9A 5F3CA 1RUC2 4OFGA 1PMHX 1Q5OA 3FC0A 3CEWA 1UOFA 2VCCA 3VBSB 3WQ7A 5GZCA 1K42A 2IXKA 2OA2A 4QKNA 2WYFA 5DAXA 3MIHA 2UY8A 1I5ZA 5FZOA 3J8F2 3KF3A 2RJ2A 1XNDA 3C7OA 3L2HA 4Q1PA 4XMAA 4NWVA 1YI9A 3PHMA 3CQOA 4I01A 1APNA 1F4AA 5AVPA 3LQCA 1H0BA 3OGGA 4AAXA 2J1UA 2R073 5LEJA 2ZACA 3CU7A 3LF7A 1Y9GA 3O1PA 4PF1A 1TNFA 3J7HA 1WW4A 4EJRA 1RXFA 3CZJA 2D3PA 4AFCA 2XLAA 1W90A 3VKLA 2WJSA 3VL9A 1EUUA 4FPEA 1AR73 4S2FA 1SQ4A 4DRRA 1V6OA 1OKQA 3J7LA 4A45A 1K5MC 3C3VA 3NJVA 4JQRA 5FMDA 4BDVB 2G9FA 4X8NA 1OSGA 3OUJA 5LRRA 1ODMA 3GZEA 1X9PA 1CWPA 3VDAA 4FP2A 4BE3A 1OUXA 4B4QA 4CCNA 1NA1C 4LBNA 4MHRA 5FKBA 2WNUA 1OVSA 4GB33 5ACA3 3B9CA 1CD3G 1IG3A 1TMF2 1KDKA 3AZXA 2OT7A 5LEKA 3TEYA 3WNMA 2NN8A 3UNPA 4CU7A 4GJYA 4GZ9A 5L73A 3ZYRA 2XJRA 3WF2A 1YQ8A 3GCWA 2EXJA 1HRV2 1O5UA 5IVFA 5IHRA 1XU2A 1TEIA 3SQOA 2WFF3 1W8WA 2WS92 2Y64A 1OH3A 4URAA 5HCBA 4NJ4A 1B35C 1NZIA 3VHPA 3WUDA 1FT9A 4QDQA 1V70A 1IG0A 4ZKTB 1H2KA 5FZ7A 3I3MA 2JE9A 2AEYA 1MS8A 2D98A 1WMDA 4K3UA 4OUEA 2Y6LA 3W5NA 2HWC3 2RMU2 3RJRA 4CPBD 4LK6A 5D2AA 3UL2A 1OVPA 1BBT2 2VOWA 3AYEA 1QQP2 2A1XA 1B35A 2Q1MA 5DUVA 5JR7B 4EN6B 3NNGA 4Y24A 1RUJ1 2XJUA 5FZ3A 4FSJA 2AH2A 5L9RA 3VL8A 4LKEA 1UF2C 2EIDA 4LOTA 1NE6A 1UXXX 1W6MA 2A6YA 1PGL2 1WA4A 4FFFA 2XHNA 1NAEA 1XE7A 3OBAA 4XF1A 5DUWA 2PHTA 3HBZA 3IIIA 3W5MA 3Q8BA 2HH9A 1QXPA 3AMHA 5HXMA 1RUE2 3P5BA 5I8SA 5FZEA 4B1MA 1LECA 3V56A 3J26N 1QIQA 3IZOA 3B9IA 4AVBA 3AZYA 4WVZA 1MACA 4MG2A 2WO3A 4XEZA 3PIGA 5GLWA 4C91A 1HRI1 2FMYA 1QH6A 4GH4C 3ACGA 3WP3A 3I2KA 4HPKA 1WUVA 2EXIA 3JBG1 5T50A 1AYM1 2PQQA 2RDSA 5DAQA 5G05L 1RUG3 4COUA 3QBQA 4GKXA 4PIXA 2WA4A 5J98B 4CDXB 4XILA 1RHI2 4OQ8A 4KI5M 2WZ8A 3I3EA 1COV1 3MFCA 4YM1A 4CCDA 1DLLA 3A23A 3RDIA 3RZHA 4W6WA 1MR5A 1NCQB 2VUJA 3ZFGB 1MS5A 2TUNA 1N3OA 3CF6E 1CESA 2FZ1A 4MXVA 2X5IB 5BNNB 1SFNA 3PU3A 3VBFC 3DKQA 4RN5A 3POIA 1KEXA 2XONA 2PMWB 4DXTA 1EP0A 5FPXA 2J1SA 1DCSA 5CKMA 1BQPA 4OZOA 2HWE1 2DV9A 1VAKA 4P9WA 1UY1A 1MEC1 2ZEWA 5C70A 3CL1A 3NV2A 2W92A 4J25A 4RGGA 1VP6A 5DPNA 5A32B 2VOTA 1FOD1 3MICA 5JVVA 1RMU3 3VBFA 5K0UB 3I2OA 1QHDA 4Q8LA 2DCTA 1QJZA 3RNSA 3U78A 3RG0A 2XJQA 4MO3M 4HKLA 4M4PA 2ARCA 1ASJ2 5HV4A 