2MEV1

Structural refinement and analysis of mengo virus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
268
structure length
268
Chain Sequence
GVENAEKGVTENTDATADFVAQPVYLPENQTKVAFFYDRSSPIGAFAVKSGSLESGFAPFSNKACPNSVILTPGPQFDPAYDQLRPQRLTEIWGNGNEETSEVFPLKTKQDYSFCLFSPFVYYKCDLEVTLSPHTSGAHGLLVRWCPTGTPTKPTTQVLHEVSSLSEGRTPQVYSAGPGTSNQISFVVPYNSPLSVLPAVWYNGHKRFDNTGDLGIAPNSDFGTLFFAGTKPDIKFTVYLRYKNMRVFCPRPTVFFPWPTSGDKIDMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
total genus 43
structure length 268
sequence length 268
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev100
1Z7S2 5C4WB 4FTBA 1ND2C 1NOVA 1PO23 4Q4X3 5C9AC 3JBG2 1H8TB 2WZR2 5CFCB 3TN92 1PIV1 5BNNB 4N53C 2XBO1 1POV1 1QJX1 4N43C 4QPIB 2RMU2 5K0UB 1AR81 4QPGA 4JGYA 1RUE3 1VRH3 3JD71 1Z7S1 3VBFB 2MEV2 5CFDA 1NCQA 4Q4V1 3CJIB 1HRV3 2RM22 5BNOC 3TN91 1ASJ2 5A32B 5K0UA 2RMU1 5C8CB 1AL23 2QQPA 1R092 1VBD1 1RUH3 1NA1B 1VAKA 2HWD3 1NCRA 1AR62 2MEV1 2HWE1 3ZFFB 4Q4W2 2BUKA 1COV2 1MQTB 3M8LA 1HRI2 1RUC3 1F2NA 5CFDC 1PVC2 1SMVA 1NCQC 2RR12 5A32A 5C8CA 1VBB1 1CD3G 1R091 1ZBE2 3NAPB 1PO22 3VBHB 1RUJ2 4Q4X2 1VB2A 1AR61 1FPN1 1QJY1 4Q4W1 1OOPB 4CEWC 1RUD2 1NCRC 1QQP2 1HRI1 3ZFGB 1RUE2 1PO11 5L7OC 3JBG3 1ZBE1 4CDUA 2WZR3 4RS5B 1PO21 4CDXB 4SBVA 4FTEA 2X5IC 4Q4X1 4CDWA 2RMU3 1M06G 5LK7B 1OOPA 2TBVA 4GH4A 2RS53 1DDLA 1AR72 2R043 1AL22 1RUH2 3ZFGA 1RUE1 1VRH1 1QJU2 2RM23 1ASJ3 5JZGB 2DF7A 3VBRB 1R093 1PGL2 1POV0 4CDUC 3JB4C 4PDWA 3ZFEB 2GSYA 1AL21 1AR63 1RUH1 4WM8B 1AYN2 4CDWC 2HWD1 1QJU1 4YVWC 1RUI2 4GH4C 1COV3 1W39A 1FOD2 3VDDA 4RR3C 1AYM2 1HX6A 5DDJ2 3ZXAC 1F8VA 2ZTNA 1PVC3 4Q4Y3 2RR13 5ABJA 4Y4YA 1RUC1 1PGL1 1B35C 1ZBE3 2PLV2 1RUJ3 3J8F3 4JGZA 4CEYB 1ZBA2 1R082 1RUI1 1RUD3 4IV3A 5FMOL 1ND3B 4IV1A 4WM7B 1QQP3 4GB33 1K5MC 2RS52 5A33B 2R042 5C4WA 5J96B 4GMP0 2PLV1 1BEV2 3VDDC 2GH8A 1H8TA 3JBG1 5CFCA 2WZR1 5BNNA 1VBC3 1RB8G 1ZBA1 5ACA2 1AR73 1CJDA 4QPIA 4YVSB 5FOJB 2FZ2A 2RS51 1R1A2 4JGZC 1BBT2 4LLFA 2R041 3VBFA 1QJU3 1MEC2 1BEV1 3LOBA 3CJIA 4IV1C 1RUF2 4QPGC 4JGYC 3VBSB 1RVF3 2RM21 4RHV3 1EAH2 5C4WC 5BNPB 5ACA1 4YVSA 1ASJ1 4Q4Y2 3DPRB 4RQPB 4Z92B 5FMOS 1H8TC 1NA1A 5CFCC 1AYN3 1TMF2 2FZ1A 5BNNC 3J8F2 1NY72 1V9U2 3HAGA 3VBUB 1RUI3 1AL0G 1FOD3 4QPIC 5D8AB 5GKAC 3ZFFA 5K0UC 4CDQB 1A6CA 3VBOB 3VBSA 1AYM3 5DDJ3 4AEDB 1COV1 1MQTA 5BNPA 2IZWA 3VBFC 4GB32 2BPA2 2PLV3 2RS32 2HWB2 4RQPA 1PVC1 3JB8A 2RR11 3CJIC 4Q4Y1 1QJZA 1RMU2 3NAPA 3VBHA 1TMF1 1RUJ1 3J8F1 1EV12 1ZBA3 2WWSA 1R083 1C8M2 3VBOA 4RFT0 5C8CC 1VBC2 1HXS2 1VB4A 2RS12 4AEDA 4Y5Z0 4YVWB 1X33A 1RUD1 1TME2 2WS92 1GFF2 1QQP1 4GB31 2BBVA 1BEV3 3ZFFC 2RS31 1VBA2 1WCDJ 4RS5A 4CDXA 1B35B 1ND2B 4NWVA 5ACA3 5C9AB 1RVF2 4RHV2 1D4M2 1HXS1 1VBC1 1X36A 2RS11 3NAPC 4N53B 3VBHC 1R1A3 1AR71 1AR92 4N43B 1BBT3 1MEC3 2HWF3 1RUF3 1OOPC 5AC93 1EAH3 5JZGA 2WFF3 3ZFGC 1RVF1 4RHV1 3VBRA 5BNOB 1D4M1 2R073 4N53A 4RS5C 1TMF3 4N43A 3ZFEA 4CDXC 1V9U3 5BNOA 4WM8A 1AYN1 2R063 2ZZQA 1VBE2 1QJX2 1AUYA 1FOD1 4PDWC 1AYM1 5DDJ1 4QPGB 2RS33 2HWB3 3JD72 1RMU3 2Y26A 5CFDB 2XPJA 4Q4V2 1NCQB 1EV13 5JZGC 1C8M3 5ABJC 4CEYA 3VBRC 1HXS3 2RS13 1VBE1 1R081 3ZFEC 4FTSA 1ND3A 4WM7A 1TME3 2WS93 1RUG2 1VBD2 4WM8C 5A33A 2WLPA 4CEWB 1FMD3 2HWC2 1VBA3 1E57A 1NCRB 2HWF2 1PGW2 2HWE2 2VQ0A 4IV3C 5L7OB 5AC92 4BCUA 1D4M3 2ZAHA 2X5IB 2WFF2 1AR93 1RHI2 1VBB2 2R072 1RUG1 1HQNA 4CEWA 1R1A1 4CEYC 1BBT1 2HWC1 1BMV2 1MEC1 2HWF1 1PGW1 1ND3C 4WM7C 1FPN2 1QJY2 2R062 1RUF1 2BFUL 5L7OA 5AC91 1EAH1 4GMP1 2X5IA 4NWWA 3DPRA 2WFF1 1PO12 1RHI1 2R071 4CDUB 1PIV3 3VBUA 1NY71 1V9U1 2XBO3 1VBE3 1POV3 1BMV1 1QJX3 1C8NA 5D8AA 4YVSC 4CDQA 4CDWB 1AR83 2R061 1NG0A 1NA1C 4GH4B 3JD73 1Z7S3 4RR3B 2HWB1 4Q4V3 1FMD2 1OPOA 1VRH2 3VBSC 1RMU1 1MQTC 5BNPC 3TN93 1EV11 3DPRC 4RQPC 1HRV2 1C8M1 1RUG3 1VBD3 4YVWA 1IHMA 2BFUS 1TME1 2WS91 3FBMA 2HWC3 4PDWB 4RR3A 3VBUC 4EJRA 5D8AC 2MEV3 2HWE3 1K5MB 3VBOC 4CDQC 1FMD1 2HWD2 1VBA1 4AEDC 1B35A 1ND2A 4FSJA 3IDEA 3VDDB 4GMP3 1OHFA 5C9AA 1HRV1 1RHI3 5ABJB 1VBB3 1RUC2 1AR91 3S6PA 1K5MA 5J98B 1FPN3 1PIV2 1QJY3 4JGZB 2XBO2 4Q4W3 4IV3B 1AR82 4IV1B 1HRI3 4JGYB 1PO13
chains in the Genus database with same CATH superfamily
5A7PA 5C4WB 1W2UA 4RGGA 4AQTA 3POWA 5C71A 2CNAA 1S2KA 1UXZA 1JUIA 3UK9A 1CAXB 4TWTA 4XMIA 5C8WA 1VP6A 3JBG2 3PL0A 4MYEA 2YY1A 1LGBA 2OT7A 2HH9A 4QD2A 1PIV1 4JDOA 2XBO1 1O4TA 2K2SA 2NZ9A 5IW0A 3WF2A 2VQAA 3K51A 2GNBA 4N43C 2J7MA 2QDRA 4GALA 2VQUA 4QPIB 2DURA 3H7YA 1LOCA 2ZKNA 1PM7A 2GALA 3KGLA 4CCEA 1GZWA 1UYXA 3O14A 4XMAA 4BJ0A 4DY5A 1VRH3 1CAVB 4G4FA 3ASIA 1SPPB 1Z7S1 4LO7A 4Z1VA 2MEV2 4IUGA 3VZMA 5T5PA 4Q4V1 3ZXFA 1ULDA 2VL4A 4XUNA 5DAPA 5FYSA 1J58A 2JDKA 5L9RA 3VZJA 3TEWA 2WUHA 4NHKA 3Q8CA 3MFCA 4NROA 4FPYA 4HPKA 4KL1A 3ZKYA 4CU7A 2H6CA 3HIFA 5BXXA 4IE4A 1XE7A 3AZVA 5K0UA 4UI9L 2QQPA 3V0BB 4KG0A 2GNMA 4NIHA 2R6QA 3PTYA 2DTWA 2Y60A 3DF0A 4BIFA 3U37A 1F4HA 2HWD3 3P1IA 2ADEA 2PQSA 2W87A 2Z5WA 3JUUA 2HWE1 3E6BA 4UT5A 4XVHA 2FDHA 4JC1A 1ENXA 5FPVA 4Q4W2 4UW4A 2B42B 4OMCA 1R64A 5LBFA 3S0MA 3TB0A 3M8LA 3D0JA 3ZXLA 3I3MA 2JB8A 4XJAA 1ZRDA 3N7JA 1O91A 1MVEA 1F2NA 1XSRA 2VJXA 2HBUA 5FZBA 1SMVA 5FY8A 