2MEV2

Structural refinement and analysis of mengo virus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
249
Chain Sequence
ENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGEHPASCADTASEKILAVERYYTFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGATLRRHYLVKTGWRVQVQCNASQFHAGSLLVFMAPEYPTLDVFAMDNRWSKDNLPNGTRTQTNRKGPFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLTYSTGASTSLDITASIQPVRPVFNGLRHEVLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
total genus 51
structure length 249
sequence length 249
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev200
5CFCC 4JGZC 2XBO3 3JB4C 5L7OB 2RS33 1ASJ2 4N43C 1NA1B 1QJZA 2WZR3 5DDJ1 3VBOB 1R1A2 1AYM3 4BCUA 1QJU3 1BEV3 5AC92 1OOPA 1RUJ1 1ZBE3 1C8M1 1EAH2 4Q4X1 5A32A 1AR71 5JZGC 5CFDB 3VDDB 1X36A 4SBVA 1AR93 1FOD3 1HXS1 2MEV1 1AYN2 3NAPA 2WS93 3VBOC 1RUC1 3NAPC 1HRV1 5C8CA 5BNNC 5D8AB 1ZBA3 4WM8B 1R082 1BMV2 1RUD2 1AR91 1FOD1 1V9U3 4JGZA 4WM7C 1RHI2 1RUC3 1PGL1 4CEWB 1AL23 5BNNA 4Q4V1 5CFDC 2RS32 1HRI1 1RUJ2 3VBUB 1TMF1 5JZGB 5K0UA 2HWC1 2RMU3 1TMF2 1BBT2 2R073 4IV1B 1PO13 2RS13 3TN93 5JZGA 4RQPB 4CDQB 3IDEA 2R072 4FTSA 1EV13 4PDWA 1VBB1 4JGZB 3ZFFA 1M06G 1PO11 1COV2 1AR73 4IV3C 4CDXB 1HX6A 1POV0 2MEV2 2X5IB 1RUG1 1SMVA 2RR13 1EV11 3VBHC 1ND3A 2WS91 1PGW1 1VRH1 2HWD3 3VBUC 3VBHB 2FZ1A 4GH4C 1AYM1 5BNPA 1BEV1 1H8TC 4Z92B 1R1A1 1B35C 2RMU2 1Z7S1 1FMD3 5CFCA 1TMF3 1VBC3 4CDUA 1NCRB 4CEYC 2QQPA 2FZ2A 1R1A3 2BPA2 1MQTC 2RM22 4RR3A 5A33A 4GMP1 1AYN1 2RS52 1FMD1 3JD73 1V9U2 5ACA3 1VB2A 4LLFA 1RUH3 3S6PA 3VBRC 4QPGA 1FPN3 1NY72 1VBA3 1ZBA2 1PO12 3FBMA 4JGYC 4Q4V3 1RUD1 1VAKA 1DDLA 2X5IC 3JD71 1W39A 4RQPA 1Z7S2 2RMU1 1K5MB 4CDWB 1VBA1 2R042 5C4WC 4AEDA 1NA1C 5C9AA 4IV1A 