2MEV2

Structural refinement and analysis of mengo virus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
249
Chain Sequence
ENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGEHPASCADTASEKILAVERYYTFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGATLRRHYLVKTGWRVQVQCNASQFHAGSLLVFMAPEYPTLDVFAMDNRWSKDNLPNGTRTQTNRKGPFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLTYSTGASTSLDITASIQPVRPVFNGLRHEVLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
total genus 51
structure length 249
sequence length 249
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev200
1OOPA 1POV3 3ZFGC 1FMD3 5C9AB 2XPJA 1COV1 3VBSB 5CFCA 4Q4W2 2RS52 4QPGB 1VBB2 1MEC2 2RM23 4YVWB 1H8TC 1ND2C 4GB31 5CFDA 1PGW2 5LK7B 1RUE3 4CDUC 1FOD1 2X5IC 4WM8B 4QPIB 4N43B 1RUC1 1RUG2 1PO12 3JD71 2R073 1X33A 1RHI2 1PO22 1EV13 2ZTNA 5L7OA 5DDJ3 2WZR3 1VB4A 1NA1C 1NCQA 2RMU3 2WLPA 3J8F2 1RUI2 3VBSC 3VBFB 4QPGC 1D4M2 1DDLA 4Q4V3 4YVWC 1BMV1 1AR93 4RQPA 4CDQB 2BFUL 2MEV2 1Z7S3 2RS33 5D8AA 4Q4Y3 1AYN3 4WM8C 1QQP2 3ZFEA 1BBT3 4QPIC 4N43C 1HXS2 1QJX1 1VRH1 1VBE1 3VBOA 1QJU1 1QJY1 1AR71 3CJIB 1PIV2 2HWC2 1K5MB 4WM7C 1HRI1 1PVC2 3JB8A 2TBVA 1VBC2 1POV0 1TME2 4RR3A 2RS12 1C8M1 1FPN3 1EAH1 3DPRC 4RS5A 1VBD3 5FMOS 3JBG2 1ASJ3 3VBFC 2RR12 1R082 1RVF2 1MQTB 4CEWA 5C4WA 1RMU3 1W39A 1AR82 3VDDB 5C9AA 1SMVA 4Q4X3 4Q4W1 4CDQC 2RS51 1ZBA3 4NWWA 1VBB1 5FOJB 3NAPA 2XBO3 1MEC1 1VB2A 1RUF2 5J96B 1AR62 4N53B 1RUJ2 1AYN2 5JZGA 4GMP3 1K5MC 2WS93 1E57A 4RHV3 2ZAHA 2HWB3 1RUG1 1PO11 5BNNA 2BUKA 4CDXB 4CEYA 4FTEA 1RUD2 4LLFA 1AL22 1MQTC 4IV1A 1WCDJ 2X5IB 3J8F1 1BEV2 1AYM2 1RUI1 1ND3A 4PDWB 3VDDC 2R062 1R1A3 1VBA3 4FTSA 3ZFFA 1D4M1 2HWE2 5BNPB 2HWF2 3VBHA 4N53C 4AEDA 2WWSA 1RUH2 1TMF3 3HAGA 1ZBE2 4GH4A 2BBVA 2MEV1 5BNOA 1HRV2 5ABJA 4CDWA 1AL0G 2DF7A 3ZXAC 2HWD2 1QQP1 1R093 4JGZA 5K0UB 2VQ0A 1HXS1 4CDXC 5AC92 1B35B 2PLV1 5A32A 1PIV1 2WFF3 1HX6A 2HWC1 2QQPA 1PVC1 5A33B 1VBC1 1TME1 2RS11 3IDEA 1HQNA 4PDWC 1CD3G 3VBRA 5C8CB 3JBG1 1V9U2 2RR11 1R081 1RVF1 5BNPC 1OHFA 4WM7B 3ZFEC 1AR81 1COV3 4NWVA 1A6CA 3DPRB 4IV3B 1RUF1 4GMP0 4GB33 3VBUB 1AR61 1FMD2 5K0UC 4YVSB 3ZFGA 1RUJ1 4FTBA 1B35C 1FOD3 2RM22 4Z92B 1RUC3 5ACA1 1H8TA 1ND2A 1NY72 3JD73 1X36A 2GH8A 1RUD1 1RUE2 5C8CC 4JGYC 1AL21 4SBVA 4CDUA 1NCRB 2FZ1A 2X5IA 1BEV1 1AYM1 2R072 2R061 2R041 1EV12 1OOPB 5DDJ2 2WZR2 1NG0A 4IV3C 2HWE1 2RMU2 5CFCB 1RB8G 3VBUC 1NA1A 2HWF1 4BCUA 1RUH1 4YVSC 1ZBE1 1PGL2 1HRV1 5CFDB 3VBSA 4Q4V2 4QPGA 2HWD1 1AR92 4YVWA 1AUYA 1QJX3 1VRH3 1VBE3 1QJU3 1QJY3 5AC91 1AR73 1ND3C 1Z7S2 2RS32 1PGW1 4Q4Y2 1HRI3 3ZFFC 1BBT2 1NCRC 1C8M3 4WM8A 1EAH3 1NCQB 4QPIA 4N43A 1OOPC 1V9U1 1RHI1 1PO21 3S6PA 5CFCC 4WM7A 1FPN2 4JGZC 4Q4W3 1VBD2 2RS53 1VBB3 1ASJ2 1BMV2 1MEC3 3DPRA 5CFDC 4RQPB 1POV1 3VBFA 1FMD1 4Y5Z0 3TN93 1RMU2 5D8AB 4Q4X2 1ZBA2 3ZFEB 2XBO2 2RM21 4CDQA 1RUG3 5L7OC 1AR72 1PO13 1NY71 1NCQC 1HRI2 1RUE1 4RR3B 2WS92 4RS5B 1M06G 4RHV2 3CJIA 3LOBA 2HWB2 3J8F3 1K5MA 1RUI3 2R071 1NOVA 1EV11 2BFUS 5DDJ1 4CEWB 1D4M3 3FBMA 2WZR1 5C4WB 2RMU1 4JGYB 4RQPC 1MQTA 3NAPB 5D8AC 1R1A2 2MEV3 2Y26A 1VBA2 3VDDA 1PGL1 3TN92 2BPA2 4Q4V1 1QQP3 5GKAC 1AR91 3VBOC 5JZGB 1TMF2 1HXS3 4N53A 2PLV3 1Z7S1 1PIV3 2RS31 4RR3C 4Q4Y1 1AYN1 2HWC3 5BNNB 1PVC3 4RS5C 4CEYB 1R092 1VBC3 1BBT1 1TME3 4RFT0 2RS13 4IV1B 4EJRA 3JBG3 2RR13 2WFF2 1R083 1RVF3 4CEWC 4CDXA 5C4WC 5C9AC 1ND3B 3NAPC 1AR83 3ZFFB 1FPN1 1VBD1 4FSJA 1ASJ1 3VBHB 4PDWA 1RUF3 4AEDB 1AR63 2FZ2A 4GH4B 5BNOB 3M8LA 1RMU1 5BNPA 5JZGC 5ABJB 1COV2 4CDWB 1RUJ3 4Q4X1 1ZBA1 2XBO1 4JGZB 1C8NA 5BNNC 4GB32 4CEYC 1VAKA 1F8VA 2PLV2 5A32B 5ACA3 5J98B 1RUD3 4IV1C 1FOD2 1AL23 5K0UA 4GMP1 2WS91 1B35A 4RHV1 1RUC2 3VBRB 2HWB1 1OPOA 1BEV3 1AYM3 3JD72 2R063 5A33A 2R043 5L7OB 4Y4YA 2HWE3 3VBHC 4AEDC 2ZZQA 5C8CA 4JGYA 2HWF3 4GH4C 5BNOC 5ABJC 1RUH3 4CDWC 1ZBE3 1R1A1 1HRV3 1VBA1 3TN91 3ZFGB 2HWD3 4IV3A 3CJIC 3VBUA 1TMF1 5AC93 2IZWA 4YVSA 1H8TB 1ND2B 5FMOL 5ACA2 1F2NA 2GSYA 1R091 1CJDA 3VBRC 1IHMA 1QJX2 1VRH2 1VBE2 3VBOB 1QJU2 1QJY2 4CDUB 1V9U3 1GFF2 1QJZA 2WFF1 1RHI3 1PO23 2R042 1C8M2 1EAH2 1NCRA 3JB4C 1NA1B
chains in the Genus database with same CATH superfamily
1POV3 2D93A 3KQ4B 4GWMA 2Q0AA 1VAMA 4RGGA 5F6KA 1UY4A 3WZ1A 5C9AB 1V6LA 2QNKA 3U10A 3WCRA 5H9PA 5FZAA 1TNFA 1SBDA 5IK7A 1MEC2 1SDWA 1Z0HA 4M00A 5IYYA 2DVDA 2XL9A 3CQOA 1ND2C 1HQLA 4GB31 1QY4A 1CONA 3AZWA 1ENQA 5F9TA 4BIFA 2RDSA 3MUZ1 4P00B 3O1UA 2WR9A 4LORA 4AHZA 1Q8OA 2D7FA 3ZN4A 2W08A 2Q8DA 5FP4A 4AG4A 4PJYA 3SEEA 1NX9A 5KXBA 3V0BB 1HKDA 3VUOA 1RUC1 2JEMA 2JDMA 4XMIA 4A2UA 2VPVA 3JD71 4S2GA 1V70A 1M4WA 2B9VA 4V2WA 4A44A 3AP4A 3JQWA 1H2KA 1VB4A 1NCQA 1UYYA 3TNPB 4K7JA 1PHMA 1Q3EA 4RL7A 1DQ0A 3OGJA 3WSOA 4EE2A 1ZRRA 4DXSA 2BOJA 4LO8A 2BWCA 5FP7A 3J9SA 4LBQB 2R0HA 3PVNA 1C1LA 4QPGC 3TAYA 1D4M2 1UN1A 3TBDA 4L0PA 4YVWC 3SCFA 4LA2A 3EMRA 1JZ4A 3ZDSA 4M3CA 2OXBA 3G6JB 4JTNA 3OTFA 3RYRA 5HCFA 5KBFA 4P9JA 4YRDA 5FZBA 2BOIA 4P9IA 4O7XA 5LRRA 3RZZA 3VZNA 1S0EA 2FCUA 3I3DA 4HETA 4IEWA 2B46X 3T1LA 3S5AA 3I3BA 3JUUA 3DYMA 3RG0A 2ARAA 3T0BA 4Q4Y3 4FPJA 3WLUA 4NIHA 5FO9B 4J1XA 3PVOA 1BBT3 4FCAA 4N43C 