4QB2A 5JIUA 4K1YA 1W8OA 4MGZE 4EN8B 3KHBA 2WZPP 2HWB2 1PO21 3ABZA 3FN9A 2EIEA 3T3YA 2XBO1 1OF4A 1LHVA 2MEV2 1OD5A 1ULCA 1RUNA 2Y6GA 2B4KA 3LOIA 1HXS2 2ZOEB 3T2PA 2WAAA 4CSWA 4BMEA 1OA3A 1KS5A 4QB1A 5AC91 4R4XA 4XACA 3SH4A 1QJFA 1RVF2 2XLFA 3WG3A 3GALA 1W2AX 1FPN3 4DS0A 3CLPA 1N3QA 5HCAA 1VPHA 2DCJA 3WUCA 3V0BB 4I02A 2W1UA 4Y4YA 2O14A 3I4IA 5C5TA 2BJSA 4GJZA 4C0BA 5CISA 2IWGB 2WYSA 3WHTA 1SLLA 2XHKA 2A3YA 4ZS2A 2DVFA 5I0TA 3ZFEB 3O0WA 2DDUA 5FXZA 4M3CB 4A7YA 4BHPA 5LZ6A 4JDNA 1LU2A 3R4DB 5A3WA 2ET7A 3K4DA 4QT6A 5KBFA 2ZGMA 3H8XA 4A2UA 2I07B 1UMHA 2PLV2 5A3OA 5A3NA 1ZVFA 4CVUA 1IPJA 3RZZA 4BA6A 5BNOC 2UWAA 3P3PA 2D5HA 3H3UA 5F37A 2WNVB 1GFF2 4RR3C 5JR2A 1W8UA 4O7XA 2QQMA 5FK8A 2XVKA 1D0HA 4NPRA 4QHOA 1Q56A 4QXKA 4YG3A 1LHUA 2ZX0A 4LA2A 1H4GA 3H1MA 4EWAA 2ORXA 4KMQA 3ZYIB 3AX4A 4A6SA 4AXOA 2WNOA 5BNOA 2V4AA 1IQDC 1MS3A 1PHMA 1JUIA 5IFTA 1WW7A 2BEOA 4RR3A 5T52A 5GM0A 1QJY2 1EAH2 2UU8A 3K3OA 3PVOA 3H50A 4A7ZA 5IK8A 1TME2 3KQRA 1IS6A 2XWBB 4FPHA 3WZ1A 5HBAA 2WN3A 4HG6B 5T55A 3ZSLA 1PZ9A 5GLZA 1GU3A 1C8M2 2XQRA 4XJZA 1GOGA 4CXXA 1RUI3 4I0AA 5I8TA 3AP9A 1VRBA 3OY8B 3QH7A 4Q4X2 5F6LB 3DXUA 1RINA 1HQLA 1R1A2 1W8NA 3OSDA 4JKKA 2GC3A 5FPAA 1US2A 3BPSA 1NY71 4LBMA 3ES1A 2R041 3VD7A 1R1ZA 3B01A 3O12A 1G9BA 3A4UA 2UY9A 2B7YA 1UX6A 4N9HA 4Q0VA 5EYXA 4RQPA 4ITCA 2E7AA 4P9JA 5FZ6A 1ZBA2 3H7JA 4LPLA 5C9AB 5LW9A 3CMGA 4COVA 2PXJA 3VBSC 2QQKA 1XNBA 3KLSA 3PUQA 4WV8A 2R49A 2WC2A 5DN2A 3FJSA 4Z82A 3WDYA 5FLHA 3WR0A 1F8VA 4I09A 4IEZA 4HT1T 1UZ0A 1OF3A 1VE0A 2HEVF 3NAPB 5JI9A 5AFEA 1ODNA 2R1DA 1UZZA 1VRH2 3AXEA 1KFXL 3JD71 3RI9A 4HKWA 3ZN6B 2GN7A 4JAAA 2PAMA 3MV11 2ZEXA 2GNMA 3AMMA 2EALA 5GLVA 2VZTA 5JDBA 3PJYA 4UFKA 1H9WA 1LHNA 2W1SA 3LEKA 2XMLA 4U2AA 4LITA 2H0VA 1PVC3 2R063 3DN7A 5DDJ1 2VD7A 4NOTA 2IUWA 3O1OA 1W2OA 1Z7S2 2D6OX 1UU6A 1WKYA 3ZDSA 1Y4WA 1WZXA 2D93A 2ZXQA 1AR81 1EUTA 2C6SA 1IPKA 1D4VB 1VBD3 1H6XA 3PIJA 1QJU2 5LK5A 1WBLA 5FO8B 3MBWA 1V6JA 2HBTA 3OG2A 2VMEA 1JU3A 1X8MA 2XUMA 4UWDA 4CDQA 4QPGB 2CAUA 4P5HA 1KJLA 4LO4B 3J7NA 4OMCA 4RHV2 5C8CA 1HQWA 3U1XA 4AK3A 5A7QA 5T3NA 4BU2A 4GWJA 5APAA 3POGA 1AR71 4I3GA 3AP4A 1D4M3 1TNRA 3T0BA 1NZCA 