3HAGA 2GSYA 1RUH2 5C4WA 5K0UB 4Q4Y3 2RS53 4FTBA 3VBFA 2Y26A 2HWE1 4QPIB 2MEV3 3ZFFB 4Q4W3 4CEYA 3J8F1 1HRV3 1RUI2 2HWE2 4PDWB 3ZFEB 1WCDJ 4CDUC 1Z7S3 1AR92 1FOD2 4Y4YA 1RUG3 1PVC3 4CDQA 1RVF3 1COV1 1ND2C 1QJX3 1MQTB 2PLV3 1HRV2 2HWE3 4AEDC 4Q4W1 2HWF2 3J8F3 1VRH3 4NWVA 3TN92 4GMP3 1VBA2 2R041 1HRI3 1NCRA 1FPN2 1K5MA 1RMU3 3VDDA 4CDWA 4FSJA 3VBUA 1ASJ1 3VBFC 1B35B 4EJRA 5CFCB 1RUH1 2XPJA 1PO23 2VQ0A 2PLV1 1E57A 2R062 5BNOC 1OOPB 4QPGC 2RS11 3CJIA 4IV1C 1VBC1 4IV3A 5BNPB 1VBD3 4RR3C 5ABJB 1TME3 1VBB3 1F2NA 1VBE3 3DPRC 1RUE2 1EV12 1CJDA 4RFT0 4Q4Y1 4IV3B 3JB8A 4CDXA 2RS51 1FPN1 1POV3 4RS5B 2WFF1 4YVWB 2RR12 4QPIA 1BBT3 1IHMA 2BFUS 2BBVA 1ZBE2 1PVC1 1COV3 2ZTNA 3VBHA 1GFF2 1PGW2 5ABJC 4YVSA 2HWB1 1BBT1 2HWC2 4GB33 2WWSA 1R081 5C8CC 1ASJ3 2XBO2 1PO21 5K0UC 1AR81 1MEC2 1NG0A 4WM7B 2HWD2 2RS12 4CEYB 2HWB3 5ACA2 4GB31 3JBG1 1ND3C 1VBB2 1HQNA 4WM7A 5ACA1 1R092 1RVF1 3JBG2 2RM23 1VBD1 1AR62 1QJX1 1AUYA 1QJY1 1EAH3 1H8TB 5C9AB 1C8NA 1RUD3 1FMD2 1X33A 1RMU1 5FMOL 4Y5Z0 2HWB2 5CFDA 4PDWC 4CDUB 3ZFGB 1POV1 1RUF2 5A32B 1PVC2 1OOPC 4QPGB 1PIV3 1RUE3 1RUI3 2BFUL 4WM8A 1TME1 3VBOA 4Q4V2 4WM8C 4RHV2 4N43B 5DDJ2 1ND3B 3NAPB 1VBD2 1RUF3 5J96B 1F8VA 4N43A 5ABJA 1R083 1BEV2 1RUE1 5AC93 1ND2B 5FOJB 4N53A 4GH4B 3ZXAC 1D4M3 2WFF3 3CJIB 1C8M2 1RUF1 1AR63 4QPIC 1NY71 2R043 3VBSB 4CEWC 2HWF3 4CDXC 1PGL2 4YVSC 5BNOA 4NWWA 1K5MC 4CDWC 3DPRA 4RS5C 5FMOS 2WFF2 1AR83 1VBE1 4Q4Y2 1HRI2 3JBG3 2XBO1 3VBSC 2RS31 1VBC2 4RHV3 3J8F2 1NOVA 3ZFEC 1RUI1 3VBRB 5D8AA 1AR72 1QJY3 4Q4X2 1NCQA 1RUG2 5BNOB 1C8M3 5AC91 3LOBA 4YVWC 1D4M2 4FTEA 5BNNB 1D4M1 1AYM2 5J98B 1AR61 3JD72 1BMV1 4RQPC 2ZZQA 3VDDC 2HWF1 2IZWA 3DPRB 5C8CB 1RUC2 3ZFGC 4RR3B 1PIV2 5A33B 2TBVA 3CJIC 3M8LA 1MEC3 