4QPIC 2FMYA 4QQOA 4IGQA 1ULCA 4R9AA 1HXS2 5GLUA 2B39A 1RINA 3JZVA 1VBE1 3JXSA 3T1MA 4BZ4A 1XXNA 4D6SA 1PIV2 2TEPA 4WM7C 2VOKA 4FOVA 2QTWB 3BUCA 2XJVA 1V6MA 2XWBB 4Q2FA 1G9CA 2LALA 1FPN3 4E2QA 3POWA 1BVVA 1VBD3 2WN2A 1W03A 1OQEA 5FPZA 2RR12 1R082 5FTTC 4PIXA 2D6OX 5DG1A 1REFA 4XXPA 2BRTA 1UIJA 3PIJA 3WINE 1O91A 3AYEA 4C0BA 5C4WA 2OZJA 3RJ2X 4GJZA 1LNSA 3B3QE 3RNSA 3AP9A 2RS51 4IUGA 5L9BA 4NWWA 4GJYA 4LIUA 1VB2A 3DEMA 4GKYA 2ZHLA 1AVBA 1XSRA 3ZR6A 1EPZA 2ATFA 4AI0A 4N53B 3VHPA 1CAXA 4ZU5A 3SCGA 3U0ZA 4YZ2A 3K2OA 2Y6FA 5F32A 1AYN2 1HB1A 1TQ5A 1ZZ6A 2EALA 3MDPA 5HI0A 1C3HA 2VZVA 3POFA 4DXTA 3GF6A 5K9YA 1S0GA 1K5MC 3LD8A 2WS93 1UD1A 3M2MA 1GR3A 1E57A 4RHV3 4XFHA 5FZ9A 3A0NA 5FMDA 3U37A 4D0QA 4GQ7A 1RUG1 2HBUA 3P5BA 1PO11 1QGLA 3AXEA 2BUKA 3TOJA 2XVLA 4XJAA 1UOGA 2AZ5A 5JXGA 1A8DA 3MLKA 3AMPA 4ZU7A 1MQTC 1ULOA 3KV9A 1OLRA 3TEZA 2BNNA 1H2NA 2QQUA 1BEV2 1AYM2 1WLCA 1ND3A 3VDDC 4Y1YA 3HJRA 2VR4A 5JOXA 4E9KA 2IC1A 3H0OA 1JHJA 4CCEA 3IBMA 3LEMA 1MZFA 4MH0E 4OI2A 3CLPA 2ZX4A 2VBDA 3H42B 5KHIA 3AL5A 3IDCB 1E5HA 2A73B 2Q1ZB 2VNRA 3B5LB 3ZYIB 2PAKA 5IFTA 4N8MA 2DVAA 3MF9A 5D21A 2PHRA 1LCLA 1GSLA 3ZO0B 3SH4A 2QQIA 1D2QA 3VL8A 3B69A 3BIWE 2W47A 1W04A 4YZ5A 5IVBA 2VQ0A 2Z69A 2WO3A 2WZ8A 3B9CA 3UV9A 4EN6B 3KD4A 5B4NA 1HX6A 1UY0A 2WO2A 3LE0A 3I2FA 4KWLA 1PVC1 4NUBA 4C91A 1V00A 1F5JA 3T0DA 2VZPA 3GJAA 3MLJA 4XPVA 1JYXA 2B45X 2C1FA 1SCSA 3P6BA 1MS5A 3L9JT 2VM9A 2RDRA 2DUPA 2P3KA 3WP3A 4XF4A 3WEZA 2HYKA 5BY5A 4HN1A 4F8AA 1OHFA 1VLNA 2CU5A 1UOBA 4FP2A 2J1SA 2D3SA 5G05L 1AR81 3ZPYA 4LHNA 4YLZA 3RSJA 4AI2A 1IQDC 2A6XA 1PMHX 4QB6A 4CTEA 4AVCA 1DZTA 1VMFA 2BW8A 3IPVA 3LSEA 4E2GA 4XILA 1RUF1 2D5HA 5ANQA 2JG8A 2YYOA 4GMP0 4GB33 1DF0A 1W05A 1DGLA 2VOVA 2BGPA 4QX7A 4LNVA 2Q8EA 3O7OA 1YIPA 4NMIA 3DKWA 3UKNA 5K0UC 2ET7A 4Q0UA 3ZFGA 4L97A 1KITA 4LK6A 4ZONA 1X7NA 3I3QA 5FY4A 4URAA 4ZZ8A 4JRAA 1OBNA 4WVMA 1S0IA 1KDKA 1MACA 2RVAA 4XJ9A 1X50A 3E6DA 1LODA 2WT0A 4YFWA 1RUC3 5J09A 4I2OA 2N7GA 1H8TA 3JD73 3OB8A 2A1XA 2IWGB 4MGQA 3AYAA 5FPBA 4LO5B 3PTRB 5FLHA 1CAWB 4C1WA 1JXNA 2YMZA 2ARXA 3LFMA 1T2XA 2ZGPA 5JCTA 4ZHNA 1J3PA 2X5IA 1JYVA 3UGHA 2RJKA 4PIYA 4QDQA 3B00A 2BU9A 1OOPB 2IFWA 3AP5A 4AI1A 3SEPA 2Y6GA 5IVJA 2HWE1 1EYBA 2W0XA 2XMLA 2YY1A 2YBKA 4IEYA 3VBUC 2C9AA 4ASMB 3EQEA 4HONA 5LA9A 1YFUA 4E8CA 1RUH1 4F3JA 1WBLA 3ZLIA 3ST7A 5C3QA 4CVUA 1UOFA 1BKZA 1HJGA 1HRV1 5CFDB 5A3WA 5HXMA 2CGNA 4HLTA 2IXLA 1H30A 4UYBA 4MG2A 4Y5TA 2GN3A 3HN1A 2VJXA 3GBGA 4J6GA 5C8WA 1AUYA 2QQOA 4TN7A 2ZS6B 1VBE3 3WDXA 3HNMA 2ZX0A 1CZVA 1GNHA 3D82A 4Q4Y2 4N90A 3WF4A 4OI4A 4XTMA 2PFWA 3VD5A 5F7UA 3NV3A 5F5IA 3GJBA 1BBT2 1ZA7A 2X05A 1XNDA 1W9FA 3ZSLA 5A3MA 3V0BA 4Q0SA 1HN1A 5AFEA 3OJBA 2C9KA 2IFRA 1RITA 1FATA 4JRLA 4BHPA 4C90A 1RJ7A 2OPWA 3UT0A 2H0VA 1QIQA 3VKLA 1QKQA 1WLTA 3I2KA 3NNGA 5CFCC 4XF1A 4XAEA 4XW3A 1FPN2 5DAQA 3HBZA 4JGZC 1VBD2 3C7OA 2RS53 1LEMA 2ZHMA 3H7JA 5FZ7A 5A7WB 1BMV2 3R0RA 4Q29A 3DPRA 3LF7A 4UBGA 4HXCA 1NLQA 3TYJA 1UPIA 2W3JA 3CNAA 1FMD1 2LW8A 3J7LA 5JOYA 1HIXA 4CYDA 5D8AB 2CDOA 4DUXA 4K21A 4E4ZA 1UNBA 3MIGA 4LLOA 3AC0A 3WNPA 1LR5A 5FPXA 4P9LA 2DCTA 2VNVA 3SXWA 5C5UA 2J42A 1RUG3 5L7OC 1AR72 1PO13 2GH2A 2H0BA 1OH4A 2XUEA 3GCXA 2ZGLA 5I91A 3VZOA 5CNAA 4RR3B 4XJWA 4CP2A 1GWKA 5FY7A 2ZPXA 5IK5A 1ZZBA 4HT1T 4XBLA 1U5IA 2WS92 4RS5B 5LY1A 4RHV2 1A34A 2WIIB 1G9AA 5LEKA 5LK5A 2BFUS 1XE7A 2ZKLA 4UT5A 3FBMA 3C8XA 1W6OB 3ORJA 4IQPA 1WMDA 4JGYB 2GN7A 4BQWA 3H1YA 5FPVA 3QD6A 5GLVA 1O3SA 4E27A 5EIYB 3W21A 1YQ6A 5HPOA 1MZEA 1CZTA 3TN92 5DAPA 4QX1A 3VKNA 3PU8A 5GKAC 3EYPA 3ZXKA 4EZHA 4XDPA 4DY5A 2VW1A 4NHMA 5GALA 5JXIA 5DXDA 1N3OA 1I6XA 1NT0A 4N53A 3WV6A 1Z7S1 4IE4A 1ZNPA 3PHMA 4LHKA 4XE9A 3WR0A 2J1AA 1OSGA 1AYN1 2UY9A 3E5XA 1WA4A 1PVC3 2VZTA 3OUJA 1F35A 2UURA 3BPSA 4CEYB 3MPBA 4RFT0 5JIUA 1GKBA 2JG9B 3N36A 5FDBA 1LJ7A 1WMXA 4IV1B 3G7DA 2R1BA 3DECA 3HBKA 4CEWC 4Z2AA 3RWNA 2WFPA 2ZBJA 2GNBA 2ZZJA 2FCVA 2DUOA 3NAPC 1AR83 2GP5A 3POGA 5FZCA 5FZMA 3ZFFB 2W2IA 3LIHA 4MHRA 1NZCA 3RYPA 4FSJA 3P3PA 1DQ5A 1CIWA 3ILNA 2NN8A 1OMIA 3VBHB 1RUF3 2CYFA 1CR7A 4AEDB 4RN5A 1NLRA 4ASKA 3MO4A 5JXHA 2YGMA 2BZDA 3HVDA 4GH4B 4YW4A 1XQNA 5CKNA 3AKPA 3OD0A 1XNKA 5L9VA 3FHAA 5CADA 1WMEA 1FV3A 2VW0A 2X8KA 4YNIA 2WWJA 5JVVA 4AXOA 1YEWA 4P9YA 3CBNA 2GAUA 4GB32 4YWAA 3ZXLA 2Q8CA 4HK8A 1I3HA 4HZFA 2C6SA 4MGYE 4ZKTB 3PURA 4XUPA 1LHOA 1EPWA 2JDYA 2F17A 5FUIA 4E8DA 3O1OA 2D6KA 3K3NA 1DLLA 1JTZX 3JCIA 4FAGA 4AWDA 2P3IA 3PTYA 4WZCA 1W28A 1V6NA 4S2FA 2OA2A 4NR1A 1AF9A 1RUC2 3BB6A 5FLJA 4AI9A 4DO0A 5C70A 5IVCA 3JD72 4HKOA 4MVTA 3AX4A 1AHSA 1SHWB 2VCMA 4BJ0A 2HWE3 4HKWA 2OQ7A 5KC5A 3Q8BA 1JYTA 2JENA 2E26A 3OCPA 5HBAA 4FFHA 5ABJC 1RUH3 4CDWC 3LDKA 5LBEA 3T4HB 1HRV3 1IKPA 1VBA1 1W9WA 1WW7A 5A3NA 1K45A 2BEOA 1SPPB 3C7EA 4U36A 1UZZA 2JKXA 1MPXA 1P8JA 1C1FA 1DQ1A 1UYXA 4YZ3A 1W9SA 5JOZA 1G9BA 1W2NA 2ORZA 3CJIC 4AAXA 1O5UA 1TMF1 2CWSA 4NE9A 1C4RA 2I2SA 4QD2A 2XQRA 3M70A 2ZMNA 2Z5WA 4XFGA 1ND2B 1U0AA 3N9QA 5D2AA 2A5ZA 5FMOL 3OGVA 1JUIA 1SLCA 2GSYA 3WP6A 4L99A 1X9PA 4JQTA 3VBRC 4AE2A 5AFBA 5LEJA 4YGBA 5BV6A 1IHMA 2WDBA 1CAVB 1VBE2 3WUCA 4PF5A 2CV6A 1V6IA 