5FP8A 5IWFA 3VGIA 5C4WB 5FP9A 1HV0A 4BIFA 4R9CA 1MS4A 3TYJA 5A3LA 2XGXA 5FZDA 2WNEA 4HONA 1CX1A 1PM7A 3FBYA 2RV9A 1YFWA 2AEZA 2YFUA 5FZOB 5K4LA 2A75A 1J84A 3PUIA 4OMDA 5LY1A 4TN7A 2QZ2A 4GD4A 2VUCA 2CGPA 4AHWA 2GU9A 2ZAAA 1V6MA 1NG0A 2W0XA 2VOXA 3NRUA 2SBAA 4AYUA 4NRPA 1J3QA 2MPFA 2VM9A 1VBE2 2AYHA 3FHQA 4KG8A 4MHUA 1KXGA 5JSOA 2D43A 3N7JA 2VVFA 1JHJA 1PNFA 3FWEA 4LOSA 4HL0A 1AXYA 2JEMA 2C4XA 4CTEA 4EWEA 5LCWL 4U36A 3K48A 5DABA 2VL4A 2JDNA 5FXXA 4W50A 3PNAA 4CEYA 4P00B 1RTVA 1AR62 1WGPA 3IPVA 2MNGA 3DF0A 1LENA 3ZN5A 2VG9A 3LEGA 1NT0A 1DG6A 3MLKA 4NUBA 2ZMKA 4WM8A 4AGRA 4JRAA 2IXHA 2VZQA 4ARYA 2ZHNA 1PIV1 1MZ6A 5A7SA 4LHNA 3AK0A 4Y5SA 2DUQA 2C0ZA 4XVHA 3U14A 3ZYFA 4CCEA 2WWJA 2GC1A 5JSRA 2WNUB 2XB6C 3GJAA 4HK8A 5FYVA 1J83A 4E4SA 1UKGA 3IDAA 3PMSA 5KXEA 1ST8A 4CCJA 1LOBA 4OI4A 3D4KA 2WLQA 4COYA 3KHCA 1YQCA 3HNBM 2HEWF 4CDUB 4QHZA 4FQZA 2XKOA 4QDSA 2B8MA 2Q5TA 4NHKA 5J3UA 2GMMA 3AKPA 4BLJA 3LA2A 4I30A 2AR6A 1R092 2Y33A 3BODA 2HWF1 1O6UA 4W8JA 2VPVA 3HVDA 3JB8A 3LD8A 2P1BA 3ZVXA 4CDXC 1ZRFA 2QJVA 3U4SA 1RUD2 4CRQA 1C1LA 4QKBA 2Z69A 1RB8G 2WSVA 1EPZA 3WLUA 1JBCA 2QTWB 1ZZCA 4JGYA 1GP6A 1BZWA 4QQLA 2WO1A 1NCQC 3VKNA 3HWJA 3ZFGC 1X50A 3WW3A 4BQ1A 4FAHA 1FMD1 3OBZA 5LB6A 2X5IC 1RUJ3 1OA4A 4YM2A 3RRDA 1B35B 4EWDA 4GWIA 1CAVA 5J1XA 1BCXA 1S2BA 1KITA 5HI0A 1GMMA 5JLVA 3M1HA 1MZFA 3O0VA 1XYOA 2E53A 2Y0OA 3IIAA 3UGGA 2BTVC 4Q4V2 2NM1A 4JV4A 3HR9A 4B7EA 4JVAA 2A73B 2XH6A 3ZFGA 3Q9OA 1GANA 1H1IA 1R082 4TSVA 1JHNA 1W6MB 5K0UC 1IKQA 2QFEA 3IMNA 4B8EA 1BHGA 3GHNA 4ET7A 1HRI3 2ID4A 2DCKA 3D0SA 3DEMA 4QXBA 1QXJA 2H6BA 1M4WA 1UL9A 1IS4A 5A6QA 4QXCA 2RDNA 3ZXEA 2EAKA 4XF3A 2VZVA 4YGDA 2JDYA 3VZMA 3BU0A 1J1LA 4RGKA 1POV1 1AYM3 1RJ7A 2HWD2 2PA7A 3AFKA 1W28A 2DVBA 3ORJA 4ORFA 2R6QA 2GNBA 2PHXA 1VBA2 3QH6A 4LK7A 4A6OA 2IC1A 2Q1FA 1A8MA 4HPKB 1COV3 3OEAA 2DFCA 1RMU1 4R9DA 3RSJA 3MV01 5BY5A 2WIIB 4DUXA 2WZR1 4LBKA 3TBDA 4AW7A 2B5HA 1JI6A 3HAGA 1AVBA 4A41A 4D6QA 2BW8A 3M3OA 2VCBA 3WF1A 5C6CA 5DMYA 1UMIA 3O14A 3AVSA 1CVNA 1NLSA 4XJ8A 4QGLA 4HANA 5FZMA 4AR2A 5CFCA 3A0KA 2LM3A 2ZKLA 3K51A 1AX1A 2C9KA 3IDCB 5L36A 1IS3A 2E7TA 3FUQA 1LOGA 2WABA 1AX2A 3LKJA 