1S0CA 4A7KA 5E88A 4EWEA 1SG3A 3BIWE 1VBB1 2AEYA 1EUUA 4BYYA 5C8CA 3THCA 1L7QA 1SDDB 4R9CA 1WCQA 3T2PA 3CMGA 1QMJA 4FQ4A 3VBHB 2A70A 1Z78A 4JDMA 3W20A 4CCCA 4PBPA 1CIWA 1ONAA 1UCXA 3MYXA 3WNLA 4EE2A 3WVJA 5IATA 3W5MA 1OOPB 3EO6A 1RUD2 5EXOA 4OMDA 2ZX2A 1DP0A 2JICA 1W6PA 1Q8QA 4AHWA 1QQP2 4BQ2A 1QOOA 3HNBM 2JG9A 2WQ8A 3U1XA 1LENA 2WQZC 3C2UA 4XCAA 3ZFGB 4NRQA 3RI8A 3WXPA 2YPDA 1LOFA 2DTYA 2CGPA 2CAVA 5FZIA 4FTEA 3AYEA 4HZFA 3ZOIA 1NQDA 1PZ9A 3HBKA 3APBA 2DFCA 3QACA 3WY6A 4CDWA 1J1TA 3A0KA 5F6LB 4P02B 3R4SA 4QX5A 3GJAA 4GH4A 2X10A 2AR6A 5DG1A 1H4GA 3CF6E 3WDXA 1DDLA 4OYUA 2LRPA 1BVP1 1S1AA 5FY7A 4IEYA 5FKCA 2WQ4A 2XLGA 5HCFA 4M00A 1C1LA 1ZZBA 4QB1A 3ME2A 4UFLA 4XDOA 1YQ2A 3FFZA 3NNMA 2BV4A 2EVXA 1GUIA 4KWKA 1Z0HA 1S0DA 5CYYA 3SHRA 1A8MA 1I9RA 4COUA 4OUEA 5F2SA 3DL3A 2E53A 3RRDA 1WZXA 3A23A 1JOBA 4A6SA 1ASJ3 2FDJA 3KWVA 4COVA 3CNAA 4XHXA 1HJGA 1LOFC 4XJWA 4CCLA 2PFWA 1OD5A 2YXSA 2JDUA 4AWDA 1BKZA 4LO5B 3UETA 4DUXA 1DLLA 2Z2SB 4XYXA 4OUSA 1AL21 2UWCA 5LA2A 1GKBA 1Y7BA 3MHZA 4QXBA 2ZMKA 4NIDA 2OVUA 1OC1A 4FFGA 4K20A 4LOSA 4CDWC 4XUOA 3VGIA 4M0HA 2DUPA 5FYYA 1W99A 4GH4C 4CTEA 2FDFA 1W39A 2Y34A 3H8UA 1JZ6A 1LEMA 4INDA 4QM8A 1JN2P 4FPFA 4RR3C 3UKTA 3ECQA 5F7UA 1G9FA 3ZXAC 4XABA 1F8VA 3OGRA 1PVC3 4Q4Y3 2OQ7A 2RR13 1CAWB 3HT2A 2GNTA 5DAWA 4Y4YA 3GHMA 3EYPA 1H9PA 4ZZ8A 4BQ3A 1PGL1 1N47A 1B35C 5A7QA 2WIIB 4MSVA 2ETEA 3FZ3A 4AQ2A 2HYKA 4ZXEA 1WMEA 1W8ZA 1QNWA 4B8EA 4EYUA 1U0AA 3IAPA 5FZEA 1OFSA 5A3NA 2EIEA 1RC6A 4GA9A 4P00B 3I3QA 1ND3B 1T6BX 1XPWA 1VAVA 3W58A 1K5MC 3MEPA 2P6HA 4XURA 4A4AA 1TZOA 3B01A 5J96B 3D3AA 3EXUA 4YFWA 1XNCA 2PLV1 4N7UA 4QGLA 1CN1A 1AX0A 1FATA 5HCHA 2ZBJA 5F1RA 2VVFA 1HB2A 1H8TA 1MZFA 3MIDA 4TN7A 4Y20B 1IKQA 2WZR1 3RZHA 4LE3A 1VBC3 4PI2A 2QQNA 4FPCA 4NE9A 1G8WA 3Q8FA 1UX7A 4LBJA 5DUUA 5FOJB 3NVCA 4FP3A 2XUEA 3AJZA 1HB3A 3HBZA 4GJZA 4CSWA 1JMUB 3RZKA 4QT6A 5IK8A 2RS51 3SLIA 4WZCA 1IG3A 3R4DB 1W2NA 1GQGA 2VOKA 1UPIA 3HD8B 1LHVA 4CPBD 1N3QA 5F5QA 3VZNA 4DS0A 1U5XA 3MPBA 1BEV1 5FPZA 3SMHA 2VXRA 2YGMA 1RUF2 3MW4A 2JIJA 3ILRA 5I91A 2WNUA 4D3WA 1EAH2 2E7TA 4LK7A 4M4RA 4YVSA 2BP6A 1WKYA 4Q4Y2 5D2AA 3SCHA 2R1DA 3USUB 4XCBA 5JUVA 3HN1A 2PAEA 1H8TC 5I93A 1TMF2 4W50A 2FZ1A 2CL2A 1ZA4A 3K75B 4D0QA 3O5SA 1JYWA 5DDJ3 4BM8A 1COV1 2ZGLA 4AEMA 4B3NA 1MQTA 5FZOB 4YGDA 5FYIA 3LA3A 4IETA 2BPA2 1L7RA 2GP3A 2PLV3 2WR9A 3FHQA 4OZXA 4AZZA 2JE7A 4K7JA 1XRUA 5CB7A 3JQXA 3D4KA 2WNUC 1GICA 2BNOA 1W9WA 4D94A 2ZX3A 4OHWA 3I2JA 3RZLA 2WWSA 5JIAA 2YFZA 1R083 3K3NA 3PVNA 5JI7A 3R4UA 5DPNA 1C8M2 3S30A 1VBC2 1HXS2 2W47A 3BTZA 3MUY1 4KG8A 3NV1A 3D6EA 2BEOA 1XNAA 4LT5A 1YQ6A 1W8TA 3NW4A 2E7AA 1OH3A 1YQCA 2E33A 1X9PA 1BEV3 3ZXEA 2W68A 1ZZCA 3I2IA 4B7KA 3NV2A 2AREA 2A6WA 3ZSJA 3PVBB 4LHLA 4CDXA 4FAGA 3BYWA 4YG6A 2C0ZA 1LODA 2SBAA 5A7OA 2DUOA 4X6RB 4ATFA 4EWDA 2VD7A 4CVUA 4X8PA 1DLCA 4H7LA 1N3OA 2Q1FA 4NUBA 2JE9A 3MF9A 5JWPA 2XHNA 4N43B 1BBT3 3WW3A 4MVTA 1GWKA 1L7LA 2EICA 3VHPA 1FNYA 1S0IA 1MEC3 1B09A 1SLBA 4LA3A 3OPTA 1YJKA 2ARCA 4HG6B 4HVQA 1ZVFA 1VR3A 4WVZA 4W8JA 1NUKA 1T6GC 3WNMA 3POFA 1DFQA 2V4VA 3USSA 3H8RA 1UMHA 3WF4A 5GLVA 5JZGA 1I5PA 4ATEA 4RHV1 2YDEA 4PF1A 5DZEA 1W03A 3VBRA 4N53A 4NN0A 4CDXC 4KI5M 3TNPB 1V9U3 4RD7A 3T0BA 4XFBA 1GZ9A 5JPMB 3U0ZA 1V0AA 2XVGA 4UFHA 1AYN1 1F9KA 3AC0A 5CEHA 4Q1PA 1MS0A 3K4ZA 5DABA 3MBWA 3VL8A 2XR4A 1WD4A 4Y5SA 5GLUA 2EAKA 2A6YA 1VJ2A 2F17A 4YGEA 3DYOA 4ZONA 5FUNA 1A3KA 1XYOA 4LK6A 3V0AA 3LB9A 1XXNA 1D0HA 4GZ9A 3KT1A 4UFKA 2PHXA 3RG0A 1GZWB 5D1IA 1QOSA 3JD72 2A6VA 3SKVA 3FJSA 4ZHNA 1RMU3 2R0HA 2BWCA 1LOBA 1DF0A 3BTAA 4WVMB 1ODMA 2XPJA 2OKXA 2ZACA 4KH9A 2PELA 4K40A 5DZGA 3I3DA 3VB9A 1R1ZA 5JZGC 3RMXA 1HN0A 4CEYA 3I2GA 4M01A 3VBRC 2CU5A 3KV9A 4IDZA 4AEKA 2MNGA 2D6KA 3NNGA 4E2GA 4WM7A 1TME3 4FTSA 2WS93 5LA9A 1RUG2 3I7DA 4P9JA 1VBD2 5JCTA 5FZ4A 1AZDA 2Y6GA 1WGPA 2CDOA 1CAUB 3OBAA 3ZN5A 5J36A 1AF9A 1S55A 4XF1A 1VBA3 2VNVA 2VVEA 1X50A 1LOEA 4FT8A 1QF3A 1X82A 3PVOA 3LWCA 4AVVA 2FQPA 2Y0OA 4UXAA 2WO3A 1AJOA 4Q0UA 4AI8A 3TEXA 4Y1VA 2JKXA 4IE0A 4XC9A 5A3OA 2UWAA 2WT2A 5FYBA 4SLIA 1AR93 3KCXA 4UFJA 4Z07A 4W65A 3E1F1 2VZQA 4CEYC 3O1PA 5FYTA 1BMV2 4MX3A 2JENA 1IG0A 3LIGA 4XQWA 3HN3A 4EN8B 5FXVA 1GOFA 1UKRA 5IFPA 2IXKA 4WM7C 1OA3A 5FAXA 3H0OA 1QJY2 5LB6A 2V09A 4UF0B 4F7ZA 3ZXKA 3IDAA 3POYA 5L7OA 3MFAA 3LSDA 3ALQA 3B3QE 1DGWA 3PU8A 1OPMA 1IKPA 1W6PB 4NWWA 3WEZA 3DPRA 5JVVA 1W28A 1OFNA 2CY6A 2ZPXA 3OEAA 5FP4A 1J84A 1PO12 2O14A 2R071 1W8FA 5FUPA 4YARA 2JECA 3OF1A 1OA2A 5IWFA 3ZYBA 1UU5A 1C5HA 5IAVA 3VBUA 3GJBA 1QNYA 2PHLA 4NRPA 5T52A 2Y64A 2VUJA 5EV7A 4CDWB 2LALA 1ZZ6A 3MI8A 2K46A 4W6WA 4KWLA 5E89A 3C3VA 4GH4B 3SEEA 3ES1A 2W95A 4IL7A 2FDGA 2BWAA 4RR3B 5LRSA 5JIUA 3AK0A 2GDFA 3E6CC 1UMIA 3AMHA 1V6LA 1OPOA 3IMMA 1Q8OA 3VBSC 3M70A 1YNAA 5KXBA 2X8KA 4UFIA 5FZ0A 4QHBA 4UW3A 3BUCA 3TN93 4EROA 2E26A 3ZPYA 3VHRA 1N1YA 4Q0VA 2C6SA 3WZ1A 3DPRC 4RQPC 2ZX1A 1DYKA 3QOPA 4PIXA 2ZOEB 3THDA 5GJ6A 5CVRA 2J22A 2IUWA 3RMYA 4YVWA 1JUHA 4AF9A 2RJKA 3VD9A 2ATFA 3MGUA 4CP9B 5AFBA 1PHMA 1NZIA 3FBMA 4FFHA 3VBUC 2OQ6A 1XNKA 5FLHA 1K5MB 1HIXA 2WSUA 3VBOC 1F5FA 3MV01 3PJYA 4EN6B 