4B29A 5I8YA 4INDA 5JLVA 3AZXA 1KD7A 2LRPA 4ZPIA 4NN0A 1IOAA 5CA6A 1ACCA 4YW3A 5IAXA 1CPNA 2FDIA 2BNMA 1W0NA 3JB4C 5G04L 2VBPA 4L8QA 1J84A 4Y24A 2BWAA 1HB4A 4LT5A 1OOPA 5JMOA 3KVBA 3I97A 5D1IA 1FMD3 4MZUA 4YG3A 2VL4A 3V64A 4IDZA 2VMEA 4XFFA 2EIDA 2XPJA 2V4VA 5J37A 1GQPA 2P37A 2RS52 4QPGB 4ARYA 1OVPA 4D94A 4YVWB 5ISLA 2QE3A 2P3JA 3LB9A 3PMSA 4EWAA 2QZ2A 2WUHA 5CFDA 1YFXA 5K4LA 5FUNA 2PN5A 1XYNA 4SLIA 1DYOA 1IG3A 2SLIA 3OBAA 2VO5A 4R9CA 4AVVA 1WLDA 3KGLA 2XVGA 5LBFA 1HN0A 1VMHA 4JKKA 3X29B 2PMWB 3ELNA 4QB1A 4DUVA 4QPIB 4N43B 1A3KA 4A6SA 1RUG2 1PO12 3H8XA 2FDHA 4TXWA 1SLAA 1X33A 1RHI2 1PZ7A 1UMIA 4D7TA 5A6YA 3CJXA 3O14A 3O1TA 2Q30A 1JU4A 1NA1C 1Q8PA 1QDOA 2VUAA 3POYA 4DIQA 1ONAA 4UW4A 1HV0A 3ILFA 3MF6A 4XIKA 1PK6C 5F3EA 1MVQA 3ZDVA 1C57A 3N9LA 4XCAA 1ZVFA 4Y5SA 3VBSC 1JI6A 3VZJA 1Y43B 3PUIA 4YGEA 2G19A 1XYPA 4WBBA 1BMV1 1O8PA 1SFNA 2K46A 3RS6A 3NNFA 1SACA 4FPYA 5CZKA 5HV0A 1Z78A 4XETA 2QJVA 4HANA 2OKXA 5FWEA 3RDIA 1Z7S3 5HCAA 3FE5A 4Y26A 3A4UA 3RMXA 5D8AA 2ZHNA 1AYN3 4MOAA 4XFBA 3WD5A 3U1XA 3K4AA 2JDPA 3ACLA 3ATGA 3URFA 4CU7A 5FOBB 1VP6A 4NJ4A 3WP5A 5C3PA 2HLEA 1QJX1 1O5LA 3OGGA 3RJRA 1QJU1 1AR71 5KHHA 3I2IA 1PMIA 5T50A 4KG8A 1J58A 3ACFA 1K5MB 4Z07A 4ES9A 1XC6A 1PVC2 3HNYM 4QDRA 3AB0A 1POV0 4LIVA 2YPDA 2V4AA 3B02A 4RR3A 4XF9A 5FZHA 1EAH1 5JI9A 4BK5A 4RS5A 5A1AA 3AZVA 2VUDA 1OKOA 4OQ9A 4BQ2A 3VBFC 4AFDA 1A78A 5F5CA 2E31A 2WNOA 3IIAA 3C2UA 3ME2A 3WHTA 1JMUB 1MQTB 5EXOA 4LBNA 1UOJA 3O0XA 2FDFA 1W6OA 1W39A 5E16A 1AR82 1S0JA 4KL1A 2OUHA 4MXVA 5SV5A 3VDDB 4CCDA 3KT1A 4CCLA 4ZZ5A 5DMYA 2P34A 3IPVB 3MFAA 4QGNA 4BB3A 1YCIA 1RUF2 3F95A 2DU1A 3PLQA 3NJVA 4NIAA 1ZZ7A 5J96B 5FMBA 4CU8A 3FLPA 5A3TA 5FR3A 4K1ZA 2VVDA 4W6XA 4AFAA 1NQJA 2VNOA 4FP3A 1OLQA 2W87A 3U78A 4CRQA 2D43A 1JYIA 2LM3A 4NAMA 5A7SA 5CG9A 1XBFA 4YPJA 1TVGA 4X6QB 2QQNA 3NW4A 4BOWA 4FAHA 1OH3A 3USUB 4XUQA 2OPKA 3NMBA 3R4DB 1WGPA 1SQ4A 4ONUA 4QWNA 4CEYA 3U4XA 3U07A 4FTEA 3NO8A 2V73A 4KGQA 4AGGA 4EV0A 2JG9A 3CEWA 2V72A 2OUJA 2DBIA 3J4UH 4IV1A 3MW2A 2X5IB 3I2OA 4I0BA 1IPKA 3N4MA 1VBA3 2D6NA 4FTSA 2VQAA 3ZFFA 1YFYA 2HWE2 2HYXA 3DXUA 2ARCA 2ZGNA 4IGOA 3T30A 2JDUA 3WF3A 2ORXA 1U5YA 3VBHA 3D3AA 4X6RB 4AEDA 5CEHA 4XIOA 3AMQA 1A8MA 1RUH2 1TMF3 1JUHA 4HVRA 4GH4A 1UYPA 4UFIA 1O3TA 1ZZCA 1HRV2 2VZSA 1BK1A 2ZGOA 3ABZA 4C8DA 4JKLA 3S57A 2AEZA 4JDMA 4XMAA 2VMCA 2YXSA 4K8RB 1W90A 2EA7A 3WX5A 3J26N 5K0UB 4CDXC 1QNWA 3ZKUA 3K3OA 3UJQA 5JWPA 3HQRA 2HWC1 2QQPA 4CCKA 1N1YA 5JOWA 5A33B 1VBC1 2ENRA 1TME1 4WVVA 5CG8A 4Y1ZA 2RS11 3H8OA 4DMIA 1GNYA 4PDWC 4R9BA 4NHKA 2X10A 1Q56A 3UETA 1FNZA 5A7QA 3GDBA 5FYCA 1RVF1 4D7YA 3I2GA 4IEVA 4QKFA 2VU9A 3SITA 2UYAA 3AJYA 5BNPC 2IXCA 3FLTA 4K1YA 2QCSB 2QKDA 4NROA 4NWVA 1XNAA 4OUSA 1KFUL 2EF6A 4WZFA 2EIGA 3DPRB 1YQCA 3BOPA 4JZRA 1UWWA 4NHLA 4TTGA 4BYYA 3VBUB 2KD7A 1AR61 1FMD2 1UYZA 3O0WA 2NMOA 3M7AA 4Q5OA 3T08A 2NPIA 1SPPA 2BGOA 2WABA 4FTBA 1IZ3A 1SLBA 1UO9A 3K4ZA 4CXWA 1LKNA 2W68A 5GLZA 2JDHA 1BVP1 3IMNA 4K9SA 1Y3TA 4Z92B 1US3A 1UZYA 1NYWA 1NXMA 4KG0A 1UU6A 2W52A 3DV8A 4H55A 2PHXA 1KXGA 1ND2A 4LHSA 3ZM8A 1X36A 3AMHA 3GALA 5DPNA 4XJ8A 1GYKA 1RUD1 1DU3D 3MEPA 3OPZA 3VHNA 2A3XA 3LEGA 5C8CC 4EN8B 4LBMA 1CAVA 1ULEA 4R4ZA 4FPLA 4Y4RA 3WNNA 1QOTA 1QMJA 2VNGA 3AXDA 2FZ1A 2PAMA 4GKXA 4QDSA 4RA0A 3ZYHA 2ZXQA 3ZXDA 3ZN6B 2R6QA 1RIRA 4QKDA 1NG0A 4IV3C 5DN2A 2NP0A 2P1BA 1X8EA 4QXKA 1G9FA 5CFCB 1CAUB 4TYSA 2C26A 2HWF1 5EFUA 4YW5A 3PL0A 4XABA 3VZLA 4BCUA 1QOSA 4BM8A 3CZJA 3TRSB 4AR2A 5FZ6A 5FP9A 3IIIA 4XZUG 2J1RA 4HK9A 4V1PA 5K8SA 3A21A 5EV7A 3WNKA 4QPGA 4Q0QA 2A6YA 1ZYBA 3VN4A 2DBNA 3WW4A 4YM0A 4YVWA 4AEKA 1WZXA 1QJX3 1MZ5A 3I8TA 4JQRA 1QJU3 5AC91 1W8WA 4TLFA 1AR73 1ND3C 1Z7S2 3D5OA 4PHZA 5JIAA 1ZREA 1DGRN 4X8PA 2DCYA 3N7KA 2P6HA 2R32A 2ARBA 5FZEA 1FNYA 1FYUA 3EHKA 3T2PA 1EAH3 3QLQA 3VLBB 4XEZA 3LQCA 5FZ1A 2NM1A 1V6OA 4N43A 1QNYA 4LUMA 4QPIA 5FY5A 5GZFA 3M3IA 1L7LA 1OT5A 1V9U1 1IKQA 1WW5A 5AVAA 4DRRA 5L36A 1RHI1 1W2UA 4XFIA 1YFWA 3WY6A 1IGOA 3WQ7A 4A6OA 1FT9A 4AF9A 1NLSA 4AVTA 4KBZA 2D98A 4WM7A 1WBFA 4S2DA 3KZ4C 3WNXA 2KA3A 3POSA 4LUKA 3J7MA 4OUEA 5FY0A 5FREA 5F3GA 4DB5A 5EYYA 4QKNA 3FHIB 1NUKA 5FYIA 4OHZA 3TN93 1K12A 2EIBA 5A6QA 3M1HA 2CAUA 1IPJA 2VXJA 3ZFEB 3ZPOA 1LOCA 2RM21 5EPAA 3I2HA 2FMDA 1PVXA 5CBLA 2JDNA 4JVAA 5DG2A 4K6BA 3MI8A 1ZM1A 2WWUA 4N7UA 4QU1A 4DFSA 1SLTA 4I09A 4XOGA 2QQWA 2F6BA 4GWJA 3GHNA 1NY71 3ON7A 1KFXL 1UZVA 3BPZA 1HRI2 5KHGA 5JSOA 4GALA 1DIWA 1T6GC 5FWJA 1XU1A 4ZXEA 2ZGSA 4QGLA 2E32A 2VOXA 3I2JA 4HVQA 2HEWF 3FFQA 3AL6A 3WW3A 4OLLA 5IK8A 4AEMA 1M06G 4PBPA 2H6BA 3AFKA 5FK7A 4CP0A 3H8RA 3LOBA 5A3PA 1K5MA 3NNJA 1OKQA 2ZGUA 1EV11 5F5AA 1DGWX 3BODA 4CEWB 4OHYA 2B8MA 2QFEA 2BTVC 1OFNA 2RMU1 3OUHA 4FO9A 4XQ4A 4RQPC 3VKMA 3BTYA 1O4TA 4LA3A 1VRBA 3KCCA 4KU7A 1DQ4A 1MQTA 3NAPB 4CCMA 4JCKA 4UFJA 3KGZA 2YG0A 4NRPA 1STMA 1ULPA 2R30A 1Q8SA 1VBA2 1U5XA 3OPTA 5JI7A 4KBBA 3VDDA 1PGL1 2WJSA 2BPA2 1QWRA 3GNEA 4FXKB 1D0GA 1D0HA 4IE5A 3V65A 5FK8A 3PJQA 4LBJA 1AR91 3VBOC 1GQHA 1HB3A 3RZMA 1TMF2 1K5JA 4XBQA 2XG3A 3ZSKA 3PVEA 4MADA 1SZBA 2VUJA 4Q8KA 3BU7A 4GWNA 2HWC3 2JB8A 4QQ2A 2D3RA 5FP8A 1VBC3 