5C9AC 2RM21 1EAH1 1QJU1 2HWC3 4GB32 1NCRC 2R071 1R091 1RVF2 4GMP0 1RUJ3 5L7OC 5D8AC 4RHV1 1AL0G 4Q4X3 1B35A 2DF7A 1ND2A 1HXS2 1AL22 4Q4W2 4CDQC 1QQP1 1CD3G 4JGYB 1NA1A 1RB8G 1H8TA 5GKAC 5L7OA 1PIV1 1MQTA 5BNPC 2X5IA 1VRH2 2WS92 1ZBA1 2WZR2 2RR11 3ZFEA 5LK7B 1ZBE1 1VBE2 1OHFA 3VBFB 2HWD1 1TME2 2WLPA 3ZFGA 5C4WB 1VB4A 1A6CA 1HXS3 2ZAHA 4YVSB 1OPOA 4AEDB 2R063 1NCQB 4JGYA 4N53C 1AR82 1MEC1 1QJU2 1PO22 1RHI3 3VBRA 3TN91 1RMU2 3VBSA 4CEWA 4YVWA 1V9U1 1R093 2R061 3ZFFC 2WZR1 5DDJ3 2PLV2 1QQP2 1QJX2 1QJY2 4GH4A 4RS5A 1AL21 1RHI1 2BUKA 1NCQC 4N53B 1AYN3 2GH8A 1QQP3
chains in the Genus database with same CATH superfamily
5CFCC 3CU7A 1C5HA 3OY8A 4BK5A 2XBO3 3IIAA 5L7OB 5A80A 1UAIA 3MZHA 2KD7A 4JCKA 3ZKYA 2WNVB 1NA1B 2WZR3 4LBQD 1KJLA 3AVRA 4N7IA 1YJKA 3OTFA 2I07B 1OA2A 4QHZA 1N1SA 1ZZ7A 3MIHA 1N3OA 3P5BA 4QQHA 4QAWA 4TTGA 1YHFA 3OBAA 4ZZ5A 2Y0OA 4IE5A 1ZBE3 1C8M1 1EAH2 1ODMA 1UWWA 2W95A 3IM0A 3BTYA 4ZS3A 3K3OA 3PNAA 4GA9A 4QX8A 1JOBA 4CTEA 5JOXA 5IATA 3GYDA 1V00A 3VDDB 3C7GA 2WQ8A 1W6PB 1J1LA 1FOD3 4IEYA 4WV8A 4Y20B 2ARCA 1MPXA 2FCUA 3AKRA 2PA7A 2WS93 3ES1A 3WHTA 4DIQA 5C3RA 5LK5A 4OI0A 3LOIA 1HRV1 3J9SA 4ARXA 3WW4A 1W6MB 5C8CA 2BZDA 4R4XA 3WNPA 5FBZA 3U1XA 3B02A 4NOTA 3RZJA 1RUD2 1YFXA 1FOD1 3ILRA 4JGZA 1WA6X 1A8MA 1OBNA 5FJKA 4B7EA 4JDOA 5KC6A 2VOVA 4QPWA 3O1MA 2BP6A 1PGL1 2IXLA 3GHMA 3K4DA 2RDNA 3MDPA 4Q4V1 5CYYA 1IZ3A 3DKQA 1BVP1 2WUHA 5CFDC 3I49A 4OUMA 2VBPA 3VBUB 3NV3A 1YXWA 4ASMB 2YC4A 4R52A 2MPFA 4U2AA 3MW3A 2HWC1 1DIWA 2WWJA 3D8CA 3E97A 3ES4A 1V6MA 5F6KA 1BBT2 3LSEA 5H9RA 1UKGA 4IV1B 1XE0A 5FYUA 2FQPA 3IDCB 2NPIA 5HXMA 3ELNA 4ITCA 3ZXFA 3WEZA 4V2WA 1LU1A 2RS13 2YHJA 4FPOB 3IPVA 2PHDA 3CEWA 3WG3A 1JU3A 2Y0IA 3OGRA 4LMFA 4C1XA 