3R4UA 1IZ3A 3PLQA 4CUBA 1YJKA 5CYYA 1TZOA 2HWE3 4Q0PA 2PHWA 3MPBA 3N7LA 5EJ3A 1MEC3 5FMBA 2ADDA 5A7OA 4CCLA 4LKSA 1O7FA 3B00A 4HK9A 4YVSC 4LQRA 1QU0A 3NJZA 1Z78A 3BU7A 2WNVC 4DMIA 1UU5A 2QVSB 1FOD3 3MF6A 4P9LA 4NIGA 1XU1A 3WF0A 1LR5A 1AR92 1BMV2 4ZXEA 3ROUA 3LGRA 1W8FA 4QPWA 5J7MA 1NXMA 1DQ0A 1AYN2 3AP5A 1HB4A 4K9SA 4YW4A 1LAJA 4AVVA 4YVSA 3VBFB 4CE8A 1X36A 3RWKX
chains in the Genus database with same CATH topology
1VBB2 2GMEA 2AUYA 1PO23 4HVQA 2XBO3 4FPGA 4OZXA 2PAEA 5H9QA 4X6RB 2DTYA 5BYNA 2JG9A 3AZVA 2VUAA 2W52A 5FO7B 4QD2A 1O3RA 2XG3A 3OPZA 4IERA 2RMU3 4L8QA 3AKQA 1SFYA 3KCYA 4DOUA 3VBRA 2B45X 3D82A 5GALA 1WCSA 1H8TA 4O9EA 1RUF2 3KMHA 1RL3A 3D0JA 1Q8OA 1OMIA 1RJ8A 1OOPC 2R30A 2QKDA 4JDMA 3ETQA 1ZBE2 1BEV1 1H1AA 1QXRA 5GZGA 1AUYA 3GYDA 2ERFA 5CVRA 5FMOL 4AWDA 3BTAA 5C9AC 3HMYA 1U12A 2YMZA 2RE9A 4IEPA 3B69A 3VZNA 4Q0SA 4FSJA 1SBEA 2CGOA 4BH9A 1YHFA 1OOPA 2GNDA 3NKGA 1V9U2 3RJ2X 5K8SA 4W65A 1RUI1 2FZ2A 1AXZA 3NAPC 3ZN4A 3ZSJA 2RJLA 1WD4A 5EWSA 4Y1ZA 2BNMA 5A3MA 3KCXA 1DIWA 3N4MA 1YLLA 3HIFA 4QQHA 3TNPB 3VLBB 4IEVA 1ZZ6A 4TLFA 1ULGA 4QQPA 3H1WA 3G7DA 4OI1A 2WFPA 3JU9A 4BOWA 5BNOB 2H0BA 2PHFA 1YCIA 2BNNA 2EAAA 4IV3B 2NMNA 5KXDA 2D6PA 2JENA 3UJQA 2LTNA 1RHI3 2R0FA 4RR3B 2IXJA 1ZREA 4XPVA 1MS1A 1UIKA 2AZ5A 4DY5A 2BWAA 3N35A 1HLCA 1RIRA 2Y26A 1POV0 1AL0G 2D6LX 1EV12 2WWSA 2R043 1IGOA 2BWCA 4L99A 2ZGSA 3R4SA 4LE4A 1DQ2A 1G9DA 5FOJB 1FV3A 2YPJA 1MQTC 4RD7A 4CDWC 2VW2A 1PGW1 2D3RA 5A33A 4YSFA 2YGLA 4RQPB 3WT3A 2Y0IA 2RS51 1Q3EA 1PK6A 2DTWA 3JD73 5SV8A 3TAYA 1MQTA 1KS4A 4CDWA 1QH7A 3SCGA 4K1ZA 3WDXA 1ASJ3 1LB2A 3AYCA 4XF0A 1PGSA 2JE7A 1RGSA 4Q4W1 1CONA 3MI8A 2HWB3 3M2MA 4FXGB 2SLIA 5DDJ3 2MEV3 2ARBA 1D4M1 5DUXA 1DHKB 2RM22 1AR83 1YXWA 5ABJA 1Q8PA 5CADA 2VU9A 3FBMA 2IXLA 1O91A 3MIGA 4F3JA 1H8VA 1GZ9A 3JUUA 3CO2A 4RL7A 2CTVA 4Z2WA 4K6BA 4XYXA 4GWMA 3VKMA 3LZZA 3MW2A 3E97A 3WVJA 5FMOS 2LUWA 2DUPA 1DF0A 4AE2A 5HCFA 4PBOA 2O8QA 1Q43A 4HKOA 4QX5A 2JDZA 2WNUC 1FYUA 3O7OA 2PLV3 3ZYPA 4CDQB 2RS11 2RR12 5C8CB 2QNKA 5CIRA 3HT2A 3P3NA 3MDPA 1BJQA 3O5SA 4IXLA 4LT5A 1BYHA 2F6BA 4AGVA 5JPMB 4XTPA 3EQEA 3FX3A 5FCCA 2ARXA 4JDOA 4IEUA 4BCUA 1LJ7A 