1TME3 3VDBA 2RS13 2IVIB 1PZ8A 3SHRA 3ILRA 4META 3DCQA 1S2KA 5LBCA 3PVBB 2XQXA 3USUA 4K40A 4COYA 1YLLA 1RVF3 5DZGA 4TWTA 4Y1UA 1W0OA 5C9AC 4RGKA 2JDKA 4DQAA 5LRSA 2OW4A 2WYSA 3WQ1A 1E5SA 3HR9A 2VZQA 3BU0A 1WUVA 4I0AA 3VKFC 1YUDA 4NIGA 5IW0A 1ASJ1 4UOJA 1ENXA 1HJFA 3MIEA 3U14A 3LWCA 4F7ZA 2P17A 1WW6A 3ETPA 4CPBD 3OY8B 1AR63 4YYOA 3E1F1 4M01A 2E51A 4Q26A 5BNQA 2VQTA 2VD7A 2JE9A 3C7GA 4HFSA 1RMU1 5JZGC 1O4YA 2V5DA 4ATFA 4CDWB 5ABJB 4Y22B 4LMFA 2OVUA 4LJHA 2IXIA 1N3PA 4QX3A 5H9QA 4D69A 1VPHA 4J1WA 4UW5A 4DNYA 4MHUA 1DP0A 2ZHKA 3HT2A 5HCHA 5JSRA 2L9LA 5BNNC 4NVPA 1OXCA 3OGRA 1UW8A 2WNEA 3LCPA 5FYYA 2ILMA 2YPJA 2DVFA 2I74A 3K48A 4PCRA 5E1RA 1RUD3 4XF3A 2DTYA 2ZMLA 2VCBA 1LGNA 1ZX5A 5K0UA 4ISQA 4LBKA 3CF6E 1FI2A 1GBGA 2W1WA 4QM8A 1ALYA 5IVYA 3UGGA 3VBRB 1POQA 4CUGA 1OPOA 4PT6A 2OX0A 2EXKA 4QX0A 5A33A 4CU9A 2PA7A 1BYHA 3PIGA 1KRIA 2Q1MA 5DQ0A 1XRUA 5GZDA 2YBPA 1CJPA 3HN3A 4QB2A 3RMYA 4BA6A 4PLNA 2WBKA 3WOGA 2HWF3 3D4KA 3FHQA 5BNOC 1JODA 3DF0A 1R1A1 3VD4A 4W8JA 1UY2A 2KM2A 4BLIA 3ZN5A 2XKPA 3E5UA 3KWVA 2XDVA 3MIHA 2Y0OA 1SG3A 4J25A 3PUHA 2ZAAA 4HVOA 2D6MA 3HEIA 4NPLA 1CX4A 1UMZA 4XUOA 2ZKNA 3VBUA 2ZMKA 5AC93 1D7PM 2BGCA 2GC0A 2Q1FA 5FO8B 2CSGA 1K42A 2CAVA 3AKTA 4AHXA 1F2NA 4XCBA 3I3MA 3GZTB 4CUBA 2C0ZA 5F5QA 1QJX2 5JUVA 4GA9A 1QJU2 1WCKA 4Q1RA 1NZIA 2W92A 1V9U3 3N7MA 2WFF1 3KB5A 5FZOB 1RHI3 1H0BA 3WW1A 5C7GA 2VAUA 1W2OA 1W8UA 2AR6A 2R042 3ES1A 3HD8B 4LKFA 1TZOA 5FZGA 3MFCA 5GZCA 2ES3A 1EAH2 5IVFA 4LE4A 3V0AB 1VAVA 2JD4A 2EXIA 4CUCA 3NV4A 4IEZA 1GZWB 1NA1B 1F4HA 4TSVA 3ZN6A 5LASA 4AOCA 1PK6B 3CMGA 4GXLA 2BVVA 1COV1 2XXZA 5FY8A 3VBSB 5CFCA 1CAUA 4GD4A 1IQAA 1ST8A 3ITQA 5KHJA 1Y4WA 4C1XA 1YQ8A 2RM23 1S4CA 1B09A 4B1MA 4O61A 4PLMA 4CCNA 4Z2WA 4OQ8A 1SBEA 3PUSA 5DAWA 2XGXA 3HPNA 3MIBA 3NJXA 4A3ZA 4E4HA 2PHDA 2NYYA 3O5SA 2KR2A 4LBQD 1PGW2 4LKSA 1HB2A 3AYDA 4HBNA 5LK7B 2DU0A 3N9OA 2KXLA 3LIGA 1SEFA 1QU0A 4LPLA 4CDUC 3O0VA 1LB2A 2HH9A 5F6LB 1S2EA 3H7YA 3OUIA 5BXXA 4AL9A 5IJRA 1UKRA 2JJ6A 3HQUA 4AI8A 1I5PA 3NQHA 2BQPA 2WQZC 2XJQA 3ZX7A 3GZUC 1JYNA 1PO22 1EV13 5A1LA 5F1RA 3LPFA 4LO7A 2OQ6A 1PZ9A 3NJYA 5L7OA 2DCZA 2RMU3 3FZ3A 2G4IA 4HSJA 4XZPA 1HDKA 2FDJA 3NL1A 4D6RA 3I59B 4QM9A 5IT6A 2ZA9A 5LA1A 4YZ1A 1LGBA 2OS2A 4DS0A 1OA2A 3CHXA 3D0JA 2WC2A 3W9AA 4FPGA 4COWA 4JTOA 2WN3A 3VBFB 1OF3A 3WUDA 3FX3A 2VULA 5FJKA 5DAXA 3KQRA 2WA3A 4XJUA 1JZ3A 4KWUA 2WQ4A 4XUNA 1AR93 2EAAA 4HPKB 2B42B 3LGRA 4RSUA 4XXAA 4CCJA 4KGGA 2PAEA 3N7JA 3WW2A 5JPNB 1SLLA 2BFUL 5T55A 4E4DX 4MUVA 2XJPA 3B93A 3K51A 5EJ3A 4MX3A 1LU1A 4WM8C 4WVZA 3OEBA 4OHVA 3ZFEA 2JX9A 2QZ3A 5B4XA 2ERFA 1LHNA 3M3OA 4PQ9A 1OF4A 1JS9A 1WCSA 4IEUA 3IB3A 1KEXA 4XAAA 3S7EA 1QJY1 1UY1A 4QT6A 2NZ9A 1WD4A 2Z4FA 4YM3A 1ZZ9A 2AENA 3GBFA 3ASIA 1JN2P 2HWC2 5F37A 1JU3A 2DCJA 1ODNA 1HRI1 3NVCA 4NAOA 5CKMA 1O3RA 1Q8VA 4YG6A 1VBC2 1TME2 4LITA 2RS12 1PMJX 1FAYA 3PJYA 5FY1A 3I2DA 2P2KA 5FMOS 1ASJ3 2RHPA 1H6YA 3KV6A 5F2SA 3MICA 1RVF2 2D5FA 4L92A 1OI6A 1AZDA 2VH9A 3K46A 3NNMA 1W06A 3R4UA 3V56A 4CEWA 1RMU3 2VQUA 3AKSA 5JDBA 2JICA 5DABA 1SMVA 4Q4W1 4CDQC 2VZUA 4A41A 1VBB1 3NAPA 4ZS2A 3LPGA 3A0KA 3KT4A 3JU9A 3NNLA 2YZ4A 2IUWA 1LRHA 4OULA 2VUCA 1AR62 5IVVA 3GM8A 3T4VA 1UZ0A 4QXHA 1TG7A 2MNGA 5T5LA 3OBZA 3ZYGA 4OMCA 2EIEA 2YDEA 2E63A 1IS5A 4AFMA 4LQRA 2EICA 3M3QA 4AGVA 2F4LA 4IEQA 4M4PA 3ZYBA 3VD7A 5E6HA 2WA4A 2DCKA 3HT1A 1DZRA 3Q8FA 4N9IA 4AW7A 4COZA 3RVHA 2ZCWA 3TEYA 1SDDB 4LK7A 5IUQA 4CDXB 1BQPA 4IE0A 1YXWA 1RUD2 3LA7A 4COUA 2J1TA 4R9DA 2GALA 4XYXA 1W0PA 4BIOA 5FJHA 3NJZA 4BMEA 1KDMA 2NLRA 2OZ6A 2AREA 4BISA 1YJKA 3J8F1 3E5QA 1G8WA 1RUI1 3N9MA 4PDWB 3RPQA 1JOBA 3WDYA 4IE7A 2P4EA 4D7SA 4E2SA 1R1A3 2UWBA 3AP6A 2DVBA 1W6QB 4W65A 5HCBA 2QDNA 4JHTA 2E7QA 5T3NA 4D3WA 5BNPB 3B9IA 3OSDA 1T6BX 4L9BA 2HWF2 2A3WA 2Z79A 2QQKA 5EHDA 2XOMA 4AGRA 3OY8A 2A6WA 2WYFA 1V6KA 2WNVC 3HNBM 3NKGA 5TSWA 4P08A 1BK0A 2MEV1 2ZGRA 3WG4A 3J7HA 2BBVA 2LTNA 1H6XA 4DOUA 3LA2A 5ABJA 1W2TA 4CDWA 1JOPA 4V2VA 4Y22A 5FYBA 4KWKA 3ZXAC 2ZEYA 5E88A 2ZEWA 1QQP1 2GC1A 4JX0A 5EP9A 4UAPA 3IWZA 4BLJA 1W6PB 2YC2A 3LEKA 4UW3A 3WT3A 3WNOA 3PNAA 2AACA 4YW1A 5FKBA 1KQRA 5AC92 3LDRA 1ENSA 1GICA 1CX1A 3ROUA 1YNAA 2WFF3 2W91A 3BN6A 3B01A 4AFBA 2GNMA 3WNLA 1JW6A 3CIHA 1DFQA 3EO6A 3KLSA 1GLHA 4LO4B 5FV3A 4FFFA 2PELA 1UAIA 3IDBB 4K20A 1HQNA 4XDOA 5FZKA 1YHFA 4GIQA 1CD3G 3VBRA 5C8CB 3JBG1 4HKLA 4LOTA 4LR4A 1V9U2 2Y6LA 3AMMA 2WNUC 3BTAA 1GV9A 3CL1A 4XUTA 1LOFC 3HMYA 5AVPA 5GLWA 4AHYA 2XH6A 3DGTA 2Q5TA 5FYTA 3W5NA 1BLZA 1G7YA 4H2AA 4IEOA 4Q27A 5FYHA 4WM7B 4PI0A 1JZ5A 1COV3 4KU8A 1EUTA 1I5ZA 4YGCA 1YYNA 1Q8QA 4YW7A 1FV2A 3KT7A 2JIJA 4IV3B 1H2LA 2Y6HA 2Y33A 3LAGA 1CGPA 4KQ7A 4WV8A 4OZOA 4O65A 5I0DA 2HEVF 2Q4SA 2OT7A 2QQVA 2K0GA 3Q8EA 1RUJ1 1CIYA 2FD8A 2G1MA 4I30A 4AVBA 1B35C 1J59A 2RM22 4QQPA 3WVJA 2JXAA 1W3XA 4FPEA 2XL7A 2I07B 4AK3A 2E33A 2YB7A 4MXWA 3T2TA 4AZZA 1CQ9A 2O8OA 2DTWA 1NY72 4KH9A 2GH8A 1RJ8A 2W46A 3K75B 1AX0A 1Q5OA 1N3QA 2W9XA 4ITCA 4JGYC 5LCWL 1X8MA 1AL21 3AMNA 3BALA 4LTAA 5DZFA 3MBWA 2GC2A 2HJIA 4K3UA 3H3ZA 5FZOA 3D0SA 1ENRA 1MS9A 2R061 4QX8A 3UGFA 2R041 1EV12 3THTA 5KXDA 4W6WA 1RL3A 