3W59A 2DVGA 4BXSV 3E97A 5A3LA 3T1LA 3IDEA 1KFXL 3N3HA 2DVBA 4LKDA 3LPFA 1JU3A 1OHFA 3LA2A 4N90A 2H0VA 1QH6A 1CZVA 5T50A 4JKLA 3FBYA 3K4AA 4PT6A 1CQ9A 3N9NA 4FOWA 2VM9A 4WV8A 4YW7A 2ZGSA 3ZXDA 2RJ2A 4HT1T 3ZYGA 3AX4A 2PAMA 1X8EA 3O0WA 1JOPA 1H9WA 4QX2A 1FPN3 3OB8A 5E6HA 5J98B 3RI9A 4LKEA 3NKGA 4XIOA 2C26A 4AL9A 5LBCA 1PNGA 2OXBA 3FUOA 5G04L 4OHVA 2XXZA 2ZAAA 3ZMNA 1HRI3 3CJXA 4QX7A 2IXLA 3INAA 1LAJA 4CZSA 4LBLA 3OPWA 5HI0A 4XUPA 5BNOA 3M3QA 4GQ7A 2QQWA 4AW7A 3PURA 1NOVA 1SLTA 3SC7X 5FO9B 2TEPA 1G86A 4IERA 2Q8DA 4Q4X3 4MOAA 4META 5F3IA 3O1OA 1H8TB 2P3KA 3TN92 5GZDA 5FOBB 1GMMA 3K48A 5F3CA 3ZLIA 1IOAA 4EN7B 1QJX1 2DFBA 5DN2A 4CUCA 1O5UA 3AL5A 3WNPA 2RMU2 2BNMA 1AR81 4QPGA 3VDCA 4JGYA 4ZKTB 1DGRN 4UOJA 2QQMA 4AE2A 2R7EB 4AI0A 2HJIA 3VZOA 5IAXA 5IVCA 1TNFA 1ULGA 5BPXA 3E6DA 4XQDA 5F5AA 2JG8C 1TG7A 4LHSA 4M0NA 3EQEA 1CVNA 4IGOA 5F37A 1UYZA 3RZJA 2JEMA 4BPZA 4YZ3A 4LE4A 2RM22 3I2FA 4XXPA 5BNOC 3VHNA 3LD8A 2WNUB 4A45A 5B4NA 3MIBA 3SH4A 3PUHA 2VNOA 1MZ6A 4AQSA 4CU6A 5A32B 4GWIA 2NYYA 1R092 1E5SA 1REEA 2WN3A 4LO8A 5FLIA 1RUH3 1JYXA 1NXD1 3DYPA 3ACFA 4QX3A 3WW2A 2VZRA 1CJPA 1VPHA 2Y38A 3ABZA 2MEV1 3OUIA 1GR3A 4AFAA 3OCPA 2PHTA 1BK0A 1QY4A 1OXCA 2OZ6A 1DQ0A 1MQTB 3B5LB 4Y22A 3UGFA 2ZGPA 1HRI2 1RUC3 2ZEXA 1O8SA 4AVTA 5L9VA 5FTTC 2VO5A 3EBRA 1GBGA 3VD4A 4PQ9A 2E63A 5F3GA 4L92A 1CD3G 4HOOA 1BZWA 1QHDA 1W6NA 3KT7A 4LBQD 4YG0A 5E8AA 4DEQA 4I30A 1JOJA 5FPUA 5I0DA 4JAAA 2VXJA 2W52A 2WZPP 5A1LA 1RUJ2 4H55A 4Q4X2 1TNRA 1VB2A 2OUHA 2FBEA 3BALA 4NJ4A 4P14A 3K2OA 4AVAA 4Q4W1 3VV1A 3VZLA 1C5IA 4AAXA 4CEWC 2V5YA 4BK4A 5GALA 2PQQA 1HQWA 4Q1RA 2JIGA 5JMCA 4HLTA 5FP8A 4M3CE 4BH9A 2IFWA 5BV6A 3GXUA 2AENA 2VMGA 3O1RA 2GN7A 3I2HA 1SBEA 5BNQA 2ADDA 3JBG3 1CONA 3TEYA 1Q43A 1S0BA 2YYOA 4CDXB 1BXHA 4SBVA 3UJQA 1V6JA 1W6QA 2P4EA 4QAWA 4AAPA 5FMBA 4OULA 5I0UA 1WWYA 5JSOA 1JTZX 5M0TA 4B4RA 1M06G 1CZTA 1PK6C 4Q0QA 2Q5TA 4BQ1A 1AR72 1MS3A 1AJKA 5FKBA 1JU4A 4TTGA 1D2SA 4GKYA 2B7YA 4TLFA 2MHFA 1NX9A 1RUH2 3ZIWA 3ZYIB 3FHIB 1WLTA 1UL9A 3U4XA 1VRH1 2ZGMA 1MS5A 1QJU2 2Q8CA 4YM1A 5CZKA 4CA9A 4Z2WA 5KC6A 2Y6KA 1V6KA 3O0XA 3WF0A 4XILA 2G19A 2PXJA 2J1EA 1JODA 3P3PA 4H14A 2VZ1A 4D7SA 5JZGB 3TRSB 3BCWA 5FPAA 2VMHA 3C7HA 3O1SA 3VBRB 3NNLA 2W08A 1POV0 1UZYA 2IXCA 3PUIA 3HNYM 1OQDA 4PDWA 2XB6C 4GWJA 4IE7A 2ORXA 1UOFA 3I2KA 5DXDA 5FYVA 4FAHA 4CPBA 2VPVA 3H3LA 4YW3A 1V6IA 1MVQA 2HWD1 3AB0A 1XOYA 3OGJA 1RUI2 3IDCB 1FOD2 1QDOA 5KXEA 3V0AB 4XHBA 3VDDA 1ENQA 4A3ZA 1AYM2 1HX6A 1UY3A 2A73B 1SLLA 2D3SA 2GMPA 5FZ8A 3N7KA 5CG9A 1XC6A 2R32A 3QCWA 4B29A 3L2YA 1I5ZA 2RE9A 2XGXA 4JQRA 2RJLA 1OVPA 2Y6FA 4JTNA 4BXFA 2PHRA 4I3GA 4XJ9A 4CEYB 2QKDA 1JHNA 1KJLA 3WW4A 1RUD3 1V6OA 1LR5A 2XH6A 5IK5A 2WWUA 2ENRA 3QBQA 3FN9A 3ZSKA 4WM7B 5FZCA 2TNFA 2W94A 1QQP3 2OA2A 2ZGNA 1TEIA 2O8OA 2EXIA 3B93A 3V65A 5HCBA 2EXHA 4LBNA 3RJ2X 2YROA 3NWKA 5LK5A 4GMP0 1GZTA 5KC5A 4FPKA 5FP9A 3VDDC 3K3OA 4O65A 1XB9A 3B69A 1YHFA 3LEIA 5BNNA 5GLTA 2ZHNA 3LAGA 5DQ0A 3HPNA 1WUVA 1CJDA 1XE8A 2OX0A 2ZX0A 4JZRA 3LGRA 1GU3A 5FY9A 3OY8A 1G9AA 2FZ2A 2DVFA 2RDQA 3EHKA 4QX0A 5L36A 1R1A2 3RJRA 1W6MA 3S7EA 4A2UA 1VIWB 3T0AA 4U36A 2Y6HA 5FBZA 5JSRA 2BW8A 1Q8PA 2QQVA 5A70A 1KJRA 3R05A 3DN7A 1XJAA 3IT8A 5A1FA 3T4HB 3VBSB 5JR7B 5FK8A 4JHTA 1RVF3 3A7QA 5LZ6A 3ZXJA 5C3QA 2C5DA 4FP2A 4FCAA 3ZYHA 1ASJ1 4BB3A 1JXNA 3DPRB 4RQPB 4Z8BA 4BLJA 3HQUA 3ORJA 3OGVA 2WSVA 4GKXA 2GC0A 4A7ZA 1VE0A 3VD5A 4FPOB 2YUEA 3DXUA 3BI3A 5BNNC 4IEXA 3ZIXA 3VBUB 3IZOA 5FR3A 4XEZA 5GKAC 4CCDA 1E5HA 1HW5A 2H6BA 2K9ZA 3VBOB 1US2A 5C6CA 1YRZA 5K0UC 3M1HA 4QMAA 1YLLA 3HWJA 4B1MA 4DUWA 4Z2AA 5BNPA 2QTWB 3PUAA 5FP7A 2I74A 4CXYA 3I8TA 1N1VA 3M2MA 2HWB2 4KBZA 1PVC1 1HV1A 2RR11 4NHMA 3KGZA 4Q4Y1 4HANA 4XIKA 4YW2A 1QJZA 2A71A 3AM2A 3NAPA 2X09A 1PX4A 1TMF1 2VUDA 4AFBA 1OMIA 3CZUA 1EV12 2VR4A 4JX0A 4BU2A 4Y26A 2XJVA 3R0RA 2VBDA 4BMEA 1H1MA 4QB2A 5C8CC 2ERFA 1X7NA 3ST7A 3T4VA 4AEDA 1DZRA 2VCBA 5LCWL 2ID4A 4YVWB 1X33A 4KBBA 1POQA 3DCQA 2AZ5A 2J42A 3O1MA 2CAUA 1IPSA 1W6OB 2XHKA 2BYVE 1DGLA 3GNEA 1MPXA 2JX9A 3T0DA 1DGRA 4P9GA 4EV0A 1CR7A 3OBRA 3MIFA 1W8HA 3DKWA 4LIUA 2NQYA 4NWVA 4XDPA 2JG9C 4L11A 2VBPA 5FYCA 5HPOA 1RVF2 2BGOA 4YW6A 4ARYA 1H1IA 4Z82A 5CAZA 1H2NA 1YQ8A 4TLGA 1WMXA 1VBC1 1HXS1 1X36A 4HVRA 3NAPC 3AP5A 4P5HA 4RYDA 4HVOA 5DUVA 2B46X 4XFCA 1WA6X 2JDYA 2VZ3A 4Y24A 5LRRA 1W3XA 3ZM8A 4J1WA 2JDNA 2HWF3 4NHYA 2YBPA 5FCCA 2UY8A 4AOCA 3MLLA 1RUF3 4QXHA 4HSLA 4JKKA 3C8XA 4XF4A 3WDYA 3FHAA 5AC93 2E6VA 1Y3TA 1EAH3 2JG8B 2QZ3A 3H1YA 5F5IA 3RWNA 5H9QA 4NR1A 5IVFA 4COYA 1IPJA 2XJUA 4YGCA 3ZN6A 4XFIA 2F6BA 3GHNA 4XACA 5BNOB 3MUZ1 4CU9A 5KXDA 1ZA7A 2VTXA 4NIGA 1GOHA 1TMF3 2WLQA 3ZFEA 3HVDA 4OCTA 1I3HA 3UL2A 4A42A 4WM8A 4Q0PA 2ZMLA 1BYHA 2JJ6A 1ULCA 2P6CA 3U14A 1DBNA 3VKFC 1GOGA 1FYUA 3Q8EA 1AUYA 1GP6A 2I45A 1N1TA 2FDIA 4YWAA 5DDJ1 2ZEWA 4QPGB 1W90A 2ZGUA 3DXTA 4FPEA 4PJYA 3VL9A 4LHKA 1VMJA 2ZX4A 1XBFA 4NRMA 1WW4A 1YYNA 2LM3A 5FZHA 5CISA 4RFRB 4LHNA 4Q4V2 4ET7A 5A3MA 1NE4A 3FFQA 1I6XA 1IZ3A 1ALYA 1AX1A 1ODNA 1C8M3 2CGNA 2I07B 2KM2A 1HXS3 1R081 4K8FA 4MGYE 4QDQA 5DAVA 2RVAA 3ZFEC 1M4WA 4AFCA 4I2OA 1QXRA 2A1XA 5EQUA 