1PZ7A 4LEJA 2VW1A 4YZ4A 2Z2SB 2NYYA 4FPJA 3S30A 1TME3 4HSJA 5JMCA 1DQ1A 3LA7A 3RYKA 3T1LA 1OPMA 4HSLA 1HDKA 3HD8B 1G9CA 4LA3A 4AI8A 3M7AA 4H7MA 2GSYA 1RUH2 2B39A 4OI0A 1GBGA 4AEMA 1C5HA 4AFBA 4FCAA 1CR7A 1NXD1 2NLRA 1PIV3 4E2SA 3E6BA 4CEYB 2D6MA 5FQ0A 1OHFA 3IPVB 2XL9A 1AL21 4XOGA 4B3NA 5FLJA 4WM8B 1QMJA 4CP0A 5DZFA 2PAKA 4IESA 1QJX1 3EBRA 2B9UA 4AVAA 4XFBA 2DURA 3PJQA 3H3ZA 3R05A 5GLTA 3TN91 2HWF3 2JX9A 5E88A 1GQGA 1UMZA 3BOPA 1SMVA 3SXWA 3WQ1A 3S7EA 2UWCA 5KHJA 4MVTA 2AREA 1PO12 2ZZJA 1RUC1 3POYA 4I0BA 3S7IA 1N1SA 4YARA 2GNTA 1HV1A 1A3KA 1AHSA 3AMQA 3NV1A 1FMD3 2W68A 4LBLA 4AG4A 3J8F1 3IDEA 4FTSA 4TYSA 2EA7A 3SH5A 4JGYB 5EXOA 1S0BA 3WNXA 1DGRN 1U5IA 4LBQA 1W6NA 5FTTC 1ONAA 4QHBA 4QGNA 4GWNA 2A3WA 2AGSA 1CAVB 1QF3A 5DZGA 3A0NA 5JOWA 2WQ4A 4IQPA 1V00A 3BCWA 2HEYF 2QUOA 2D40A 1S1AA 1ND2C 1LCLA 4FTBA 5LRSA 3EHKA 1LGBA 2GH2A 2NMOA 4Z1VA 4XMIA 3T1MA 1POV3 2FMDA 3AMPA 1ND2A 1Q8SA 3ME2A 4Q4Y2 4N43A 3B02A 3IKWA 1S0CA 2H6CA 2ZS6B 4N53C 4YW2A 1TMF1 1G9AA 4YM0A 2WZR3 2GN3A 3S0MA 2GDFA 3MW4A 3KGLA 1HRV1 1NQJA 3FLRA 4XJUA 3AZZA 2C9AA 2W39A 2WS91 4N53A 4HMZA 4W6XA 2IZWA 5EFUA 1CN1A 4XBQA 2BGCA 2JG8B 5E89A 4QMAA 2CNAA 4AEDC 5CFCB 4MXWA 3HQXA 1FI2A 2YGMA 4BM8A 2GC0A 1ZZ8A 3L2YA 2RMU1 5CAZA 4Q1RA 1VBC2 1BBT1 1VAVA 1QQP1 3ASIA 4MLOA 4ISQA 3WQ0A 1TQ5A 1KDMA 2GAUA 3M3EA 1IOAA 3B5LB 1DZQA 2I2SA 4AEDA 5J36A 2ZABA 2QDNA 1O4ZA 1SBFA 1KD7A 3M8LA 1OQ1A 4JC1A 2YHJA 2KA3A 2XJSA 1YFXA 4R4ZA 4YW1A 1PGL1 1XE8A 1R093 2ENRA 4YVSB 4IV3C 3NSTA 2VQ0A 5CU1A 2ZGKA 2ZHKA 1RUE1 2R072 2PTMA 4DZGA 3ZXLA 2ETEA 4GMP1 1J3PA 4TZDA 4Q27A 2JG9B 3USSA 2VMGA 3WDVA 1GSLA 4IV3A 4Q26A 1BEV3 3B93A 4ES9A 4BZ4A 4H3WA 3VBRB 1NE4A 1H8TB 3VZLA 2ZGPA 4XJAA 2GC2A 4S2GA 2PHUA 1XYPA 3I2DA 4IEXA 2WINB 4YZ3A 5JOXA 3E5UA 5FREA 1RHI1 1SLCA 1Y3TA 2DF7A 1YO8A 1UPIA 3IN9A 3J9SA 4L92A 4RQPC 5GZEA 1FNZA 4Z8BA 4I0WB 1R083 2A6WA 1EPWA 2WQZC 4GB32 4Q2FA 4FOYA 3EXUA 5ACA2 1QNWA 3LAGA 2P17A 2QZ3A 3VBOC 1WLTA 1OOPB 4YYOA 4DFSA 4ZU4A 4JCKA 1H4HA 1SCSA 1QOSA 4Q8KA 4PQ9A 4GULA 1CAXA 3KSCA 4OHVA 5HXVA 1LOCA 2WFF2 1NCRA 4GKYA 3VBOA 3W59A 5E16A 1VBA3 4G9SB 3HN1A 1LGNA 4L2NA 4YM3A 1A6CA 1H2LA 2WSUA 1MS9A 