4QHBA 3W59A 1GP6A 2E7AA 1S0CA 3V0AA 1G9DA 2RMU2 4G4FA 3O1MA 2B5HA 2VMIA 3CKHA 4NIIA 3ZVXA 1QJEA 3MZHA 1RB8G 1GZWA 1NA1A 3RI8A 4GZ9A 5SV8A 2UWCA 4NHYA 3RQ0A 4QU2A 4M4RA 5FXWA 4C0HA 4YVSC 1E5RA 1GWLA 1PNFA 1ZBE1 1PK6A 4DUWA 2XLFA 4LBOA 1PGL2 3UJOA 3VBSA 3IZOA 2ADEA 3NKTA 2JG9C 2DFCA 2YC0A 2HWD1 1H8VA 1AR92 2I45A 1GANA 1QXJA 4XF0A 3THPA 4CP9B 4I0WB 4OI1A 1QJY3 1JZ2A 5IHRA 1RGSA 4UFKA 3IKWA 5DUVA 1PGW1 1O59A 5FZ3A 1AJOA 2E9QA 2VE1A 1HRI3 3ZFFC 1DYKA 5JR2A 1HV1A 4MGZE 3IM0A 1Y7BA 1NCRC 4YM1A 4CCCA 5IATA 4KNCA 4EROA 2VXRA 3MW3A 5DUXA 5FYSA 3FBYA 1KS5A 3OD4A 4CXXA 4QHOA 1I9RA 3S5QA 3CDZB 5LATA 1PO21 4Y1XA 1TEIA 2JDAA 3S6PA 5EZWA 2CNAA 3MHZA 3DYPA 4CCOA 1QXRA 3I59A 4Q4W3 5JSPA 1VBB3 1ASJ2 5I8SA 3S30A 2BDRA 2D97A 4DPNA 1LHUA 3KF5A 3WNMA 1YWKA 3R05A 1YC61 4RQPB 3VBFA 1MS0A 4UFHA 4Y5Z0 1U12A 3VDCA 1RMU2 4XACA 3VZMA 1DYPA 4XFAA 4FBFA 2WZEA 4PF1A 1D4VB 4FPOB 4HPKA 3I4IA 5H9RA 1W9YA 4G3YC 2XONA 2YUEA 1J1LA 3OYWB 3EB7A 4LEJA 1GU3A 2DUQA 1S0BA 2GMPA 4HN0A 3DN7A 3KHCA 2CHHA 5GLTA 1C5HA 5FO7B 3OEAA 1NCQC 5FUPA 3J7NA 5ANNA 5EJ1B 3NSTA 5FYUA 4LULA 3WG2A 2ZX3A 1RUE1 1OA3A 3MGUA 3FLRA 1APNA 4W6YA 4AVSA 4DXRA 2PTMA 3VKOA 1GZTA 5FZ0A 3J8F3 4DZGA 5CAZA 1RUI3 2E53A 4RGAA 2R071 4CA9A 2WZPP 1NOVA 3DL3A 5DDJ1 2J7MA 3H1MA 2QUOA 1IG0A 2W1UA 2WZR1 1UX6A 5J7MA 2R49A 1XNBA 3FWEA 5EQUA 1UXXX 3O1PA 3RZJA 3N35A 5FCCA 2VVEA 1G86A 1W6NB 1W9TA 1R1A2 1RYYA 2J1VA 2MEV3 2WRAA 4PLOA 2DVGA 4P9XA 3CZUA 1HW5A 1WCQA 4H7LA 4TZDA 2RJLA 4NIDA 1H1MA 3AP7A 4Q4V1 5GZGA 3IMMA 3KCYA 4QAWA 4ZY9A 1J83A 1QQP3 4N7IA 5JZGB 4PIZA 2Y64A 2Z42A 4EWDA 5E8AA 5T5JA 2O8QA 1YJLA 2NMNA 4PBOA 3SC7X 2RS31 1S0DA 1Y9QA 1XNTA 2C5DA 2W94A 3UK9A 1UZWA 2ID4A 3ZXGA 5BNNB 2FDKA 4HG6B 1KJRA 2PYTA 3VZKA 4AVAA 4BK4A 1WW4A 3DKQA 3AYCA 4LO6B 2PHUA 1PGSA 3ZXJA 4UBHA 5E89A 4OZXA 4EJRA 1UKGA 3JBG3 3AZYA 3MLLA 4IGPA 4AAPA 1JZ6A 2WFF2 4QXCA 1W8HA 2VW2A 4CDXA 5C4WC 2ZGTA 5C71A 4EN9B 5DAVA 1ZRFA 5C3RA 2IXKA 2B7YA 2UWAA 4A3XA 1UXZA 1XYOA 2YROA 4ASLA 1WMFA 4DEQA 1OFSA 5A3UA 2R0FA 2OYZA 2ZJCA 3AFGA 2PHTA 1ZRDA 4PDWA 3H50A 3ZMNA 4ZS3A 3VL9A 2YHJA 1UQXA 3MW4A 1W6QA 5BNOB 2DYCA 2P3YA 3M8LA 1OUSA 2TUNA 5BNPA 1AXZA 1COV2 2ZOEB 1RUJ3 3FN9A 3ECQA 4Q4X1 1LECA 2VTXJ 1Y9GA 2AC1A 1ZBA1 4QMAA 3S0MA 5GZEA 2VZ3A 4IESA 2XBO1 5APAA 4JGZB 4CU6A 3HWJA 5DZEA 4LHLA 2WKKA 3P3NA 3R4SA 4EWEA 1F8VA 2CTVA 2PLV2 5A32B 3WG1A 4QPYA 1VIWB 3H9AA 3OF1A 4XHBA 3WP4A 1K3IA 2AH2A 4XTPA 2Y38A 3F2ZA 1CVNA 1W6PA 3SKJE 3WF1A 1JZ7A 3BTXA 1AL23 1LEDA 4GMP1 4A45A 4NO4A 2JB4A 1G6NA 4BXFA 1DGRA 1NAEA 2FBEA 4UXAA 2HWB1 1QHDA 2JECA 3NV1A 1ZRIA 4Z8BA 2Q8OA 2R063 4FI9A 2V09A 2R043 4MYEA 4P14A 5K7PA 5L7OB 4Y4YA 5A3OA 4IE6A 4CUAA 5CIRA 3UNPA 3VD9A 4Q0VA 5FBZA 1YI9A 5C8CA 3ACIA 3ZSJA 2O14A 2P6CA 2WSUA 2QQMA 4A7YA 2DV9A 5HXVA 4OUMA 3W20A 4R52A 2Y60A 4QX2A 1ZBE3 4ISRA 2P5BA 5KHKA 4Y33A 3WHUA 5A7OA 3UYJA 1V0AA 1DCSA 1FXZA 5LWBA 2WT1A 5A3LA 2HWD3 3T09A 1QDCA 4IV3A 2E6VA 1JH5A 1PX3A 4A7ZA 3TEWA 4EN7B 1W6MA 4LKDA 1JZ8A 1GUIA 2BP6A 2VVFA 5FYMA 1Q43A 2IZWA 1AXKA 3ZR5A 1UF2C 3TWIA 4P9WA 3IDAA 5T54A 4B3NA 5H9SA 5ACA2 1O4ZA 1EP0A 1GP5A 2FHRA 4COVA 1R091 4I3PA 3D8CA 1CJDA 4ZXKA 3BYWA 3M4FA 5KC6A 2A7AA 2AGSA 1QJY2 2C4XA 4CDUB 2RJ2A 3M3EA 2FDGA 2RE9A 1QJZA 2WT2A 5FMCA 1PO23 1OQDA 5I0UA 4IEPA 2GDFA 2QVSB 3TEXA 2JD9A 3ZSMA 2QQLA 5JPMB 2WO7A 5L19A 3LKJA 2RDQA 5I0TA 3VD3A 2JG8C 3UKVA 2X29A 2ZEZA 3QH6A 4FXGB 1QF3A 2JE8A 4OHXA 4FT8A 1MS1A 1UL9A 3ZFGC 4DRVA 3FJSA 4FPKA 1UPSA 4A4AA 1Y9MA 4Q4W2 1ZZ8A 3ZKYA 3DYOA 1RUOA 1QEXA 1MZ6A 1VBB2 2D44A 4UW6A 3OBRA 5FLIA 1N1TA 4YARA 1SFPA 3BTZA 1H8TC 3KS7A 2ZABA 3KV4A 3H3LA 5CKQA 5CB7A 4JKMA 3QCWA 4KWJA 2PXJA 1XOYA 1JHNA 1BHGA 4W50A 4DXZA 4Z1VA 1OVSA 1RUE3 4CP9A 2G9FA 1FOD1 1L3JA 5A80A 2X5IC 4WM8B 4QQLA 2A6VA 2B4KA 4CPBA 2YU1A 3AJZA 1W8TA 3RI9A 2G9ZA 5F8PA 5BUVA 5FXXA 3TNQA 2R073 2IXHA 3PUAA 2ZTNA 5DDJ3 4MGKE 5FXVA 2WZR3 3WDWA 1JYWA 4IW3A 4BU2A 2WLPA 3J8F2 2CGPA 1RUI2 3NV2A 3I7DA 4HOOA 1JYCA 5IK4A 3RZLA 3WXPA 2R1DA 2MPFA 2GC3A 1DDLA 4Q4V3 1LHVA 3OG2A 1SLIA 4LXLA 4OMDA 2WO1A 1QXPA 2QQJA 4MO3M 4U2AA 5FPAA 4UFLA 4XHXA 3K77A 1GOHA 2O1QA 5I93A 4RQPA 3VHOA 4CDQB 4DINB 2MEV2 5T5PA 2BJSA 1QOOA 1US2A 2RS33 2XWJB 2HKXA 5A7PA 2PQQA 3VGIA 1RXFA 2A70A 2W1SA 2Y8KA 3WF2A 1QQP2 2UYBA 3POBA 3OYWA 5FZDA 2VCAA 3BGAA 5F39A 1VRH1 5EJZB 3VBOA 1XE0A 5LB6A 1N1SA 3CJIB 5A6XA 4MV2A 1O8SA 2VZOA 4GULA 1YIFA 3E6BA 2NQYA 2WL1A 3JB8A 1WKYA 2TBVA 4JDNA 2ZX1A 5FZFA 2E7TA 1O7FA 3OOXA 2W1QA 1C8M1 4FPCA 3DPRC 3AM2A 1OURA 5FIXA 1QJFA 2EXHA 3JBG2 2XVKA 4NRQA 1AJKA 1MS4A 1VE0A 3MYXA 4CSWA 2EAKA 3U4SA 3THDA 1W8OA 4B7KA 1BXHA 5F3IA 5FPLA 5ERLA 1TNRA 1H1AA 5C9AA 5JXJA 3ZSEA 4FFIA 4Q4X3 3O1SA 1O3QA 2VECA 2XB6C 1ZBA3 2XR4A 4P5HA 5FOJB 2XBO3 1MEC1 1S1AA 3OPWA 2BVBA 4UF0B 2A3YA 5I0RA 2RV9A 1W6NA 4LBLA 5IVEA 2BV4A 1OD3A 4FOYA 4OYUA 2W39A 4NOTA 3APBA 1DG6A 3ACHA 3I3EA 4AQTA 2WNVB 2VZ1A 3TB0A 1RUJ2 2A75A 4BE3A 2GMEA 2IXJA 4NPMA 1ZA4A 3ZYFA 5JZGA 4GMP3 1VJ2A 3RZKA 4OVEA 4N9HA 4Q1PA 4MXWB 2XJSA 1X9TA 1F31A 2ZAHA 4A7KA 2HWB3 4BPZA 3C3VA 4M3CF 5BNNA 4IXLA 2D3PA 4XJZA 3O1VA 4LLFA 5KXEA 5CYYA 1AL22 2JE7A 4QPWA 4AFCA 1TE1B 