5HCHA 5A6YA 3NKTA 2WN2A 5DAPA 5FY0A 2PN5A 5DZGA 5FZEA 2VCCA 3K77A 2D98A 4XUQA 4JGZB 4QDRA 3CLPA 3AJZA 1COV2 3BIWE 4UBHA 1YQCA 4IV3C 4XTPA 4W6WA 3LFMA 4MHUA 1POV0 1DHKB 4XF9A 2Y33A 3OD4A 4LBOA 2G9FA 2RR13 3CQOA 3I3QA 4I0WB 4L8QA 4HKLA 1SLAA 5G04L 2W08A 4LO5B 1NKGA 4HFSA 1K3IA 3VBHC 2CGPA 1F5FA 4XQWA 1KXGA 4L0PA 4QT6A 3T2TA 3KQRA 3VBUC 1H4GA 1NYWA 3JU9A 2WO7A 5A1LA 4JAAA 1BEV1 1CZVA 1JHNA 5DQ0A 2D44A 3U07A 1ZREA 4XJAA 2GZWA 4LBLA 5BNQA 1V70A 2LRPA 3MW2A 3LA2A 3RZKA 2R32A 2W2IA 4PJYA 5CFCA 4QPYA 4CYDA 3K4ZA 1SCSA 1NCRB 5IFTA 1JZ4A 2UU8A 1KJRA 5JDBA 1NLRA 2DBIA 3VD7A 5FYIA 2QQPA 4EN9B 2Q30A 2Q1MA 4K9SA 5FZ3A 4XMIA 3EQEA 3VKOA 5D21A 3GXUA 5FZ4A 4QKBA 2WNUA 4XFFA 2BNNA 2VXRA 5AFEA 3SLIA 3IZOA 1AYN1 4XJWA 5KHIA 3GBFA 3JD73 5F2WA 3OBTA 5HBAA 5I0SA 3MBWA 2VM9A 1JYTA 2LW8A 4XFBA 5B4NA 1RUH3 2JG9C 3SH3A 3VBRC 1WZXA 1W28A 4QPGA 2JDHA 5FZCA 1VBA3 4BMBA 2VBBA 2VZQA 2TEPA 2VD7A 4JGYC 3RRDA 3QBQA 1VAKA 1OA3A 2X5IC 3GF6A 3MLJA 5A6QA 4L2NA 5C3SA 1W39A 1DFQA 3WNKA 1DG6A 4FBFA 5K4LA 2P3KA 1WW4A 2UY9A 3KQ4B 3FN9A 2JENA 4XUNA 4AEDA 5LZ6A 1VMJA 2EAAA 1SDWA 1UF2C 1FATA 4DINB 3C8XA 5JOYA 4LIUA 4HZFA 1RUH2 3GCWA 3AX4A 4AYUA 5FPVA 2AZ5A 5LEKA 4Q4Y3 4NHXA 3DF0A 2FDHA 3H3LA 4FTBA 1OA4A 4CPBA 2Y26A 4QPIB 5GZFA 1DGWA 1LECA 3D4KA 3H3UA 4NROA 4Q4W3 4UXAA 3UYJA 5DUXA 3ZFEB 4PDWB 1W04A 4MOAA 3WG2A 1Z7S3 2GALA 1AR92 1SBEA 4KI5M 3S7IA 3AKTA 2P4EA 3R4UA 4Y4YA 5FREA 5EYYA 1RVF3 3AM2A 3O0VA 2BVBA 2WA3A 4IQPA 5FP8A 1COV1 5FLIA 3TEZA 1MQTB 3UESA 3VB9A 3ECQA 3NL1A 4Q4W1 3J8F3 2ZGPA 4XZUG 5KWRA 3TN92 2ZMLA 3NJVA 1OQ1A 1JHJA 3LEIA 4GMP3 2N7GA 1RMU3 1FPN2 1K5MA 4RN5A 4CDWA 4NAOA 2ZHNA 1S0JA 4IL7A 2VUJA 2CAUA 2XPJA 4J1XA 5A7OA 5T5PA 4K7JA 2VQ0A 2WAAA 2AENA 1E57A 1A8DA 1S0BA 