4QM8A 2X53S 3AKSA 3VDDA 2HWC2 1E57A 5I91A 1ASJ1 4V1PA 3ST7A 3VV1A 1UZYA 1JYIA 5JZGA 4R9BA 2HWB1 4COWA 2MEV1 4LTAA 2MHFA 1HXS1 2D44A 2RJKA 5DUUA 4D3WA 3V65A 4CDQC 1UU4A 5C8CC 1QWRA 3U07A 4D7TA 4TWTA 4I2OA 1RVF1 1W6OA 2RS53 4HVOA 2ZGLA 2I74A 1S0GA 1XXNA 4FTEA 1G86A 4CEWA 2P3KA 3MGUA 4PDWC 4QM9A 5A33B 1AYN3 5FPZA 5IUQA 3ZO0B 5D1IA 5FFOC 4YW3A 1AJKA 3ZMOA 1PK6B 3BB6A 4XFGA 4Q4W3 4S2HA 4QU2A 3VZOA 4XXPA 1MQTB 2V73A 4CDWB 1CJDA 3KD4A 2YXSA 2ATFA 4URTA 3U4XA 2PLV1 5JSPA 4PDWA 1D0GA 1GQHA 1RUG2 3IT8A 2C1FA 4KQ7A 1Q8QA 1J59A 4AI3A 2A7AA 4FBFA 4HETA 2XKPA 1I9RA 5ABJB 5IK4A 1O3TA 3RMYA 3T2TA 1GR3A 1ZBE3 4CEYC 4AVCA 3POSA 2CAVA 4LO6B 1QJY1 1EAH1 4YGCA 2TEPA 4GMP0 1TME1 4WM8C 2UYBA 4HFSA 2RS13 3WP5A 1OQEA 1DYPA 1KQRA 3JQXA 1C8M1 4XJWA 3KT4A 1LU1A 4Q0UA 2QCSB 2ZBJA 4LE3A 4IV1C 1ZA4A 5GLUA 3CJXA 4Q4X1 5DZEA 3BIWE 5L7OA 2TNFA 1R1A1 2XVLA 4KNCA 4FQ4A 1CGPA 2JD4A 2BQPA 1YFYA 2X8KA 2A6ZA 2DUOA 3TNQA 3INAA 2VW0A 2P34A 4IEYA 3JZVA 1A8DA 3KT7A 1B09A 1DDLA 4NWWA 3FMGA 4IV1A 3B7MA 1ZBA1 2QDRA 2E63A 3SCFA 4NR1A 3RWNA 3VBUC 3VN4A 1LTEA 4Z07A 1N1TA 4OHYA 4AHXA 1VRH1 4HN0A 4JGYC 1LEDA 1WLWA 2X29A 4LUKA 4Y26A 3JB4C 4YVWA 2A71A 4MYEA 3AJZA 3FE5A 4F83A 1PZ8A 5BXXA 5KXBA 3VBUA 2GALA 1FPN2 2RS33 4QPIA 2ZX4A 4ZU7A 1U5ZA 1AL23 3RQ0A 2Q30A 2ZTNA 3RS6A 2JECA 1KJRA 4WM7A 2UURA 4YRDA 4N90A 3ZSEA 5FQ0B 1LOAA 3OJBA 4XFCA 4LULA 1OA2A 1QJX3 4Q29A 5EYYA 4K7JA 1QJU1 4XHBA 3I7DA 3WP4A 1U5XA 5KC5A 3TN93 3GBFA 3H0OA 3G6JB 2DWRA 4LBQD 2VVEA 2WA3A 2GMPA 4RHV1 1LEMA 4MGIE 2EXHA 1KRIA 4YGBA 1WW5A 2ET1A 4AI0A 1RUC3 3UV9A 3DGTA 4RSUA 1J1TA 3SITA 4IL7A 3OTFA 1VALA 4M00A 4MSVA 3J8F3 2BVBA 3AJYA 4QGMA 1XQNA 3ZFFA 3PVEA 1QDOA 1VJ2A 2JG8C 2ZX1A 3DL3A 4OUMA 3ALQA 4UBGA 5CFCC 1WLDA 2ZPXA 4KBBA 1JH5A 4OHXA 4M0NA 4LBQB 3LWCA 3N7KA 1W6NB 1VBE1 2E6VA 3E5QA 4OVEA 4WVWA 5J37A 3H8UA 4M3CF 1WW6A 1KFUL 2JG8A 3WW1A 1ZRCA 4G4FA 5BPXA 2VVDA 3MW3A 2A6XA 1UPSA 2VECA 4LLFA 1FX5A 1DBNA 1SBDA 2BBVA 3AP6A 1AR61 1Z0HA 4OLLA 3V0AA 1LRHA 3AKTA 3LA3A 3AMNA 2ZA9A 2NZ9A 1REFA 3M3IA 1BVP1 3FZ3A 1TMF3 4PF5A 1ND3A 2D6NA 1X8EA 1ND2B 2JG9C 4L9BA 3TOJA 1LOFA 2ZGRA 4OHWA 3AB0A 4N43B 3FHIB 1HRV3 4XHXA 1GNZA 2IFRA 3USUA 