2YC2A 3RFRA 4MUVA 4WM8C 5A33A 4Q8KA 4Q27A 1MS4A 1YJLA 4CEWB 4E8DA 2NMOA 1FMD3 3LE0A 4KQ7A 4OI4A 4P9YA 1E57A 1HKDA 2GMMA 1ZM1A 4PBOA 4PHZA 2HWF2 2HWE2 2QFEA 5L19A 4JCKA 5A6ZA 3BTXA 3M7AA 3UESA 3NSTA 3U07A 3LOIA 5FREA 4XJZA 3W9AA 5AC92 5GZEA 1JZ4A 4E9KA 2R30A 4G9SB 2LS6A 3QH6A 1W2OA 3OYWA 5EWSA 4GWMA 1VBB2 2AYHA 3HOBA 4IQPA 1FXZA 1RUG1 4JRLA 1PK6B 1HQNA 1N1SA 1PMIA 2PAKA 1SBFA 2GAUA 3NNFA 5T55A 4AI3A 4E4HA 1BBT1 2UY9A 5T5OA 4BLIA 4XE9A 1MEC1 2EAAA 1DG6A 2GMEA 1J83A 1DU3D 4D6RA 3H50A 2PHFA 2WAOA 2D43A 1OLME 2BFUL 1H6XA 2FCTA 3CDZB 2A5ZA 4KMQA 3H7JA 4BHPA 1KXGA 1PM4A 4GMP1 2X5IA 2QQUA 1N3PA 3L9JT 4IEVA 4LO6B 3HQXA 1OUXA 1W05A 2XJSA 3UNPA 1H6YA 2W1QA 4LORA 3NRUA 3NV4A 1PGSA 4DO0A 2D5HA 1KDKA 1NY71 1V9U1 4P9LA 5FZFA 3RZZA 1POV3 4OLLA 2ZMNA 5LATA 1W6QB 2DDUA 2A7AA 3ILNA 4LLOA 5D8AA 4YVSC 2UU8A 5FZGA 3SH3A 4CDQA 5JXHA 5J37A 1O3QA 4LOTA 4QKNA 1JYIA 1RUOA 4BQ5A 1LULA 2VQTA 3LSEA 4DXTA 2ZGQA 2ZGKA 3AVSA 4MXVA 3I59A 2X53S 4NO4A 4CCKA 2A3WA 3LPGA 2QZ2A 3JD73 3RYRA 4PLNA 5FO8B 1H8VA 1WW7A 3WDTA 1UY0A 1FMD2 2WYSA 5J3UA 1RMU1 3ZR6A 4QM9A 4QPWA 1MQTC 1GWLA 1RXGA 4P08A 3HQRA 1S0FA 1OKQA 3KT4A 1HRV2 3N36A 3IB3A 4FQZA 4IGQA 4V2WA 5IHRA 1RUG3 1VBD3 5B2GB 1IHMA 2TUNA 3GCWA 1GSLA 1S2EA 2D3RA 3T1MA 1TME1 2WS91 4HMZA 4PDWB 5FZKA 2XOMA 4X8NA 3WSOA 4LR4A 4O9GA 5D8AC 4YPJA 3X29B 4CDQC 1E5RA 3A21A 1Q5OA 1VBA1 1YEWA 1VMFA 3VHOA 3Q8BA 1ND2A 4FSJA 2CWMA 3CIHA 4J6GA 4KGGA 4XAEA 3VDDB 4GMP3 1KQRA 1CIYA 2VOXA 2XMLA 3CZJA 1C4RA 1H4HA 5FV3A 1AHSA 3QH7A 4CP1A 3GZEA 4E4ZA 1RXFA 3H3UA 4B1LA 2ARBA 5SV8A 3E5QA 1AR91 4YSFA 2VMDA 3AP7A 3U75A 1NE6A 1UMZA 5KHKA 1MS1A 2G4IA 2DV9A 1QJY3 4XQ4A 3POGA 5T54A 5IVBA 3S5AA 1H30A 4RSUA 4LTAA 4GJYA 3AXDA 4O61A 2E51A 2CHHA 1UNBA 4QQPA 3AMPA 3C7OA 1PO13 1SBDA 1OLQA 1ND2C 2D7FA 3B7MA 2E7QA 1NKGA 3AKSA 5LBBA 1PO23 1LEDA 3AJYA 3T08A 5LA0A 4LEJA 3AKTA 4ES9A 2WZR2 1QDCA 2IXIA 1O5LA 3AZYA 5BNNB 4HPKB 1SCRA 4N53C 2JDMA 2UWBA 4QHOA 1LOGA 2VE1A 5K0UB 1UW8A 3PUSA 5J1XA 5FZLA 5FJHA 2QNKA 5FZ3A 1LOAA 1U5ZA 2JDHA 3W21A 1RUE3 1W6MB 4DIQA 2JWPA 3OUJA 4FI9A 2PN5A 1RUNA 4YRDA 3A0NA 1OF4A 4DOUA 1Y43B 3U78A 3BTYA 3I2DA 1CAXA 4MHUA 4CXWA 1YXWA 3MPPG 2XDVA 4QPYA 1NT0A 3JQWA 1APNA 4XFFA 1LKNA 2GH2A 3FLTA 5IUQA 4UW5A 5BY5A 5IFTA 3TN91 1LNSA 4JKMA 3OGSA 3GGLA 3OPZA 4D6QA 2ZZJA 4XUTA 3SNMA 2BOIA 2RMU1 2EXJA 1K5JA 1Q8SA 4QKBA 5C8CB 1UXXX 2PYTA 1SEFA 3UGHA 1SPPA 3FE5A 4I09A 3WQ7A 2BRTA 1ZREA 1AR62 1TVGA 4P9WA 1GNZA 3IKWA 3BN6A 4QQLA 2X29A 1OLMA 4RL7A 1X9TA 3FL7A 5A7SA 1COV2 2ORZA 4HK8A 4ONUA 3IIAA 1WW5A 5FY4A 3NO8A 1RTVA 5HV4A 4GWNA 1W8WA 4Y5TA 2QCSB 1DYPA 2JG9B 4P5YA 2XKPA 5GZCA 3UJOA 1HQLA 1O8PA 1U5IA 1YO8A 3KQRA 2DYCA 2A6ZA 2VW2A 1R091 2XQRA 3DKQA 1ZBE2 2MPFA 3NAPB 4YZ4A 2YU2A 2ILMA 1PO22 5FXXA 1H2KA 1XNTA 3NQHA 3DV8A 4PF5A 4LULA 5EJ3A 2HBTA 2VOWA 2VMCA 3NNJA 5BUVA 1O4YA 2WKKA 2JXAA 3OOXA 5LY1A 1FPN1 2QBXA 5A80A 4ASKA 5ISLA 4MG2A 2BZDA 2FDKA 3FUQA 1WD3A 3RSJA 3AVRA 5IVYA 5FQ0A 2Q1MA 4HL0A 1HRI1 2D6NA 2G9ZA 4L97A 2D98A 5FP3A 2J1RA 5FUIA 3LA7A 1RUE2 1YWKA 3IAQA 4GAZA 2OZJA 3LIHA 5L7OC 3PMSA 3BU0A 2P2KA 3V56A 5HCAA 4CDUA 5F3EA 2VZSA 1QOTA 4Y3OA 4IEUA 1XU1A 1RJ7A 3OGGA 4Y4RA 4DZGA 4Q4X1 2ET7A 5F2WA 1ZX5A 5DUXA 1MS9A 2RMU3 5C3OA 1YFYA 3Q8AA 1OOPA 3WT3A 1A78A 3VD3A 3N4MA 3KF3A 2R043 2DCJA 3ACHA 4XETA 2Y0IA 1FV3A 2OUJA 2VY0A 1NLQA 3ZFGA 5JI9A 1CX1A 4ISQA 3D82A 5FYUA 2QQKA 5A6YA 1XNDA 1G9DA 1IQDC 1GQHA 1Q3EA 2W0XA 2RM23 2ZKLA 5EP9A 1W9SA 4XXAA 3ZYRA 3FLPA 4AVBA 1GP4A 1O59A 4K21A 2YZ4A 4H2AA 2BGCA 2DVDA 2IFRA 2DBIA 4NVPA 1OH4A 1H1AA 2DF7A 3JXSA 1QGLA 1XYNA 1R093 1JYCA 1NXMA 4MHRA 3WNOA 4IEWA 3JB4C 3CO2A 4CDUC 3ZFEB 1G7YA 5EIYB 5A3UA 2ARAA 1GWMA 4FXGB 3KSCA 3KS7A 1RUH1 4LBMA 4NOTA 1AYN2 3MIEA 4WM8B 5FBJA 4R52A 1W06A 2VTFA 1QJU1 4YVWC 5SV5A 5LW9A 1C3HA 5F32A 2GC1A 2P3JA 3HT1A 5FXZA 1QXPA 2VOTA 2B39A 2IXJA 2VZTA 2ZTNA 3RPQA 1KITA 4MADA 5ABJA 2Q0AA 4Y1UA 5FPXA 1RUC1 4W4ZA 3FWEA 3TEZA 2P17A 2ARXA 5EPAA 3O12A 4UYBA 1RUJ3 3J8F3 3AYDA 4XZPA 2RG4A 4IEPA 4OQ9A 4EN0A 5LA1A 1JZ8A 3GDBA 4CP2A 1XNBA 3PIGA 3EMRA 3H42B 3MV11 1G9BA 4ASLA 5KXCA 2A6XA 1BJQA 4MGQA 1ZBA2 5I8TA 2Q4SA 3I3BA 1RUI1 1QH7A 5L9BA 3ZR5A 4IV3A 1ZRFA 5FMOL 5DG2A 5GLWA 4HN0A 5ANQA 4OI1A 2X05A 4ES8A 4EQVA 4GB33 4DXZA 5F5CA 4E8CA 3BPZA 3M3EA 4I0WB 4XJ8A 5A33B 1CAWA 1XYPA 2R042 2NLRA 5LASA 2YHJA 1GANA 4A44A 1GNHA 2A3XA 4D6SA 5FZAA 4QGMA 3AYAA 1UZZA 3URFA 4S2HA 2NPIA 2XL9A 3SEPA 2H0BA 2GH8A 4P9IA 3JBG1 1SHWB 5CFCA 3J26N 3NKTA 2ZABA 4BQWA 4D7TA 1K12A 2D6LX 4LMFA 2R16A 3OBTA 2ZGTA 4AI1A 5ACA2 2GC2A 1AR73 4LO4B 3MW3A 3B02A 4YVSB 4E4SA 5DUWA 3HEIA 4NMIA 1OT5A 1V6MA 4LLFA 3VBFA 4DFSA 1QJU3 5FYZA 1WLWA 2W1SA 5H9SA 4OI2A 3LOBA 3CJIA 1VRBA 4XUQA 3ZO0B 2Z4FA 4QPGC 3FC0A 4JGYC 4MGKE 3PVEA 4E2QA 4V1PA 4K1YA 3C7GA 2QQJA 2R0FA 4AI2A 5JXJA 2DVAA 2PHWA 4HONA 4QKFA 4KGQA 1DYOA 2VCCA 3E5UA 4L2NA 1KFUL 5L73A 3UGGA 1NA1A 5CFCC 1Q8VA 3J8F2 4MO3M 1RUI3 4Q2FA 3ATGA 3ES4A 1FOD3 2QJVA 5D8AB 1RL3A 3ZFFA 4NHXA 1DIWA 1A6CA 3PNAA 4CDQB 1AYM3 1GLHA 3PU3A 4COWA 4BISA 2J1VA 2DU1A 3SXWA 3VBFC 4QB6A 4GB32 5JOZA 1OD3A 5CNAA 1JYVA 1OQ1A 1BMV1 3BGAA 3MW2A 2RS32 3I97A 