2VBBA 4W4ZA 1NXD1 4L2NA 5FFOC 1WCDJ 2J22A 2VY0A 3T2OA 2YU2A 4QQHA 3E6CC 2TNFA 1S0FA 2AUYA 2R062 2ZGMA 2CL2A 5IAVA 1DBNA 4LBQA 3WDUA 5J48A 3VDAA 4BQ3A 2WNUB 3VHRA 2CGOA 1D4M1 3AVRA 4S2HA 2VMDA 4CZSA 3LFIA 5B2GB 1RXGA 4I01A 4KI5M 3KHBA 4N53C 5HV4A 1EUUA 1UMHA 3NRUA 2WWSA 5KR7A 2R16A 2PQSA 3N7LA 3HAGA 3O1RA 4UWDA 1ZBE2 4QGMA 2XHNA 5BNOA 2VZRA 1YI7A 3AK0A 3E97A 3UL2A 1PX4A 1N47A 1AL0G 2DF7A 3EBRA 3MUY1 5CU1A 4D8MA 2HWD2 1R093 3FUOA 3MV01 3GYDA 4NPRA 4JGZA 1W8NA 2Y0IA 3B7MA 2YC4A 3FUQA 3QOPA 1HXS1 3ES4A 4FVVA 3KSCA 3GZEA 5FQ0B 1B35B 2YFZA 4B8EA 2PLV1 5A32A 1PIV1 5LA0A 2DFBA 5I0SA 1JOJA 2XHKA 3T0AA 4RYDA 3GBWA 1C28A 3RRDA 1XU2A 2WINB 4XVHA 1DLCA 1F4AA 3IDEA 3MIDA 1HLCA 4QXBA 5J3UA 3W5MA 4OCTA 3UKTA 5JAXA 5FZIA 2VCCA 3THCA 1SBFA 2OIIA 2RR11 1R081 5LW9A 4KMQA 5FY9A 5L9RA 2K2SA 2GU9A 1ODMA 1LOGA 3H1WA 2VOTA 3LZZA 1OA4A 3T2QA 3BKZA 3SLIA 3ETQA 2UY8A 1AX2A 1UX7A 5FZLA 3ZFEC 1H9PA 1A6CA 1GOFA 2VOWA 3P1IA 3CU7A 2QDRA 2XUMA 4TLGA 5CISA 1LOBA 1OC1A 1F9KA 3I49A 4BXSV 5GJ6A 1J3QA 2VMFA 5I8TA 3WG3A 1NKGA 3EXUA 1REDA 2LROA 4YVSB 3UESA 1LHWA 2YFUA 4MGIE 2EVXA 2WAOA 5T52A 3ZMOA 1FOD3 1CWPA 2G9GA 2A71A 1OQ1A 3FMGA 1IS3A 2XJTA 4B4QA 3ZOIA 2V5YA 1LENA 1N1VA 2VC9A 1VR3A 2B9UA 4R8HA 3RFRA 3N9PA 1GWMA 4B7EA 3N3HA 1WD3A 5ACA1 3BOWA 2VMGA 1UIKA 4FQZA 1D2SA 1H4HA 1V6JA 1RUE2 3U11A 4Y20B 1JBCA 1J1TA 5LA2A 5LZ6A 1ZRCA 3O12A 4SBVA 4YZ4A 2HBTA 4UI9L 4CDUA 4AHWA 1UY3A 1NCRB 3SNMA 4FFGA 1BEV1 1AYM1 4IEXA 1KJLA 2R072 2WSVA 3MIFA 1IS6A 5DDJ2 2XKOA 2Y6KA 4K8FA 2WZR2 1DQ6A 2VTFA 1S55A 3HOBA 1MS8A 1I1EA 3USSA 4CE8A 1L7QA 1QH7A 3SMHA 2Y6JA 1OLME 1CESA 5C6CA 3WQBA 5A7NA 3RZGA 4GAZA 4URTA 2BNOA 1CZSA 2SBAA 1OUXA 4Q4V2 3ZYJB 1CN1A 5FYZA 5F3CA 2Y34A 3ZYPA 3FC0A 4FOQA 3BIEA 4XURA 1BCXA 1VRH3 1KS4A 2RS32 3DXTA 2D6PA 3BI3A 2XJRA 3ZIWA 5FZ4A 5JMCA 4CXYA 1AX1A 1GQGA 4OI0A 1YRZA 3HQXA 5FBJA 2DURA 1PM4A 1UU5A 1C8M3 1W8ZA 1WWYA 3QH7A 4WM8A 4YG0A 1NCQB 3U75A 2RDNA 4O9EA 2YGLA 1OOPC 4RFRB 4P5YA 4FOWA 5DUWA 3QACA 3W58A 3RZHA 1HQWA 3K4DA 4BQ1A 3POJA 1VMJA 1LOEA 1U5ZA 2ADDA 4H14A 2VG9A 1J3RA 3KVAA 2J1UA 4WVWA 1LULA 4BWOA 4Q0PA 2AYHA 2GMMA 1BJQA 1MEC3 4M3CB 4BDVB 1F5FA 1LESA 1LTEA 3GCWA 3IT8A 5CFDC 3L2YA 4B4PA 4BH9A 2O0OA 3LDBA 1POV1 1R64A 2CDPA 4XFCA 5FRAA 4EYUA 1W8FA 4MSVA 1H9WA 3IAPA 3VB9A 4BQ5A 2X09A 4Q4X2 3SKVA 4QKBA 3POIA 1ZBA2 3PMEA 3MV11 2XBO2 4IERA 4M0HA 2FQPA 4CDQA 4Q8LA 2J1EA 1OPMA 1VALA 3LEIA 3KV5A 5BYNA 3ZXEA 5C33A 4NHXA 4AYUA 2JIGA 2XLAA 4XC9A 2X53S 1KGYA 5C3OA 1RUNA 4ET7A 3LSDA 4PI2A 1XNCA 3HIFA 1CAWA 4Z82A 3H8UA 4DEVA 4AI3A 1OD5A 2GP3A 5C5TA 4JV4A 3CJIA 4AQ6A 4HSLA 4YFZA 2HWB2 3D6EA 2W95A 3H3UA 3IN9A 1RTVA 3INAA 4BMBA 1FX5A 3SCHA 4A42A 4ARXA 4M3CE 5EYXA 2XLGA 2CWMA 1RC6A 3ACGA 3SH5A 1WLWA 1D4M3 2R7EB 5C4WB 2ET1A 3IAQA 4BQ4A 1GZCA 4ES8A 4AQ2A 2IVJA 2K9ZA 3JQXA 4FPHA 2RG4A 5D8AC 2CY6A 4I3GA 1MR5A 3MPPG 2Y26A 3VV1A 2GZWA 4B4RA 1CPMA 1CAXB 1PM7A 3AKRA 3C7FA 4QX5A 3ENRA 4RD7A 1NE4A 1MVEA 1NE6A 4HL0A 4JAAA 4UF0A 1GNZA 1GMMA 1C5IA 1W6MB 1HXS3 1GZ9A 4FPFA 3GZAA 1S2BA 1H4GA 1WA6X 1DQ2A 2QBXA 5F2WA 1ULDA 2PLV3 3KCXA 1PIV3 5C3SA 4RR3C 4GWIA 2WNVA 5CVRA 4Q4Y1 1GP4A 5KXCA 4I02A 4JHZA 4XQWA 3Q8AA 4RS5C 1R092 1BBT1 4MGSA 3KF3A 2WQ8A 4LKEA 4XQDA 3RGBA 3LOIA 2DWRA 5DUUA 5J1XA 1F15A 2ZEXA 3GXUA 2RR13 1R083 4Y1VA 4IL7A 1YQ5A 1ND3B 3ZYRA 1LAJA 4YW2A 4MLOA 2JWPA 1XB9A 3AZZA 4P9GA 4YSFA 1SCRA 4F83A 4BQYA 1FPN1 4FQ4A 1SFYA 1VBD1 2GNDA 2JKBA 4ORFA 4AQSA 5A7WA 4XBNA 2WLQA 1XSQA 3FL7A 3WQ0A 3BCWA 4B1LA 5FKCA 2AEYA 1REEA 1DHKB 2DDUA 4O9GA 4P02B 1X82A 1NQDA 1QH6A 2UU8A 2WNUA 2FZ2A 1LOFA 2LUWA 5FYVA 4DY3A 1MS3A 4L11A 2VTXA 4R4XA 4D6QA 1L7RA 5FPUA 2BBAA 1H2MA 3AKQA 4NRMA 4E4SA 3WDTA 2ETEA 3POEA 4AEJA 3Q9OA 1C8NA 3N9NA 3SISA 1UU4A 1DGWA 4CEYC 1VAKA 3GHMA 3C7HA 3BVCA 3OBTA 4H3WA 3PU3A 5ACA3 5J98B 3T3YA 1ULFA 5FXZA 4UFMA 3ZXFA 4IV1C 3FFZA 4CP1A 2YV8A 5A70A 1FOD2 4QHZA 4XDQA 4EN0A 5FQ0A 2F4PA 2WS91 1B35A 4EQVA 4RHV1 4X8NA 2JDZA 2YBSA 1XJAA 3ZIXA 1BEV3 1AYM3 3KM5A 4G9SB 1IPSA 5EWSA 2ZACA 3WCSA 3B94A 3A23A 2FCTA 1GOGA 3SQOA 3SH3A 1ULGA 2D40A 4MGTA 2PHWA 4OHWA 3VBHC 4AEDC 3A7QA 1EY2A 2ZZQA 5J36A 3CO2A 2VMHA 1XPWA 4JGYA 4HMZA 4GH4C 2W5FA 4Y3OA 2Z2SB 5IWFA 4IETA 2LS6A 2PHFA 4YM2A 1H1IA 1W2AX 5A1FA 5KWRA 2JG8B 4OFGA 1W99A 4LOSA 3PDQA 2C24A 1LOAA 1XE8A 2BERA 3TN91 3M3CA 1BZWA 3Q8CA 2PHLA 3ZFGB 3I54A 1YO8A 4BQXA 3L2HA 1LGCA 2A6ZA 4JDOA 3LA3A 4H7MA 4M0NA 4JC1A 4WVMB 5FAXA 5FZ8A 3OGSA 4ZU4A 5T5OA 4YW6A 5JR7B 1LU2A 4LE3A 2ZGQA 5LBBA 2BYVE 4YVSA 1H8TB 1OLMA 3DUIA 3WDVA 5A6ZA 5L73A 1URXA 2MHFA 5M0TA 2WAAA 1WCUA 2D6LX 4ATEA 3ALQA 1VRH2 3AVSA 1PNGA 3VBOB 2GNTA 1AXYA 1R1ZA 2H6CA 1GFF2 1IS4A 3EJKA 3GGLA 1YQ2A 5BPXA 3NWKA 3R6SA 1UCXA 1W3VA 2XJUA 3QBQA 3KMHA 3PUQA 4YGDA 4Y20A 1O6UA 2EXJA 1C8M2 2ZX2A 3A22A 3S7IA 1E5IA 3RWKX 3RYKA 2VGDA 1NCRA 2ZGKA 5GM0A 4EZ4A 5IFPA 3WF0A 5FP3A 2HEYF 5LY2A 1DZQA 4PQQA
chains in the Genus database with same CATH topology