4R8HA 2ZX3A 4FOVA 3OD4A 1ENQA 2HJIA 1GZWA 2WS93 3AFGA 5LK7B 4FVVA 2R062 1PVC2 3MIBA 1I1EA 3KZ4C 3VBRC 3WXPA 2BVVA 4LBJA 2NQYA 1H8TC 4XFFA 3B94A 1W39A 1G8WA 3JQWA 1ZRRA 2OW4A 5BNPA 1R091 1VBD2 3WG4A 4N53B 2R32A 4RS5A 3IDBB 1RUD1 4B29A 3PVBB 1BBT3 4K20A 1QQP3 2XVGA 4MXWB 1H30A 5CFDC 1M06G 4DB5A 5K7PA 4Y22A 1WBFA 4LBOA 2O1QA 1ZYBA 3SH3A 4L97A 2D6KA 1SLIA 4HBNA 4AEDB 1QNYA 3URFA 3DUIA 4Q4V1 5TSWA 5CFDA 4XZPA 1SLBA 1RUE3 1LODA 4Y1XA 1R081 3M3CA 2O0OA 4SBVA 4E2GA 4GMP3 4K40A 2Z5WA 5EV7A 1CQ9A 4UW3A 2ZGQA 3MFAA 2XJPA 1RITA 2P3IA 2A70A 3VHOA 2CWMA 3BALA 4XETA 4AVSA 2HWD1 4R9AA 4IEQA 1W0OA 2VOKA 3VKOA 2VNRA 1VBA1 3DV8A 4CP2A 2EF6A 2IFWA 4AQTA 1J3RA 2V09A 3HT1A 4C1WA 4BIOA 1DGRA 3KCCA 1MVEA 2JKBA 4NVPA 1WMEA 2ZHLA 3OCPA 4Y1YA 4AQ2A 5KWRA 1DGLA 4M0HA 4EN9B 2XLGA 1QGLA 4OI2A 2VH9A 3AKRA 1SCRA 4AHZA 1PK6C 5JAXA 1UKRA 4Y1UA 2B46X 1S0DA 2DYCA 3MIEA 3LSDA 1CPNA 3SISA 1UW8A 3WW4A 3RYPA 2CGNA 1CAXB 4D7YA 4CDUA 5D8AA 2JXAA 2YC0A 4DRVA 3WX5A 1BK1A 1N1YA 2K0GA 3H7YA 4EV0A 1AR91 1NCRB 2K9ZA 3SLIA 1BMV1 1C1FA 1DYKA 1F5JA 3VBOB 3TRSB 1AYN1 2CY6A 5ABJC 5KHHA 3IBMA 1MZEA 3DPRA 1VBB1 3AYAA 1OPOA 1GZCA 1JUHA 3VDDB 2E9QA 2XPJA 2DCZA 2P2KA 3VBHC 1HXS3 1H2MA 1RUJ2 3GHMA 1V6LA 3I59A 1ULFA 3NW4A 5JZGB 2VQAA 1RVF3 2PN5A 3EJKA 3UKNA 1IKPA 1ZZBA 2ZZQA 4OHZA 1X82A 1RUF1 2XL7A 3VBHA 2IXCA 5H9RA 3SHRA 1W0PA 1C4RA 1W6OB 4AFDA 1DFQA 1OLRA 1ZBE1 3EO6A 4XF4A 1JW6A 4NHMA 1J58A 4D7SA 2G4IA 4KGGA 4NN0A 4CEWB 2YYOA 4ZXKA 1HRI2 2OPKA 3ZPYA 1GNHA 4AQ6A 4N7IA 3MYXA 5FLIA 5JPNB 1V9U1 1YWKA 4FXKB 5AFEA 3JBG2 1LESA 1AYM2 2TBVA 3FUOA 4Y1VA 4PDWB 4EN7B 4E9KA 5BNQA 3ZXKA 1COV2 2BPA2 1AXKA 1SDWA 2AENA 3OGJA 3PTYA 1JXNA 3THPA 1VB2A 3NV3A 3WDTA 3R0RA 4MH0E 1CAUA 4C0HA 3ILRA 3B3QE 1QJY3 1EAH3 4SLIA 1EYBA 2ZGUA 1CAWA 3ENRA 1SACA 2HYKA 1QOOA 2XWJB 1C8M3 1HKDA 2R16A 3APBA 1REDA 2Q1ZB 3MIFA 1WCDJ 2HWE2 3C2UA 1OI6A 4FPYA 5H9SA 3KM5A 1MEC2 4N7UA 2K2SA 3WW2A 4Q4X3 4PCRA 1K5MA 1R1A3 1V6NA 4FAGA 3D6EA 4QQ2A 1QOTA 1FOD2 1EV11 5H9PA 2RS31 3QACA 5L7OB 3ZSMA 1NA1A 1ZBA3 4D94A 3VHNA 2ZX2A 2BUKA 4XTMA 1PO22 4LNVA 1HQNA 4CZSA 4D69A 2XBO2 4X6QB 2PELA 4IV1B 3TB0A 1VRH3 4P9YA 2YDEA 3ES4A 5AC92 4Q0QA 