4A3XA 2LTNA 2D6MA 3CJIC 3CBNA 5C7GA 3KHCA 1OURA 4HXCA 4NAOA 1IS4A 1UOGA 3GBWA 3UV9A 5I0SA 3WOGA 2R49A 2WO7A 1UZWA 3J7HA 2XVLA 4RFT0 1OI6A 5KR7A 2RS12 2VH9A 4N9IA 1J1LA 4TSVA 1RUD1 1HDKA 2KXLA 4FPJA 4JTOA 5FRAA 4XW3A 3CEWA 4BIOA 1QQP1 2ZEZA 3WG1A 1O6UA 1XE0A 2BBVA 3B00A 3ZFFC 3KB5A 2VNGA 1O3TA 4IE5A 5A3TA 2W1WA 5FZ1A 1WCDJ 5FFOC 4RS5A 3AP9A 1ND2B 2YU1A 1DGWX 2BVVA 4CCMA 1JZ2A 4MH0E 1VLNA 3LEKA 3PMEA 4GXLA 3WNNA 3GBGA 1PX3A 3K4DA 1PVXA 2HLEA 1D4M2 1VMHA 2E9QA 4MLOA 4YM0A 4N53B 3WF3A 4QQOA 2O8QA 1R1A3 5JAXA 3AL6A 3THTA 3LDRA 5IYYA 2WFPA 1XQNA 5J48A 4TYSA 5H9PA 4UW6A 3MLJA 3AYCA 4AVSA 2WA4A 5FLJA 2VZOA 4HN1A 1FAYA 3WHTA 1ZYBA 3BKZA 4XAAA 4CP0A 4RA0A 1K42A 5G05L 1UF2C 2XL7A 4NIIA 3ACGA 1YFWA 2WFF3 5C3RA 2BU9A 3IPVA 1RVF1 2E31A 2HKXA 4LQRA 5A3PA 3KLSA 2YG0A 4URTA 5KHHA 4F3JA 1RYYA 4RS5C 4N43A 1GV9A 3SKJE 3ON7A 5FZ7A 4XPVA 5IVVA 2J1SA 3WCRA 3WDUA 3AP6A 4F83A 3T30A 3T09A 1VALA 4QX1A 1D0GA 3LZZA 2R063 2ZZQA 1H2LA 5AVAA 1KEXA 3B9IA 1VBE2 4C91A 5CBLA 3ACIA 1QJX2 1UZVA 2B5HA 4YM2A 1WMFA 2VCMA 3OEBA 2WYFA 3N9MA 4PDWC 4ARXA 1K3IA 1S0JA 3HR9A 3H3ZA 3P5BA 4CU8A 3ZDSA 1OUSA 1DQ2A 2HWB3 2UYAA 2WAAA 1NYWA 1BQPA 1SFNA 4KU8A 4QWNA 4Y1YA 2ET1A 2C9KA 5HXVA 5EHDA 2EALA 1EYBA 3N9QA 4JV4A 4FBFA 1EV13 3SCGA 1PNFA 2AH2A 3WR0A 1ULOA 4V2VA 4OZOA 1HB4A 4AVCA 3LEGA 2VW0A 1MR5A 1AX2A 1GZCA 2G9GA 2GZWA 4MGZE 3ITQA 3NJVA 2VUAA 5IK7A 5A7WA 5K7PA 2JB4A 5FO7B 2DWRA 4AK3A 2W2IA 4XJUA 4OUMA 2YGLA 3U4SA 2ZHLA 3BPSA 2HWC2 1OQEA 2EIBA 3S5QA 3T3YA 4WVMA 4AHXA 1PGW2 2VQ0A 1D4VB 2XLFA 2Z69A 1GNYA 1OA4A 4AHZA 3VKOA 1LHWA 2FMYA 4UAPA 1HJFA 4BWOA 2JD4A 4AGVA 4CUGA 5L7OB 5JXGA 1UKGA 4ZS3A 4BCUA 3AFKA 4CCNA 2ZAHA 4ZU5A 3KCCA 3ZYFA 2WFF2 5FZMA 3N9LA 2QVSB 4COZA 1O4ZA 3QD6A 1RHI2 4Q8LA 4NHLA 1KS5A 2EIGA 1C28A 3TAYA 1CAUA 3AZWA 2OPKA 2WA3A 3KV5A 4ZPIA 4DQAA 4HKWA 2D40A 3FMGA 3H8XA 2HWF1 1LCLA 4I02A 3PLQA 2RV9A 4DXSA 1ENSA 1LHOA 2R062 4NAMA 2AC1A 1RUF1 4R9AA 5CU1A 4CRQA 4XOGA 2O1QA 1LECA 5JOXA 2VULA 4TZDA 3OBZA 5AC91 3B9CA 5JPNB 1SQ4A 2WNOA 1EAH1 1QU0A 5F8PA 5FQ0B 3ZSMA 4M3CA 2JDZA 3N35A 5APAA 3WDVA 3ZX7A 4LJHA 2XJRA 3B94A 3KHBA 3WUCA 4YNIA 3KV4A 3GCXA 5EFUA 1JYNA 3WW1A 1RJ8A 1FNZA 2D44A 3IM0A 3IIIA 1PIV3 2RDNA 4CDUB 1KD7A 2XBO3 4UBHA 5BYNA 4OI0A 3ACLA 1ZNPA 1C8NA 2GC3A 3LKJA 1UAIA 2NM1A 1LGCA 4UF0A 2DCKA 4KNCA 2V4AA 1NG0A 4BMBA 2ZHMA 1MACA 2KA3A 3ETPA 4FO9A 5FMDA 4IEOA 3K46A 4PLOA 3KCYA 1Z7S3 1ZZ8A 2PA7A 2WNVA 5JOYA 1RIRA 3WCSA 4DPNA 5A6XA 4EN9B 4Q4V3 4M3CF 2K0GA 1VRH2 4Y1XA 4R4XA 1SFYA 3ZVXA 4CYDA 1Y9MA 1WCUA 3K77A 3OJBA 3I54A 3PIJA 5CA6A 5BNPC 2WRAA 3PJQA 4YG3A 2C1FA 1HLCA 4JDNA 3ZXGA 2BGPA 1LHUA 1C8M1 3GF6A 2PTMA 2D6OX 5JDBA 4NIAA 1FT9A 2BFUS 2FCUA 2IC1A 3KVBA 1FX5A 4RR3A 1DQ4A 3AMMA 1UYPA 5C3SA 2HWE3 2ZCWA 4R4ZA 1DCSA 2ZS6B 4MGTA 3WX5A 1FMD1 2AGSA 1AXKA 2HWD2 2L9LA 4AEDC 4AG4A 2YV8A 3R6SA 5KHGA 4IGPA 1L3JA 1B35A 3POEA 2P5BA 1OSGA 4I0BA 1SLAA 5GLZA 4PCRA 4C90A 2WNVC 1WLCA 3WP5A 4HSJA 4XF0A 5C9AA 4LUMA 1HRV1 5CIRA 1Q56A 3ETQA 2BTVC 2YC0A 3HMYA 1VBB3 4LBOA 4Q5OA 5C5UA 5ABJB 2Q1ZB 4ITCA 3WF1A 1REFA 1YCIA 3H8OA 3UT0A 1WBLA 3AMQA 4CP9A 1SLIA 5GZFA 3OUHA 3S6PA 1W9TA 1NAEA 1URXA 4L99A 1FI2A 1K5MA 4LNVA 5JR2A 2JKBA 1LJ7A 2B45X 3FX3A 4I0AA 4DUVA 1PIV2 5FZ6A 3RZMA 2XBO2 5E16A 4XBNA 4D69A 1JH5A 1JYTA 2WT1A 5FYHA 2Q30A 5CADA 3VUOA 3WP6A 3RS6A 3KM5A 4QU2A 3SITA 4IV3B 2EXKA 2Z42A 4JGYB 5ERLA 2XWJB 4C1XA 2AEZA 2O0OA 4YYOA 5T5JA 2XQXA 2Y8KA 1Z7S2 2VG9A 3N7MA 4FTBA 2G1MA 3VZKA 1WBFA 5GM0A 5FIXA 1HN1A 2B9UA 2LUWA 3POBA 1UIJA 1UX6A 1YI7A 2VGDA 3KF5A 4AR2A 2OIIA 3AKQA 5C9AC 1ZRCA 1TQ5A 5CFCB 1RINA 2VMEA 3O7OA 4IEZA 4LIVA 5DAQA 1POV1 2P37A 1NZCA 3NV3A 4LXLA 4JVAA 5JSPA 5IVJA 4Y33A 3RDIA 1Y9QA 4BZ4A 3H1MA 1NLSA 2NMNA 2YFUA 4ZXKA 2XJTA 4EZ4A 1UD1A 4K9SA 3CKHA 1LU2A 4R8HA 4LITA 3JD71 2RDSA 3VBFB 3SISA 5CFDA 3I3EA 5FJKA 1NCQA 1LGNA 3TBDA 3QLQA 3CJIB 4BQXA 2OPWA 2Y33A 3OTFA 1E5IA 1HRV3 3AKRA 3WG4A 5C70A 2C24A 3WNKA 1CPMA 4Y22B 2VBBA 4MZUA 4DB5A 2WBKA 1F31A 2GN3A 1ASJ2 1AVBA 4M4PA 1MZEA 4RGAA 4UFMA 5FDBA 1AL23 2J1TA 3G7DA 1RGSA 1VBD1 4A7YA 1W6NB 5A6QA 1NA1B 1VAKA 2NN8A 1Y9GA 4C0HA 1EP0A 1NCRA 4MXWA 2JD9A 4XTMA 3WHUA 4K1ZA 5EJ1B 4X6QB 3C7FA 2Q8OA 3ZFFB 4K8RB 2BUKA 4A6OA 5FPBA 2C4XA 3O0VA 1BLZA 1LTEA 5FZDA 4WBBA 5CFDC 1PVC2 5A32A 1NCQC 2RR12 3DEMA 3OG2A 4N8MA 1ST8A 4OFGA 1WCKA 4LA2A 2VECA 4AQ6A 3A4UA 5FWEA 2VU9A 4C8DA 4R9DA 4QKDA 5FXWA 3N7LA 1JHJA 1AR61 3MDPA 2VC9A 1JZ5A 2D3PA 2ZGRA 1QJY1 1UPSA 4IESA 2B4KA 2P1BA 1J3PA 4DRVA 4FFFA 4D7YA 1MS8A 1YIFA 2BQPA 4EWAA 4XDQA 1NCRC 3POIA 1IS5A 2W92A 1S4CA 5FY0A 2WZEA 1BVVA 2ES3A 4FXKB 4ZY9A 2VZPA 2OYZA 4BDVB 1PO11 2P3IA 1IQAA 2BBAA 2KR2A 3AP4A 5EJZB 4YW5A 2W91A 5DMYA 4IW3A 1ZBE1 1LRHA 4IE6A 2WZR3 3U10A 4RS5B 1PO21 2I2SA 3ZYJB 2X5IC 3KZ4C 3EB7A 4FFIA 1D2QA 2DUQA 3WP4A 5LK7B 2TBVA 4H7MA 5I8SA 2ZEYA 5JXIA 2A75A 2RS53 5C3PA 4QQ2A 1OKOA 2VZUA 1ZZ7A 4HBNA 4IEQA 1W8UA 4E2SA 1AL22 1QKQA 1CPNA 2VW1A 3DUIA 3MICA 2OW4A 3AMNA 2YC4A 3BVCA 1SDWA 3RGBA 1RUE1 4CUBA 1AXZA 4DNYA 4WVWA 4K3UA 1A34A 1XU2A 5FMCA 5IVEA 3POJA 4PIZA 1PZ7A 1V70A 4QX8A 5ANNA 3IPVB 3O1UA 1PGL2 2WABA 2YBKA 3H1WA 2IVJA 4YM3A 1YFXA 