1POV3 2D93A 4GWMA 2Q0AA 1VAMA 4RGGA 5F6KA 3WZ1A 5C9AB 1V6LA 2QNKA 3U10A 3WCRA 5H9PA 1TNFA 1SBDA 5IK7A 1MEC2 1SDWA 1Z0HA 4M00A 2DVDA 2XL9A 1ND2C 1HQLA 4GB31 1QY4A 1CONA 3AZWA 1ENQA 5F9TA 4BIFA 4AHZA 1Q8OA 2D7FA 3ZN4A 2W08A 4AG4A 4PJYA 5KXBA 3V0BB 1HKDA 3VUOA 1RUC1 2JEMA 4A2UA 4XMIA 2VPVA 3JD71 4S2GA 1V70A 1M4WA 3AP4A 3JQWA 1H2KA 1VB4A 1NCQA 3TNPB 4K7JA 1PHMA 1Q3EA 4RL7A 1DQ0A 3OGJA 1ZRRA 4LO8A 2BWCA 3J9SA 4LBQB 2R0HA 3PVNA 1C1LA 4QPGC 3TAYA 1D4M2 1UN1A 3TBDA 4YVWC 3SCFA 4LA2A 3ZDSA 4M3CA 3G6JB 4JTNA 3OTFA 3RYRA 5HCFA 5KBFA 4P9JA 4YRDA 4P9IA 5LRRA 3RZZA 3VZNA 1S0EA 4IEWA 4HETA 3T1LA 2B46X 3JUUA 3RG0A 4Q4Y3 4FPJA 3WLUA 5FO9B 4J1XA 3PVOA 1BBT3 4FCAA 4N43C 4QPIC 2FMYA 4QQOA 1ULCA 4R9AA 1HXS2 5GLUA 2B39A 1RINA 3JZVA 1VBE1 3T1MA 4BZ4A 1XXNA 1PIV2 2TEPA 4WM7C 2VOKA 4FOVA 2XJVA 1V6MA 2XWBB 4Q2FA 1G9CA 2LALA 1FPN3 4E2QA 3POWA 1BVVA 1VBD3 1OQEA 5FPZA 2RR12 1R082 5FTTC 4PIXA 2D6OX 5DG1A 1REFA 4XXPA 1UIJA 3WINE 1O91A 3AYEA 4C0BA 5C4WA 2OZJA 3RJ2X 3B3QE 3RNSA 3AP9A 2RS51 4NWWA 1VB2A 4GKYA 2ZHLA 1AVBA 1EPZA 2ATFA 4AI0A 4N53B 3VHPA 1CAXA 4ZU5A 3SCGA 3U0ZA 4YZ2A 1AYN2 1TQ5A 1ZZ6A 2EALA 3MDPA 5HI0A 1C3HA 3GF6A 5K9YA 1S0GA 1K5MC 3M2MA 2WS93 1UD1A 1GR3A 1E57A 4RHV3 4XFHA 3A0NA 4GQ7A 1RUG1 1PO11 1QGLA 3AXEA 2BUKA 3TOJA 2XVLA 4XJAA 2AZ5A 1A8DA 3MLKA 3AMPA 4ZU7A 1MQTC 1OLRA 2BNNA 1H2NA 1BEV2 1AYM2 1WLCA 1ND3A 3VDDC 4Y1YA 5JOXA 4E9KA 2IC1A 3H0OA 3IBMA 1MZFA 4MH0E 4OI2A 3CLPA 2ZX4A 5KHIA 3IDCB 2A73B 2Q1ZB 2VNRA 3B5LB 3ZYIB 2PAKA 2DVAA 3MF9A 2PHRA 1LCLA 1GSLA 3ZO0B 3SH4A 1D2QA 3VL8A 3B69A 3BIWE 4YZ5A 2VQ0A 2Z69A 3B9CA 3UV9A 4EN6B 3KD4A 1HX6A 4KWLA 1PVC1 4C91A 1V00A 1F5JA 3MLJA 4XPVA 2B45X 2C1FA 1SCSA 1MS5A 3L9JT 2DUPA 2P3KA 3WP3A 4XF4A 5BY5A 2HYKA 4HN1A 4F8AA 1OHFA 1VLNA 4FP2A 3ZPYA 2D3SA 1AR81 4LHNA 4YLZA 3RSJA 4AI2A 2A6XA 4CTEA 4AVCA 1DZTA 2BW8A 3IPVA 3LSEA 4E2GA 4XILA 1RUF1 2D5HA 2JG8A 2YYOA 4GMP0 4GB33 1DF0A 1DGLA 2VOVA 4LNVA 3O7OA 1YIPA 3DKWA 3UKNA 5K0UC 2ET7A 4Q0UA 3ZFGA 4L97A 1KITA 1X7NA 4JRAA 4WVMA 1S0IA 1KDKA 1MACA 4XJ9A 1X50A 3E6DA 1LODA 2WT0A 4YFWA 1RUC3 5J09A 4I2OA 2N7GA 1H8TA 3JD73 2IWGB 3AYAA 4LO5B 5FLHA 1CAWB 4C1WA 1JXNA 2YMZA 2ARXA 2ZGPA 5JCTA 1J3PA 2X5IA 2RJKA 4PIYA 3B00A 1OOPB 2IFWA 3AP5A 4AI1A 2HWE1 1EYBA 2W0XA 2YY1A 4IEYA 3VBUC 2C9AA 4ASMB 3EQEA 1YFUA 1RUH1 1WBLA 3ST7A 1BKZA 1HRV1 5CFDB 2CGNA 4HLTA 2IXLA 1H30A 2GN3A 3HN1A 3GBGA 4J6GA 5C8WA 1AUYA 2ZS6B 1VBE3 3WDXA 2ZX0A 1GNHA 3D82A 4Q4Y2 4N90A 4OI4A 4XTMA 2PFWA 3NV3A 1BBT2 1XNDA 3ZSLA 5A3MA 3V0BA 4Q0SA 5AFEA 3OJBA 2IFRA 1RITA 1FATA 4JRLA 4BHPA 4C90A 1RJ7A 3VKLA 2H0VA 1QKQA 1WLTA 5CFCC 4XF1A 4XW3A 1FPN2 3HBZA 4JGZC 1VBD2 2RS53 1LEMA 2ZHMA 3H7JA 1BMV2 3R0RA 4Q29A 3DPRA 4UBGA 3TYJA 1UPIA 3CNAA 1FMD1 5JOYA 1HIXA 4CYDA 5D8AB 4K21A 4E4ZA 3MIGA 4LLOA 1LR5A 4P9LA 2DCTA 3SXWA 1RUG3 5L7OC 1AR72 1PO13 2GH2A 2H0BA 2ZGLA 5I91A 3VZOA 5CNAA 4RR3B 4XJWA 4CP2A 5IK5A 2ZPXA 1ZZBA 4HT1T 4XBLA 1U5IA 2WS92 4RS5B 4RHV2 2WIIB 1G9AA 5LEKA 5LK5A 2BFUS 1XE7A 2ZKLA 3FBMA 1W6OB 4IQPA 1WMDA 4JGYB 2GN7A 3H1YA 3QD6A 5GLVA 1O3SA 4E27A 1MZEA 3TN92 3VKNA 5GKAC 3ZXKA 4DY5A 2VW1A 4NHMA 5GALA 5DXDA 1N3OA 1I6XA 4N53A 3WV6A 1Z7S1 1ZNPA 3PHMA 4LHKA 4XE9A 3WR0A 1OSGA 1AYN1 2UY9A 3E5XA 1WA4A 1PVC3 4CEYB 2UURA 3MPBA 4RFT0 5JIUA 1GKBA 2JG9B 3N36A 5FDBA 1LJ7A 4IV1B 3G7DA 2R1BA 4CEWC 3RWNA 2WFPA 2ZBJA 2GNBA 2ZZJA 2DUOA 3NAPC 1AR83 3ZFFB 1NZCA 3RYPA 4FSJA 3P3PA 1DQ5A 1CIWA 3ILNA 2NN8A 1OMIA 3VBHB 1RUF3 2CYFA 1CR7A 4AEDB 1NLRA 2YGMA 4YW4A 4GH4B 1XQNA 3AKPA 3OD0A 1XNKA 5CADA 1WMEA 1FV3A 2VW0A 2X8KA 4YNIA 5JVVA 4AXOA 4P9YA 4GB32 2GAUA 3ZXLA 4HK8A 1I3HA 4HZFA 4MGYE 4ZKTB 1LHOA 1EPWA 2D6KA 1DLLA 1JTZX 3JCIA 4FAGA 4AWDA 2P3IA 3PTYA 4WZCA 1V6NA 4S2FA 2OA2A 4NR1A 1AF9A 1RUC2 3BB6A 5FLJA 3JD72 4HKOA 4MVTA 3AX4A 1AHSA 2HWE3 4HKWA 5KC5A 2JENA 3OCPA 5HBAA 5ABJC 1RUH3 4CDWC 1HRV3 1IKPA 1VBA1 1WW7A 2BEOA 4U36A 1UZZA 1C1FA 1DQ1A 4YZ3A 5JOZA 1G9BA 3CJIC 1O5UA 1TMF1 2CWSA 1C4RA 2I2SA 4QD2A 3M70A 2ZMNA 2Z5WA 4XFGA 1ND2B 1U0AA 5FMOL 2A5ZA 3WP6A 1JUIA 1SLCA 2GSYA 4L99A 5AFBA 3VBRC 4AE2A 5LEJA 4YGBA 5BV6A 1IHMA 1CAVB 1VBE2 3WUCA 4PF5A 2CV6A 1V6IA 4B29A 5I8YA 4INDA 5JLVA 3AZXA 1KD7A 4NN0A 1IOAA 5CA6A 4YW3A 1CPNA 2BNMA 3JB4C 4L8QA 4Y24A 2BWAA 4LT5A 1OOPA 5D1IA 1FMD3 4MZUA 4YG3A 3V64A 4XFFA 2XPJA 5J37A 2P37A 2RS52 4QPGB 4D94A 4YVWB 2QE3A 2P3JA 3LB9A 3PMSA 4EWAA 2QZ2A 5CFDA 1YFXA 2PN5A 1XYNA 4SLIA 2SLIA 4AVVA 4R9CA 1WLDA 3KGLA 2XVGA 3X29B 3ELNA 4QPIB 4N43B 1A3KA 1RUG2 1PO12 1SLAA 1X33A 1RHI2 1PZ7A 4D7TA 3CJXA 3O14A 2Q30A 2VUAA 1NA1C 1Q8PA 1QDOA 3POYA 1ONAA 4UW4A 1HV0A 3ILFA 3MF6A 4XIKA 1PK6C 1MVQA 1C57A 1ZVFA 3VBSC 3VZJA 1Y43B 4YGEA 1XYPA 4WBBA 1BMV1 1SFNA 3RS6A 4FPYA 1SACA 1Z78A 4XETA 2QJVA 4HANA 3RDIA 1Z7S3 5HCAA 3FE5A 4Y26A 3A4UA 3RMXA 5D8AA 2ZHNA 1AYN3 4XFBA 3WD5A 3ACLA 3ATGA 3URFA 5FOBB 1VP6A 3WP5A 1QJX1 1O5LA 3OGGA 3RJRA 1QJU1 1AR71 5KHHA 1PMIA 5T50A 4KG8A 1J58A 1K5MB 4Z07A 4ES9A 1PVC2 3AB0A 1POV0 4RR3A 3B02A 4XF9A 1EAH1 5JI9A 4RS5A 3AZVA 3VBFC 4AFDA 1A78A 3IIAA 3C2UA 3ME2A 3WHTA 1MQTB 5EXOA 4LBNA 3O0XA 1W6OA 1W39A 5E16A 1AR82 1S0JA 4KL1A 2OUHA 4MXVA 5SV5A 3VDDB 3KT1A 2P34A 3IPVB 3MFAA 4QGNA 1YCIA 1RUF2 2DU1A 3PLQA 5J96B 1ZZ7A 3FLPA 4K1ZA 2VVDA 4W6XA 4AFAA 1NQJA 2VNOA 4FP3A 1OLQA 4CRQA 2D43A 1JYIA 2LM3A 5CG9A 4X6QB 4BOWA 3NW4A 4FAHA 3USUB 2OPKA 