1PNGA 1QKQA 1ALYA 4R52A 2OIIA 3FFZA 5J09A 4JGZC 5CNAA 1DZTA 4H14A 4ASLA 4WVVA 2PHDA 4YVWB 1Y9QA 1I3HA 4P14A 3VBUB 1Z7S3 3IM0A 2RM21 2BNOA 4MX3A 4QPIB 1YFUA 4XIOA 2VMIA 1YRZA 2DVGA 1Y43B 4JGZA 1V6KA 1QJU3 2A6VA 4ONUA 1H2NA 2JICA 1ULEA 3AZWA 4WM7B 3POWA 2R1BA 4RA0A 3RI8A 3I54A 1UD1A 2OUJA 4RHV3 4ES8A 5T5JA 4BLIA 5AVAA 3MPPG 4OUSA 4EROA 2DCYA 3ILNA 3ZXFA 1FAYA 3J4UH 4N43C 4AGGA 5IK7A 3JCIA 2RR11 2ZGTA 4KWLA 4KU8A 1GICA 3U11A 3N7MA 2ZGOA 5GZDA 1YIPA 3GNEA 3UK9A 4DXZA 4NO4A 1NQDA 4J6GA 1ZM1A 4GH4A 4XDQA 5JOYA 4KU7A 2YY1A 1FATA 4KL1A 3UJOA 1W6QA 4B7KA 3ZFFB 5GKAC 4WVMA 1NY72 2D5FA 5CB7A 1VBE3 2R042 4BMBA 4XQWA 1OFSA 1LOEA 2ES3A 5KHIA 1RC6A 1W6PA 2XJTA 3ECQA 2VNOA 1VR3A 1OLQA 4MGYE 4DNYA 4YNIA 3CJIC 4K8FA 2VGDA 1AR63 4B4PA 1O4TA 1RUH1 4XQ4A 3H9AA 2PYTA 3M3QA 3JD72 4WZCA 5IT6A 1ZNPA 4KWJA 4YZ2A 3V0AB 5BV6A 1XNCA 3ZIXA 5FDBA 5CG8A 3CJIA 4AVTA 2D7FA 4XXAA 1C3HA 1DQ5A 3N36A 1ND3B 1H1MA 3WHUA 1MZ5A 4DPNA 2CV6A 5DDJ2 4FO9A 4PLMA 2D97A 2D3SA 2CL2A 4JRLA 1JYCA 3NO8A 3RPQA 1F5FA 3OYWA 4IETA 2NP0A 4ZU5A 3MEPA 2XJVA 1AR82 3USUB 1GZWB 3D5OA 3U0ZA 1RUD3 1MVQA 4XE9A 5DG2A 2NPIA 3ZXAC 1OQDA 3NV4A 5DXDA 1PO11 2PFWA 5BNPB 5I8YA 4P9IA 2ILMA 4YGEA 1HX6A 3BPZA 4RS5B 1WCKA 2OVUA 2DVAA 4H55A 1JN2P 1N3PA 1AR72 4GXLA 4BYYA 2FHRA 3ILFA 4PLOA 4E27A 4I3PA 2DU1A 1IHMA 4FOWA 4Y20A 2HKXA 1AZDA 4Q4V3 3MF9A 4E2QA 1YJLA 4Y22B 3SCHA 1CPMA 2I45A 3E6CC 4J1WA 5F1RA 1NCRC 5KHKA 2DU0A 4B4RA 1LHOA 5CFDB 4XBLA 2ZKNA 2OZJA 1Q8VA 3ZIWA 1C57A 3QD6A 4UW6A 3WV6A 3SNMA 1DZRA 3WG2A 3VDDC 2G9GA 2HWD3 3ELNA 3S6PA 4Q4Y1 2EXKA 5IK5A 2C5DA 2RHPA 5JZGC 4JTOA 3ZYGA 1N1VA 1PMIA 3GZUC 2DFBA 5JOZA 1FXZA 1FV2A 4RFT0 3GZTB 4NHLA 4EN0A 1PIV2 2V5YA 3GBWA 4P9XA 2PHLA 2OYZA 4COZA 1QY4A 1UAIA 2ZCWA 1RUOA 1IQAA 4CEWC 2JJ6A 1WLCA 2OUHA 1BVVA 3PVNA 5E8AA 2BFUL 1URXA 4UW5A 2DVDA 3WD5A 3FFQA 3FLPA 2UYAA 1VBC1 1ENXA 4AQSA 2HWF2 1NLRA 3VBSA 1AR93 2WLPA 3DKWA 1G9FA 3LCPA 4M01A 4CDUB 5D8AB 3ACLA 1YIFA 3AP7A 3KB5A 4XW3A 5JWPA 1VBB3 3H1YA 2LALA 4GALA 4M3CE 4YLZA 1FNYA 1GYKA 1FMD2 5CG9A 5T54A 4AEKA 1LKNA 3DPRB 1I6XA 1ULDA 4YZ5A 4HLTA 3VZJA 5I0RA 1F9KA 2R071 3ATGA 1LGCA 4MGKE 5C8WA 4AEJA 1U0AA 3R6SA 1RUF3