3N9OA 4CE8A 1KDMA 2GSYA 1WCSA 3KMHA 4NPLA 4I3PA 1AR63 5HXMA 4S2FA 3TOJA 1CWPA 4Q0SA 1SFPA 1WMDA 1YIPA 4O9EA 4MGIE 4ORFA 3WP3A 4ZU7A 4QDSA 5D21A 2W3JA 4NPRA 1COV3 4W6XA 3VDBA 1WW6A 2ZA9A 5DDJ2 3WG3A 3BB6A 3I4IA 5FY5A 3CLPA 1BCXA 2XJQA 5CKQA 2FHRA 1S0EA 4HFSA 1ZBE3 2PLV2 4LBQA 3M4FA 3VKLA 1W8NA 2G9FA 3VN4A 3J4UH 1JZ3A 1ACCA 3CHXA 4UWDA 3BIEA 3OSDA 3RQ0A 1H0BA 2BERA 3UYJA 2P34A 1UZ0A 4JGZA 2D6PA 2ZJCA 1DQ1A 4KWUA 2DCZA 1R082 1OVSA 3D8CA 5CKMA 2BJSA 4IV1A 3DECA 3ROUA 3ENRA 3OY8B 5A7WB 3HNMA 2RS52 1NQJA 3WLUA 5I0TA 3WV6A 1UQXA 3LEMA 5C4WA 4AFDA 1QEXA 4CUAA 3MIGA 2WC2A 3VKMA 2VCAA 1BEV2 2WT0A 3WNXA 4A41A 4FPGA 2BDRA 4XZUG 3OD4A 1YUDA 4QDRA 5JMOA 5LEKA 4NPMA 5A3WA 3H9AA 4DMIA 1SZBA 5LWBA 4H3WA 4O7XA 4E4DX 3I49A 1RB8G 1ZBA1 4AHYA 4QHZA 4QPIA 1W8OA 1YFUA 1ZZ9A 1F35A 3LDKA 2VZVA 3BOWA 4TXWA 2W46A 3IDBB 5KBFA 1O7FA 4KU7A 1HV0A 2E32A 4JGZC 1CAVA 1LU1A 1BBT2 1JW6A 1V6NA 2R041 2Y6LA 3TYJA 3WDWA 4ASMB 3ILFA 1JZ7A 1MEC2 4K6BA 4FOYA 1BK1A 2C9AA 2CSGA 1GP5A 4ISRA 4IV1C 5IT6A 1JI6A 2FD8A 1LHNA 3SH5A 2JDAA 4QQHA 1IS3A 1D7PM 2XG3A 2RM21 4GULA 4RHV3 4XTPA 5C4WC 5BNPB 3M3OA 2RDRA 1UY4A 4M3CB 4CCOA 3JCIA 2D93A 5ACA1 2CTVA 5FYMA 1US3A 3C7EA 3AZXA 3D5OA 5KWRA 2HYXA 5FK7A 3V0BA 1SACA 2QE3A 1UO9A 4Z92B 5FMOS 4S2GA 3S57A 2QDNA 1AYN3 1QXJA 3MLKA 4D8MA 3D0SA 1NY72 1V9U2 3HAGA 2Q8EA 3ZN4A 4ZU4A 5LEJA 4XF9A 1AL0G 5EZWA 1DQ6A 1DZTA 2WINB 4QPIC 4AGRA 1EUTA 3V64A 2IWGB 1G9CA 1IGOA 1WLDA 3VBSA 2ZHKA 4S2DA 4Y1ZA 3J7LA 4AEDB 2XKOA 3IN9A 4DINB 4QGNA 2XJPA 4YGBA 5HBAA 2IZWA 2XONA 3LQCA 3LFIA 3LF7A 3WD5A 2UURA 2WNVB 3GZUC 4MGSA 4RQPA 5FZ9A 3JB8A 3KD4A 1SCSA 2Y6JA 2VOVA 3SCFA 4YZ1A 4OHYA 1RMU2 5DAXA 4XBLA 5FPLA 3VBHA 1CX4A 2W1UA 3RNSA 1RUJ1 3J8F1 1ZBA3 5E1RA 3PHMA 4B7EA 1YC61 1TE1B 1VAMA 3IMNA 3JZVA 3MO4A 4N7IA 4W6YA 3VBOA 4F8AA 5FWJA 1O3RA 4LUKA 4FOVA 1VB4A 5HV0A 3DYMA 3BU7A 4Y5Z0 1TME2 5A7NA 2WS92 4BOWA 4BQ4A 1OLRA 1GFF2 3S7IA 4GB31 3VD7A 2WWJA 4B4QA 2WJSA 2RS31 2WDBA 4PLMA 2EA7A 2HEYF 5J09A 1VBA2 4FOQA 2D97A 1W9FA 1B35B 3RVHA 4IXLA 1UN1A 2AACA 2LROA 5EYXA 4YW4A 3TWIA 5C33A 2BNNA 5ACA3 2EIDA 5C9AB 1LB2A 3KQ4B 4RHV2 2VAUA 3ZN6B 2W9XA 1QIQA 2XWBB 1UYYA 2RS11 5K8SA 4OVEA 3VBHC 3ZSLA 2LW8A 1AR71 1AR92 3Q9OA 5JLVA 2VUCA 4R9BA 4FVVA 3W5NA 1W9YA 3IBMA 4U2AA 1W6OA 2QQOA 4PI0A 4BA6A 3P6BA 3FLRA 1OOPC 1EY2A 2BOJA 3WQ0A 1FV2A 2JE8A 4YLZA 1UWWA 3TNQA 5CG8A 3ZMOA 1GYKA 3POSA 1ULPA 2F4PA 3I2OA 1AXYA 1ENRA 3ZFGC 1PZ8A 4DRRA 2QQIA 3NJXA 3ZKUA 4J1XA 3AFGA 1D4M1 2R073 2SLIA 2XVKA 4DXRA 1ULFA 1PMHX 3MZHA 1ULEA 1DHKB 2Z79A 4ZS2A 3GYDA 3IWZA 3NJZA 4AXOA 2FMDA 1J3QA 2DBNA 4LKFA 3GALA 2JDPA 3OD0A 2NP0A 1W04A 1UOBA 1FOD1 4OHZA 3AKPA 2J1UA 1F15A 2JG8A 4AYUA 1KRIA 4N9HA 1F4AA 2B8MA 1AYM1 4AEJA 3PUQA 2RS33 3LCPA 3WINE 2CWSA 4YZ2A 3F2ZA 5K9YA 5JOWA 2YPJA 5K4LA 2VMIA 2AUYA 2IVIB 2Y26A 1RITA 1WA4A 5CFDB 4HKLA 4J25A 1NCQB 3MF6A 3SQOA 5T3NA 2VTXJ 2W39A 2WL1A 3G6JB 5F6KA 5ABJC 1U12A 1PMJX 3GBFA 3LFMA 4UBGA 5TSWA 3THPA 1DQ5A 3UKNA 3WUDA 2RS13 3O1VA 1VBE1 5J7MA 2IXHA 3PDQA 2WN2A 1KS4A 1ND3A 3OYWB 1GQPA 1HB1A 5B4XA 3J7NA 3ZDVA 1EPWA 1YQ5A 5I8YA 1F5JA 2WLPA 4I01A 2N7GA 1STMA 4RN5A 3WG2A 3WQBA 5I0RA 1J59A 4OHXA 3AXEA 4GD4A 4DEVA 3GM8A 4PQQA 3VDAA 1NCRB 2ZGOA 4LPLA 4MXWB 5KHIA 4IV3C 2QUOA 2J1AA 3L2HA 2VVDA 4Y20A 3NJYA 1ZRRA 3MIHA 3JU9A 1D4M3 2YMZA 4XBQA 5H9RA 3RWKX 2X5IB 3F95A 4EZHA 3ZSEA 1W0NA 3EJKA 2R072 4KWJA 5DZFA 4HETA 4CEWA 1O3SA 3CU7A 1R1A1 4C1WA 1OF3A 1X8MA 2HWC1 1I1EA 1QJEA 2R1BA 2VNRA 3N9PA 1T2XA 2VMFA 1PGW1 4RGKA 3UKVA 1ND3C 5T5LA 1FPN2 3RYPA 1U5YA 2GU9A 4XFAA 5IK4A 1SLCA 3BOPA 1J3RA 2GP5A 5GZGA 1P8JA 2B9VA 2CDPA 3I59B 1W0OA 3LDBA 4GIQA 4C0BA 4JHZA 2HEVF 4XFHA 3ELNA 2DCYA 3WQ1A 1C57A 1W2TA 3USUA 2WFF1 4BQYA 2WZ8A 1CGPA 2EF6A 1RHI1 2FCVA 3M3CA 4Q26A 4ZZ5A 1PK6A 4L9BA 4MV2A 2YB7A 2WO1A 1W3VA 1KGYA 4XF3A 5LY2A 1VBE3 1QJX3 3J9SA 3VLBB 1REDA 1QJFA 4XFGA 1DZQA 1AR83 2R061 1UU4A 2PMWB 2UYBA 2PHDA 1QWRA 3KVAA 1NA1C 4JQTA 3A22A 1LESA 5F39A 3RZGA 1V00A 5FZOA 4G3YC 3CQOA 3VKNA 1YI9A 2HEWF 2CV6A 3P3NA 4CXXA 3BODA 4CCJA 2PHUA 2YBSA 2HWB1 4FPLA 4QXKA 1JS9A 4FPHA 4WZFA 2V72A 4AFMA 1UY2A 4QXCA 4YFZA 1UOJA 4PIYA 4L0PA 1EV11 3U11A 4JRAA 2P3YA 4B4PA 5EYYA 4AI9A 3NL1A 3CL1A 4LKSA 2V73A 4YZ5A 3M3IA 3ZPOA 3RYKA 3T2TA 1CZSA 3GZAA 1A8DA 1IS6A 3PTRB 4WVVA 4URAA 1G6NA 4BK5A 1BHGA 2HWC3 1CESA 1NLRA 4P9XA 1UY1A 4EJRA 1MZ5A 1UU6A 2MEV3 5LBEA 1W0PA 1C1FA 4QU1A 1ZRIA 1W2AX 3KV6A 1H2MA 1IPKA 2XUMA 1XSQA 5AVPA 2WO2A 2RHPA 5AFEA 1JBCA 2BVBA 2KD7A 5FY1A 3ZYPA 2DU0A 1UIKA 4LBKA 1RHI3 4HK9A 2V5DA 4Q29A 3GZTB 1RUC2 1EPZA 3T2QA 4HKOA 5IJRA 4BE3A 2W5FA 2ZXQA 4L8QA 4E27A 3O1TA 2QQLA 4LBQB 3AZZA 4OQ8A 1OBNA 4DY3A 5KHJA 3J7MA 2CGOA 4YW1A 3T2OA 5C5TA 3E5XA 5CKNA 4JGZB 2GNDA 4Q4W3 1Y4WA 5A1AA 2WNEA 1S0GA 2XLAA 3HJRA 2CYFA 1K45A 1AR82 3NMBA 5F9TA 4IV1B 2DCTA 2A3YA 2D5FA 2F4LA 2OS2A 3DGTA 4AGGA 1S2BA
chains in the Genus database with same CATH topology