3R4DB 1WGPA 1SQ4A 4ONUA 4CEYA 3U4XA 4FTEA 3U07A 3NO8A 2V73A 4KGQA 4AGGA 4EV0A 2JG9A 3CEWA 2OUJA 4IV1A 3J4UH 3MW2A 2X5IB 4I0BA 1IPKA 3N4MA 1VBA3 2D6NA 4FTSA 2VQAA 3ZFFA 1YFYA 2HWE2 2ZGNA 1U5YA 3VBHA 4X6RB 4AEDA 4XIOA 3AMQA 1A8MA 1RUH2 1TMF3 1JUHA 4HVRA 4GH4A 1O3TA 1ZZCA 1HRV2 1BK1A 2ZGOA 4JDMA 4XMAA 2YXSA 2EA7A 3WX5A 3J26N 5K0UB 4CDXC 1QNWA 3UJQA 5JWPA 2HWC1 2QQPA 1N1YA 5JOWA 5A33B 1VBC1 2ENRA 1TME1 4WVVA 5CG8A 4Y1ZA 2RS11 4DMIA 4PDWC 4R9BA 4NHKA 1Q56A 1FNZA 1RVF1 4D7YA 4IEVA 3SITA 2VU9A 5BNPC 2UYAA 3AJYA 2IXCA 3FLTA 4K1YA 2QCSB 2QKDA 4NWVA 4OUSA 1KFUL 2EF6A 4WZFA 2EIGA 3DPRB 3BOPA 4NHLA 4BYYA 3VBUB 1AR61 1FMD2 3O0WA 2NMOA 3M7AA 2NPIA 4FTBA 1IZ3A 1SLBA 1LKNA 2W68A 5GLZA 1BVP1 3IMNA 4K9SA 1Y3TA 4Z92B 1UZYA 1NYWA 1NXMA 4KG0A 1UU6A 2W52A 3DV8A 4H55A 2PHXA 1KXGA 1ND2A 1X36A 3AMHA 3GALA 4XJ8A 1GYKA 1RUD1 1DU3D 3MEPA 3OPZA 3VHNA 2A3XA 5C8CC 4EN8B 4LBMA 1CAVA 1ULEA 4R4ZA 4FPLA 1QOTA 1QMJA 2VNGA 3AXDA 2FZ1A 2PAMA 4GKXA 4RA0A 3ZXDA 3ZN6B 2R6QA 1RIRA 1NG0A 4IV3C 2NP0A 4QXKA 1X8EA 1G9FA 5CFCB 1CAUB 4TYSA 2HWF1 5EFUA 4YW5A 3VZLA 4BCUA 4BM8A 1QOSA 3TRSB 4HK9A 4V1PA 5K8SA 5EV7A 4QPGA 4Q0QA 2A6YA 1ZYBA 3VN4A 3WW4A 4AEKA 4YM0A 4YVWA 1QJX3 1MZ5A 3I8TA 4JQRA 1QJU3 5AC91 4TLFA 1AR73 1ND3C 1Z7S2 3D5OA 1ZREA 5JIAA 1DGRN 4X8PA 2DCYA 3N7KA 2R32A 2ARBA 1FNYA 1FYUA 3EHKA 1EAH3 3QLQA 3VLBB 4XEZA 2NM1A 1V6OA 4N43A 1QNYA 4LUMA 4QPIA 5GZFA 3M3IA 1V9U1 1WW5A 1IKQA 5AVAA 4DRRA 5L36A 1RHI1 1W2UA 4XFIA 1YFWA 3WY6A 1IGOA 3WQ7A 1FT9A 4AF9A 1NLSA 4AVTA 2D98A 4WM7A 1WBFA 4S2DA 3KZ4C 3WNXA 2KA3A 3POSA 4LUKA 5FREA 4DB5A 5EYYA 3FHIB 4OHZA 3TN93 3M1HA 2CAUA 1IPJA 3ZFEB 1LOCA 2RM21 2FMDA 1PVXA 5CBLA 4JVAA 5DG2A 4K6BA 3MI8A 1ZM1A 4DFSA 4N7UA 1SLTA 4I09A 4XOGA 2F6BA 3GHNA 1NY71 1KFXL 3BPZA 1HRI2 5KHGA 5JSOA 4GALA 1DIWA 1T6GC 1XU1A 2ZGSA 4QGLA 2VOXA 4HVQA 2HEWF 3FFQA 3WW3A 4OLLA 5IK8A 4AEMA 1M06G 4PBPA 2H6BA 3AFKA 4CP0A 3LOBA 1K5MA 1OKQA 2ZGUA 1EV11 1DGWX 3BODA 4CEWB 4OHYA 2B8MA 2QFEA 2BTVC 1OFNA 2RMU1 4FO9A 4XQ4A 4RQPC 3VKMA 1O4TA 4LA3A 3KCCA 4KU7A 1DQ4A 1MQTA 3NAPB 4JCKA 3KGZA 2R30A 1Q8SA 1VBA2 1U5XA 5JI7A 3VDDA 4KBBA 1PGL1 2WJSA 2BPA2 1QWRA 3GNEA 4FXKB 1D0GA 1D0HA 3V65A 3PJQA 4LBJA 1AR91 3VBOC 1GQHA 1TMF2 4XBQA 2XG3A 3ZSKA 3PVEA 2VUJA 4Q8KA 3BU7A 4GWNA 2HWC3 4QQ2A 2D3RA 1VBC3 1TME3 2RS13 1PZ8A 3SHRA 3ILRA 4META 1S2KA 3PVBB 3USUA 4COYA 4K40A 1YLLA 1RVF3 5DZGA 4TWTA 4Y1UA 1W0OA 5C9AC 4DQAA 5LRSA 2OW4A 3WQ1A 3HR9A 1WUVA 4I0AA 3VKFC 1YUDA 1ASJ1 1ENXA 3MIEA 3LWCA 4F7ZA 2P17A 1WW6A 3OY8B 1AR63 4YYOA 4M01A 2E51A 4Q26A 5BNQA 2JE9A 4HFSA 1RMU1 5JZGC 1O4YA 4ATFA 4CDWB 5ABJB 4Y22B 2OVUA 5H9QA 2IXIA 1N3PA 4D69A 4DNYA 4J1WA 4UW5A 3HT2A 2ZHKA 5JSRA 5BNNC 4NVPA 1UW8A 2WNEA 3LCPA 2ILMA 2YPJA 2DVFA 2I74A 3K48A 4PCRA 5E1RA 1RUD3 4XF3A 2DTYA 2ZMLA 1LGNA 1ZX5A 5K0UA 4ISQA 4LBKA 3CF6E 1FI2A 1GBGA 4QM8A 1ALYA 3VBRB 1OPOA 2EXKA 5A33A 2PA7A 1BYHA 1KRIA 2Q1MA 1XRUA 5GZDA 1CJPA 3RMYA 4BA6A 4PLNA 3WOGA 2HWF3 3D4KA 5BNOC 3DF0A 1R1A1 2KM2A 4BLIA 3ZN5A 2XKPA 3E5UA 3MIHA 2Y0OA 2ZAAA 4HVOA 2D6MA 1CX4A 1UMZA 2ZKNA 3VBUA 2ZMKA 5AC93 2BGCA 2GC0A 5FO8B 2CAVA 3AKTA 4AHXA 1F2NA 3GZTB 2C0ZA 5F5QA 1QJX2 4GA9A 1QJU2 1WCKA 4Q1RA 1V9U3 3N7MA 2WFF1 3KB5A 1RHI3 1H0BA 3WW1A 3ES1A 2AR6A 2R042 3HD8B 3MFCA 5GZCA 2ES3A 1EAH2 4LE4A 3V0AB 1VAVA 2JD4A 2EXIA 3NV4A 4IEZA 1GZWB 1NA1B 4TSVA 3ZN6A 1PK6B 4GXLA 2BVVA 1COV1 3VBSB 5CFCA 1CAUA 1IQAA 5KHJA 4C1XA 2RM23 1B09A 4PLMA 4Z2WA 1SBEA 2XGXA 3MIBA 2PHDA 2NYYA 3O5SA 4LBQD 1PGW2 3AYDA 4HBNA 5LK7B 2DU0A 2KXLA 1SEFA 1QU0A 4CDUC 1LB2A 3O0VA 5F6LB 5BXXA 3H7YA 1UKRA 2JJ6A 4AI8A 2BQPA 2WQZC 2XJQA 3ZX7A 3GZUC 1PO22 1EV13 5F1RA 5L7OA 4LO7A 1PZ9A 2DCZA 2RMU3 3FZ3A 2G4IA 4HSJA 4XZPA 1HDKA 3NL1A 3I59B 4QM9A 5IT6A 2ZA9A 4YZ1A 1LGBA 4DS0A 1OA2A 3D0JA 2WC2A 3W9AA 4FPGA 4COWA 4JTOA 3VBFB 3WUDA 3FX3A 2VULA 3KQRA 2WA3A 4XJUA 2WQ4A 1AR93 2EAAA 4HPKB 2B42B 3LGRA 4RSUA 4XXAA 4KGGA 2PAEA 3N7JA 3WW2A 5JPNB 1SLLA 2BFUL 5T55A 4E4DX 4MUVA 2XJPA 3B93A 3K51A 5EJ3A 4MX3A 1LU1A 4WM8C 4WVZA 4OHVA 3ZFEA 2JX9A 2QZ3A 2ERFA 1LHNA 3M3OA 4PQ9A 1WCSA 4IEUA 3S7EA 1QJY1 4QT6A 2NZ9A 1WD4A 4YM3A 1ZZ9A 2AENA 3GBFA 3ASIA 1JN2P 2HWC2 2DCJA 3NVCA 1O3RA 1HRI1 1Q8VA 4YG6A 1VBC2 1TME2 2RS12 1FAYA 3PJYA 3I2DA 2P2KA 5FMOS 1ASJ3 2RHPA 3MICA 1RVF2 2D5FA 4L92A 1OI6A 1AZDA 2VH9A 3V56A 3R4UA 4CEWA 1RMU3 3AKSA 5JDBA 2JICA 1SMVA 4Q4W1 4CDQC 1VBB1 3NAPA 3A0KA 3KT4A 3JU9A 2YZ4A 4OULA 1LRHA 1AR62 2MNGA 5T5LA 3ZYGA 2YDEA 2E63A 1IS5A 4AFMA 4AGVA 3M3QA 4IEQA 2WA4A 2DCKA 3HT1A 1DZRA 4N9IA 4AW7A 4COZA 2ZCWA 5IUQA 4CDXB 1BQPA 1YXWA 1RUD2 3LA7A 4COUA 4R9DA 2GALA 4XYXA 1W0PA 4BIOA 3NJZA 4BMEA 1KDMA 2NLRA 2OZ6A 2AREA 1YJKA 3J8F1 3E5QA 1G8WA 1RUI1 4PDWB 4D7SA 3RPQA 4E2SA 3WDYA 4F3JA 1R1A3 2UWBA 3AP6A 2DVBA 1W6QB 4W65A 5HCBA 2QDNA 2E7QA 5T3NA 4D3WA 5BNPB 3B9IA 4L9BA 2HWF2 2A3WA 2Z79A 4AGRA 3OY8A 2A6WA 1V6KA 2WNVC 3NKGA 5TSWA 2BBVA 2ZGRA 2MEV1 3WG4A 2LTNA 4DOUA 3LA2A 5ABJA 4CDWA 4Y22A 4KWKA 3ZXAC 5E88A 1QQP1 2GC1A 4BLJA 3IWZA 1W6PB 3WT3A 4UW3A 3PNAA 4YW1A 1KQRA 5AC92 1ENSA 1GICA 3ROUA 1YNAA 2WFF3 3B01A 4AFBA 2GNMA 1JW6A 3EO6A 1DFQA 3KLSA 1GLHA 4LO4B 2PELA 1UAIA