5C4WB 1W2UA 4RGGA 4AQTA 3POWA 2CNAA 1S2KA 5C8WA 1JUIA 3UK9A 1CAXB 4TWTA 4XMIA 1VP6A 3JBG2 4MYEA 2YY1A 1LGBA 4QD2A 1PIV1 4JDOA 2XBO1 1O4TA 2K2SA 2NZ9A 2VQAA 3K51A 2GNBA 4N43C 2QDRA 4GALA 4QPIB 2DURA 3H7YA 1LOCA 2ZKNA 1PM7A 2GALA 3KGLA 1GZWA 3O14A 4XMAA 4DY5A 1VRH3 1CAVB 4G4FA 3ASIA 1Z7S1 4LO7A 4Z1VA 2MEV2 3VZMA 3ZXFA 5T5PA 4Q4V1 1ULDA 3VZJA 1J58A 4NHKA 3MFCA 4FPYA 4HPKA 4KL1A 2H6CA 3HIFA 5BXXA 1XE7A 3AZVA 5K0UA 2QQPA 3V0BB 4KG0A 2GNMA 2R6QA 3PTYA 2DTWA 3DF0A 4BIFA 2HWD3 2Z5WA 3JUUA 2HWE1 3E6BA 4JC1A 1ENXA 4Q4W2 4UW4A 2B42B 3S0MA 3TB0A 3M8LA 3D0JA 3ZXLA 4XJAA 1ZRDA 3N7JA 1O91A 1MVEA 1F2NA 1SMVA 4A7KA 1S0CA 4EWEA 5E88A 5C8CA 3BIWE 1VBB1 4BYYA 4R9CA 1QMJA 4FQ4A 3VBHB 2A70A 1Z78A 4JDMA 4PBPA 1CIWA 1ONAA 1UCXA 3MYXA 3WVJA 1OOPB 3EO6A 1RUD2 5EXOA 2ZX2A 2JICA 1W6PA 1Q8QA 4AHWA 1QQP2 1QOOA 2JG9A 1LENA 2WQZC 3C2UA 3ZFGB 3RI8A 3WXPA 1LOFA 2DTYA 2CGPA 2CAVA 4FTEA 3AYEA 4HZFA 1NQDA 1PZ9A 3APBA 2DFCA 3QACA 3WY6A 4CDWA 1J1TA 3A0KA 5F6LB 3R4SA 4QX5A 4GH4A 2AR6A 5DG1A 1H4GA 3CF6E 3WDXA 1DDLA 1BVP1 1S1AA 4IEYA 2WQ4A 2XLGA 5HCFA 4M00A 1C1LA 1ZZBA 3ME2A 3FFZA 2EVXA 4KWKA 1Z0HA 1S0DA 3SHRA 1A8MA 1I9RA 4COUA 3DL3A 2E53A 3RRDA 1ASJ3 4COVA 3CNAA 4XHXA 1LOFC 4XJWA 2PFWA 1OD5A 2YXSA 4AWDA 1BKZA 4LO5B 1DLLA 2Z2SB 4XYXA 4OUSA 1AL21 2UWCA 1GKBA 1Y7BA 2ZMKA 2OVUA 4K20A 4CDWC 3VGIA 4M0HA 2DUPA 4GH4C 4CTEA 1W39A 3H8UA 1LEMA 4INDA 4QM8A 1JN2P 4FPFA 4RR3C 3UKTA 3ECQA 1G9FA 3ZXAC 1F8VA 1PVC3 4Q4Y3 2RR13 3HT2A 1CAWB 2GNTA 4Y4YA 3GHMA 1H9PA 1PGL1 1N47A 1B35C 2WIIB 4MSVA 2ETEA 3FZ3A 4AQ2A 2HYKA 1WMEA 1QNWA 4B8EA 1U0AA 1OFSA 1RC6A 4GA9A 1ND3B 3W58A 1VAVA 1K5MC 3MEPA 3B01A 5J96B 3EXUA 4YFWA 1XNCA 2PLV1 4N7UA 4QGLA 1CN1A 1AX0A 1FATA 2ZBJA 5F1RA 2VVFA 3MIDA 1H8TA 1MZFA 4Y20B 1IKQA 2WZR1 4LE3A 1VBC3 4FPCA 1G8WA 5DUUA 4LBJA 5FOJB 3NVCA 4FP3A 3AJZA 3HBZA 4QT6A 5IK8A 2RS51 3SLIA 4WZCA 3R4DB 1GQGA 2VOKA 1UPIA 3HD8B 1LHVA 1N3QA 5F5QA 3VZNA 4DS0A 1U5XA 3MPBA 1BEV1 5FPZA 3SMHA 2VXRA 2YGMA 1RUF2 3MW4A 3ILRA 5I91A 2WNUA 4D3WA 1EAH2 2E7TA 4YVSA 4Q4Y2 3USUB 3SCHA 2R1DA 3HN1A 2PAEA 1H8TC 5I93A 1TMF2 2FZ1A 2CL2A 1ZA4A 3O5SA 5DDJ3 4BM8A 1COV1 2ZGLA 4AEMA 4B3NA 1MQTA 4YGDA 3LA3A 4IETA 2BPA2 4OZXA 2PLV3 2JE7A 4K7JA 1XRUA 5CB7A 3JQXA 3D4KA 2WNUC 1GICA 2BNOA 4D94A 2ZX3A 4OHWA 2WWSA 5JIAA 5JI7A 1R083 3PVNA 3R4UA 1C8M2 3S30A 1VBC2 1HXS2 4KG8A 3NV1A 3D6EA 2BEOA 4LT5A 3NW4A 2E7AA 1BEV3 3ZXEA 2W68A 1ZZCA 4B7KA 3NV2A 2AREA 2A6WA 3ZSJA 3PVBB 4LHLA 4CDXA 4FAGA 4YG6A 2C0ZA 1LODA 2SBAA 2DUOA 4X6RB 4ATFA 4EWDA 4X8PA 4H7LA 1N3OA 2JE9A 3MF9A 5JWPA 4N43B 1BBT3 3WW3A 4MVTA 3VHPA 1FNYA 1S0IA 1MEC3 1B09A 1SLBA 4LA3A 1YJKA 4HVQA 1ZVFA 1VR3A 4WVZA 1T6GC 1DFQA 3USSA 5GLVA 5JZGA 4ATEA 4RHV1 2YDEA 5DZEA 3VBRA 4N53A 4NN0A 4CDXC 3TNPB 1V9U3 4RD7A 4XFBA 1GZ9A 5JPMB 3U0ZA 2XVGA 1AYN1 1F9KA 4Q1PA 1MS0A 3VL8A 5GLUA 1WD4A 2EAKA 2A6YA 1VJ2A 4YGEA 3V0AA 1A3KA 1XYOA 3LB9A 1XXNA 1D0HA 3KT1A 2PHXA 3RG0A 1GZWB 5D1IA 1QOSA 3JD72 2A6VA 3FJSA 2R0HA 1RMU3 2BWCA 1LOBA 1DF0A 3BTAA 4WVMB 2XPJA 2ZACA 4KH9A 2PELA 4K40A 5DZGA 5JZGC 1R1ZA 3RMXA 4CEYA 4M01A 3VBRC 4AEKA 2MNGA 2D6KA 4FTSA 4E2GA 4WM7A 1TME3 2WS93 1RUG2 3I7DA 4P9JA 1VBD2 5JCTA 1AZDA 1WGPA 1CAUB 5J36A 3ZN5A 1AF9A 1S55A 4XF1A 1VBA3 2VVEA 1X50A 1LOEA 4FT8A 1QF3A 1X82A 3PVOA 3LWCA 4AVVA 2FQPA 2Y0OA 4UXAA 1AJOA 4Q0UA 4AI8A 4Y1VA 2UWAA 2WT2A 4SLIA 1AR93 3KCXA 4Z07A 4W65A 4CEYC 1BMV2 4MX3A 2JENA 4EN8B 4XQWA 1UKRA 2IXKA 4WM7C 1OA3A 5FAXA 3H0OA 1QJY2 4F7ZA 2V09A 3ZXKA 3POYA 5L7OA 3MFAA 3LSDA 3ALQA 3B3QE 1DGWA 1OPMA 1IKPA 1W6PB 4NWWA 3DPRA 5JVVA 1OFNA 2CY6A 2ZPXA 1PO12 2R071 4YARA 2JECA 3OF1A 1OA2A 1UU5A 1C5HA 3VBUA 1QNYA 2PHLA 5T52A 2VUJA 5EV7A 4CDWB 2LALA 1ZZ6A 3MI8A 4W6WA 4KWLA 5E89A 3C3VA 4GH4B 3ES1A 4IL7A 2BWAA 4RR3B 5LRSA 5JIUA 3AK0A 2GDFA 3E6CC 3AMHA 1V6LA 1OPOA 3VBSC 1Q8OA 3M70A 1YNAA 5KXBA 2X8KA 4QHBA 4UW3A 3TN93 4EROA 3ZPYA 3VHRA 1N1YA 4Q0VA 3WZ1A 3DPRC 4RQPC 2ZX1A 1DYKA 3QOPA 4PIXA 2ZOEB 5GJ6A 5CVRA 3RMYA 4YVWA 1JUHA 4AF9A 2RJKA 2ATFA 3MGUA 5AFBA 1PHMA 3FBMA 3VBUC 1XNKA 5FLHA 1K5MB 1HIXA 2WSUA 3VBOC 1F5FA 3PJYA 4EN6B 3W59A 2DVGA 3E97A 5A3LA 3T1LA 3IDEA 1KFXL 3N3HA 2DVBA 1OHFA 3LA2A 4N90A 2H0VA 1QH6A 5T50A 3FBYA 1CQ9A 4FOWA 4WV8A 2ZGSA 3ZXDA 4HT1T 3ZYGA 3AX4A 2PAMA 1X8EA 3O0WA 3RI9A 1H9WA 5J98B 1FPN3 3NKGA 4XIOA 1PNGA 3FUOA 4OHVA 2ZAAA 3ZMNA 1HRI3 3CJXA 2IXLA 3INAA 4CZSA 4LBLA 5HI0A 5BNOA 3M3QA 4GQ7A 4AW7A 1NOVA 1SLTA 5FO9B 2TEPA 1G86A 4IERA 4Q4X3 4META 1H8TB 2P3KA 3TN92 5FOBB 3K48A 1IOAA 4EN7B 1QJX1 2DFBA 1O5UA 2RMU2 2BNMA 1AR81 4QPGA 4JGYA 4ZKTB 1DGRN 4AE2A 4AI0A 2HJIA 3VZOA 1TNFA 1ULGA 5BPXA 3E6DA 4XQDA 2JG8C 4M0NA 3EQEA 1CVNA 2JEMA 4BPZA 4YZ3A 4LE4A 2RM22 4XXPA 5BNOC 3VHNA 2WNUB 3MIBA 3SH4A 2VNOA 1MZ6A 4AQSA 5A32B 2NYYA 1R092 1REEA 4LO8A 5FLIA 1RUH3 1NXD1 3WW2A 1CJPA 2Y38A 2MEV1 1GR3A 4AFAA 3OCPA 2PHTA 1QY4A 2OZ6A 1DQ0A 1MQTB 3B5LB 4Y22A 2ZGPA 1HRI2 1RUC3 4AVTA 5FTTC 3EBRA 1GBGA 4PQ9A 2E63A 4L92A 1CD3G 1BZWA 1QHDA 1W6NA 3KT7A 4LBQD 4YG0A 5E8AA 4I30A 1JOJA 4JAAA 2W52A 2WZPP 1RUJ2 4H55A 4Q4X2 1TNRA 1VB2A 2OUHA 2FBEA 3BALA 4P14A 4AVAA 4Q4W1 3VV1A 3VZLA 1C5IA 4CEWC 2V5YA 5GALA 2PQQA 1HQWA 4Q1RA 5JMCA 4HLTA 4M3CE 4BH9A 2IFWA 5BV6A 2AENA 2VMGA 2GN7A 1SBEA 5BNQA 3JBG3 1CONA 1Q43A 1S0BA 2YYOA 4CDXB 1BXHA 4SBVA 3UJQA 1V6JA 1W6QA 4OULA 5I0UA 5JSOA 1JTZX 1M06G 4B4RA 1PK6C 4Q0QA 2Q5TA 4BQ1A 1AR72 1MS3A 1AJKA 1D2SA 4GKYA 2B7YA 4TLFA 2MHFA 1RUH2 3ZIWA 3ZYIB 3FHIB 1WLTA 1UL9A 3U4XA 1VRH1 2ZGMA 1MS5A 1QJU2 4Z2WA 4YM1A 5KC6A 1V6KA 3O0XA 4XILA 3P3PA 4H14A 4D7SA 5JZGB 3TRSB 3BCWA 2VMHA 3VBRB 2W08A 1POV0 1UZYA 2IXCA 1OQDA 4PDWA 2XB6C 5DXDA 4FAHA 2VPVA 4YW3A 1V6IA 1MVQA 2HWD1 3AB0A 3OGJA 1RUI2 3IDCB 1FOD2 1QDOA 5KXEA 3V0AB 4XHBA 3VDDA 1ENQA 1AYM2 1HX6A 2A73B 1SLLA 2D3SA 2GMPA 3N7KA 5CG9A 2R32A 3QCWA 4B29A 3L2YA 1I5ZA 2RE9A 2XGXA 4JQRA 2RJLA 4JTNA 2PHRA 4I3GA 4XJ9A 4CEYB 2QKDA 1JHNA 1KJLA 3WW4A 1RUD3 1V6OA 1LR5A 2XH6A 5IK5A 2ENRA 3QBQA 3ZSKA 4WM7B 2TNFA 2ZGNA 1QQP3 2OA2A 1TEIA 2O8OA 2EXIA 3B93A 3V65A 5HCBA 2EXHA 4LBNA 3RJ2X 2YROA 3NWKA 5LK5A 4GMP0 5KC5A 4FPKA 3VDDC 3B69A 1YHFA 5BNNA 5GLTA 2ZHNA 3LAGA 1WUVA 1CJDA 1XE8A 2ZX0A 3LGRA 2FZ2A 3OY8A 1G9AA 2DVFA 3EHKA 5L36A 1R1A2 3RJRA 1W6MA 3S7EA 4A2UA 1VIWB 4U36A 5FBZA 5JSRA 2BW8A 1Q8PA 1KJRA 3R05A 3DN7A 3IT8A 3VBSB 5JR7B 1RVF3 3ZXJA 2C5DA 4FP2A 4FCAA 1ASJ1 4Z8BA 1JXNA 3DPRB 4RQPB 4BLJA 2WSVA 4GKXA 2GC0A 4A7ZA 4FPOB 2YUEA 5BNNC 4IEXA 3ZIXA 3VBUB 4XEZA 5GKAC 1HW5A 2H6BA 2K9ZA 3VBOB 5C6CA 5K0UC 1YRZA 3M1HA 4QMAA 1YLLA 3HWJA 5BNPA 2I74A 3I8TA 1N1VA 3M2MA 2HWB2 4NHMA 1PVC1 1HV1A 2RR11 4Q4Y1 3KGZA 4YW2A 4HANA 4XIKA 1QJZA 2A71A 3AM2A 3NAPA 1TMF1 4AFBA 1OMIA 1EV12 4Y26A 2XJVA 3R0RA 4BMEA 1H1MA 5C8CC 2ERFA 1X7NA 3ST7A 4AEDA 1DZRA 4YVWB 1X33A 4KBBA 2AZ5A 2CAUA 1W6OB 2XHKA 2BYVE 1DGLA 3GNEA 2JX9A 1DGRA 4P9GA 4EV0A 1CR7A 3OBRA 3MIFA 4NWVA 3DKWA 2NQYA 2JG9C 4L11A 1RVF2 1H1IA 4Z82A 5CAZA 1H2NA 1VBC1 1HXS1 1X36A 4HVRA 3NAPC 3AP5A 4P5HA 4HVOA 5DUVA 2B46X 4XFCA 4Y24A 5LRRA 4J1WA 2HWF3 5FCCA 2UY8A 3MLLA 1RUF3 4HSLA 4XF4A 3WDYA 5AC93 2E6VA 1Y3TA 1EAH3 2JG8B 2QZ3A 3H1YA 3RWNA 5H9QA 4NR1A 4COYA 1IPJA 2XJUA 4YGCA 3ZN6A 4XFIA 2F6BA 3GHNA 5BNOB 5KXDA 1TMF3 2WLQA 3ZFEA 3UL2A 1I3HA 4WM8A 4Q0PA 2ZMLA 1BYHA 2JJ6A 1ULCA 1DBNA 3VKFC 1FYUA 1AUYA 2I45A 1N1TA 5DDJ1 4QPGB 2ZGUA 4FPEA 4PJYA 3VL9A 4LHKA 2ZX4A 1WW4A 1YYNA 2LM3A 4LHNA 4Q4V2 5A3MA 1NE4A 3FFQA 1I6XA 1IZ3A 1ALYA 1AX1A 1C8M3 2CGNA 2I07B 2KM2A 1HXS3 1R081 4K8FA 4MGYE 4AFCA 3ZFEC 1M4WA 4I2OA 1QXRA 4MUVA 4WM8C 5A33A 4Q8KA 4Q27A 1MS4A 1YJLA 4CEWB 2NMOA 1FMD3 4KQ7A 4OI4A 4P9YA 1E57A 1HKDA 2GMMA 1ZM1A 4PBOA 2HWF2 2HWE2 2QFEA 5L19A 4JCKA 3M7AA 3NSTA 3U07A 3LOIA 5FREA 4XJZA 3W9AA 5AC92 5GZEA 4E9KA 2R30A 4G9SB 3QH6A 3OYWA 5EWSA 4GWMA 1VBB2 2AYHA 4IQPA 1FXZA 1RUG1 4JRLA 1PK6B 1HQNA 1N1SA 1PMIA 2PAKA 1SBFA 2GAUA 5T55A 4AI3A 1BBT1 2UY9A 5T5OA 4BLIA 4XE9A 1MEC1 2EAAA 1DG6A 2GMEA 1DU3D 3H50A 2PHFA 2D43A 2BFUL 2A5ZA 3H7JA 4BHPA 1KXGA 4GMP1 2X5IA 1N3PA 3L9JT 4IEVA 4LO6B 3HQXA 2XJSA 3NV4A 1PGSA 2D5HA 1KDKA 1NY71 1V9U1 4P9LA 3RZZA 1BMV1 1POV3 4OLLA 2ZMNA 1W6QB 5D8AA 2A7AA 3ILNA 4LLOA 4YVSC 3SH3A 2UU8A 4CDQA 5J37A 1O3QA 1RUOA 1JYIA 1LULA 3LSEA 2ZGQA 2ZGKA 4MXVA 4NO4A 3I59A 2X53S 2A3WA 2QZ2A 3JD73 3RYRA 4PLNA 5FO8B 1H8VA 1WW7A 3WDTA 1FMD2 5J3UA 1RMU1 4QM9A 1MQTC 1S0FA 1OKQA 3KT4A 1HRV2 3N36A 4FQZA 1RUG3 1VBD3 5B2GB 1IHMA 2TUNA 1GSLA 2D3RA 3T1MA 1TME1 2WS91 4HMZA 4PDWB 4X8NA 4LR4A 4O9GA 5D8AC 3X29B 4CDQC 1Q5OA 1VBA1 3VHOA 1ND2A 4FSJA 2CWMA 4J6GA 4KGGA 3VDDB 4GMP3 1KQRA 2VOXA 1C4RA 1H4HA 4CP1A 1AHSA 3QH7A 4E4ZA 3H3UA 2ARBA 5SV8A 3E5QA 1AR91 4YSFA 3AP7A 1NE6A 1UMZA 5KHKA 1MS1A 2G4IA 2DV9A 1QJY3 4XQ4A 5T54A 1H30A 4RSUA 4LTAA 3AXDA 2E51A 4QQPA 3AMPA 1PO13 1SBDA 1OLQA 1ND2C 2D7FA 3B7MA 2E7QA 3AKSA 1PO23 1LEDA 3AJYA 4LEJA 3AKTA 4ES9A 2WZR2 1QDCA 2IXIA 1O5LA 3AZYA 5BNNB 4HPKB 1SCRA 4N53C 2UWBA 1LOGA 5K0UB 1UW8A 2QNKA 1LOAA 1U5ZA 1RUE3 1W6MB 2PN5A 1RUNA 4YRDA 3A0NA 4DOUA 1Y43B 3I2DA 1CAXA 1YXWA 3MPPG 4QPYA 4XFFA 5GZDA 3JQWA 1APNA 5IUQA 1LKNA 2GH2A 3FLTA 4UW5A 5BY5A 3TN91 3OPZA 2ZZJA 3SNMA 2RMU1 5C8CB 2EXJA 1Q8SA 2PYTA 1SEFA 3FE5A 4I09A 3WQ7A 1ZREA 1AR62 4P9WA 1GNZA 3IKWA 4QQLA 2X29A 4RL7A 1COV2 4HK8A 4ONUA 3IIAA 1WW5A 3NO8A 1RTVA 4GWNA 2QCSB 1DYPA 2JG9B 2XKPA 5GZCA 3UJOA 1HQLA 1U5IA 1YO8A 3KQRA 2DYCA 2A6ZA 2VW2A 1R091 1ZBE2 2MPFA 3NAPB 4YZ4A 2ILMA 1PO22 1H2KA 3DV8A 4PF5A 4LULA 5EJ3A 2VOWA 5BUVA 1O4YA 2WKKA 2JXAA 1FPN1 3FUQA 1WD3A 3RSJA 5FQ0A 2Q1MA 4HL0A 1HRI1 2D6NA 4L97A 2D98A 3LA7A 1RUE2 1YWKA 2OZJA 5L7OC 3PMSA 2P2KA 3V56A 5HCAA 4CDUA 1QOTA 4IEUA 1XU1A 1RJ7A 3OGGA 4DZGA 4Q4X1 2ET7A 1ZX5A 5DUXA 1MS9A 2RMU3 1YFYA 1OOPA 3WT3A 1A78A 3N4MA 2R043 2DCJA 4XETA 2Y0IA 1FV3A 2OUJA 2VY0A 3ZFGA 5JI9A 4ISQA 3D82A 1XNDA 1G9DA 2W0XA 1GQHA 1Q3EA 2RM23 2ZKLA 3ZYRA 4XXAA 3FLPA 4AVBA 4K21A 2YZ4A 2BGCA 2DVDA 2IFRA 4NVPA 1H1AA 2DF7A 1QGLA 1XYNA 1R093 1JYCA 1NXMA 4IEWA 3JB4C 3CO2A 4CDUC 3ZFEB 1G7YA 4FXGB 3KSCA 3KS7A 1RUH1 4LBMA 4NOTA 1AYN2 3MIEA 4WM8B 4R52A 1QJU1 4YVWC 5SV5A 1C3HA 2GC1A 2P3JA 3HT1A 1QXPA 2B39A 2IXJA 2ZTNA 3RPQA 1KITA 5ABJA 2Q0AA 4Y1UA 5FPXA 1RUC1 3FWEA 2P17A 2ARXA 3O12A 1RUJ3 3J8F3 3AYDA 4XZPA 4EN0A 4IEPA 1G9BA 4CP2A 1XNBA 4ASLA 5KXCA 2A6XA 1BJQA 5I8TA 1ZBA2 2Q4SA 1RUI1 1QH7A 4IV3A 1ZRFA 5FMOL 5DG2A 5GLWA 4HN0A 4ES8A 4OI1A 4GB33 4DXZA 3BPZA 3M3EA 4I0WB 4XJ8A 5A33B 1CAWA 1XYPA 2R042 2NLRA 2YHJA 1GANA 1GNHA 2A3XA 4QGMA 3AYAA 1UZZA 3URFA 4S2HA 2NPIA 2XL9A 2H0BA 2GH8A 4P9IA 3JBG1 5CFCA 3J26N 3NKTA 2ZABA 4D7TA 2D6LX