2R062 1XYNA 2JDKA 2ZGUA 4IEOA 5E1RA 3H0OA 4BJ0A 4DPNA 1YQ6A 2B5HA 4BQYA 5FO9B 3CJIA 4QX1A 4IV1C 3USUB 1W6QB 4HETA 4MZUA 4QDSA 4XACA 4XUPA 3U75A 1F5JA 5F5IA 1NXMA 3RI9A 1DLCA 5TSWA 2VCBA 1ZX5A 1F2NA 2WAOA 4C1WA 4CXWA 1VBE3 1ULEA 4FVVA 1CPMA 4IEWA 4O9GA 1EV12 3WW3A 2QVSB 2WDBA 3IKWA 1K42A 2A5ZA 3U11A 2WZEA 5EJZB 2P6CA 2Z42A 3ROUA 2ZGNA 4IESA 5T52A 2RS51 4EV0A 4RS5B 4AQ6A 4Y3OA 4BIFA 1V6NA 1RYYA 5FWJA 2DDUA 5T5OA 3LDRA 3KVBA 3N7MA 1BBT3 1C1FA 3SCHA 1LRHA 3WINE 2QJVA 1K12A 4Q0PA 2VZUA 5IHRA 3M70A 3Q8CA 2YPJA 1WBFA 1HIXA 4DXRA 4KNCA 5FZMA 5C3PA 4P9IA 2W9XA 1PGW2 2AYHA 1FV3A 2D6NA 4YW3A 4OMCA 4GB33 1AX2A 1SBDA 5IVBA 2Q8CA 1R081 3HT1A 4H7LA 1HJFA 1GZWB 3S7EA 1ZRCA 3KT4A 4Q0QA 3U4SA 3TAYA 3WNMA 2VW0A 4AR2A 1I9RA 4MGIE 2NMNA 2OUJA 4YW4A 4QB6A 5EQUA 5LRRA 4UYBA 4XF3A 3KS7A 5A1AA 3T4HB 4MVTA 2QNKA 3W58A 1HQNA 2Q8OA 4CUGA 3OGSA 4QQPA 1AR62 1QJX1 4YPJA 2DCKA 5JSOA 2V09A 3B9CA 2D3SA 2W39A 1KQRA 1AXZA 1LENA 1KEXA 1N3QA 2E53A 5APAA 5C9AB 3FWEA 2YBKA 4JDMA 4TSVA 4Y33A 3P6BA 2JG8C 4Y5Z0 2HWB2 2WO3A 4P9YA 3OYWB 4D94A 3BU0A 5FZKA 2ZBJA 4LXLA 4Z2WA 2JDYA 4LULA 5IVVA 4TYSA 2QQMA 2Q1FA 3N7KA 3Q8FA 2R1DA 3DXTA 1IPKA 2VXJA 1BJQA 3WG4A 5FK7A 3THCA 1F31A 5I91A 1XU2A 4XJUA 3ZSLA 3DYMA 5A3WA 2Z4FA 1LGBA 3FL7A 3PUIA 1ZZ8A 4Y22A 3VBOA 5KXDA 1NXD1 5F1RA 5DDJ2 2HKXA 1O6UA 1VBD2 1MZEA 5JLVA 1A34A 3WG1A 3OSDA 4BQXA 4HN1A 5FYTA 1KFXL 3HQXA 4N43A 3LKJA 1JYVA 2R6QA 1XNDA 2IXKA 4MXVA 5FWEA 5F7UA 3MLLA 4NVPA 4S2GA 5FOJB 1W2TA 1W6QA 4YZ5A 4CU9A 3MV01 3ZXAC 5FPUA 1KDMA 1O5LA 4LBNA 3CJIB 2PHLA 1KFUL 3NNJA 1K5JA 1QIQA 3AMNA 1PK6C 4OZOA 3I3MA 1NY71 3UETA 1W8WA 4A7ZA 3LGRA 4KWLA 2ADDA 3I4IA 1JYXA 1CAUA 1LESA 4RSUA 3ILFA 5DUWA 1OVSA 4YZ4A 4FPEA 4LHNA 1YIFA 3MIDA 4HK9A 5FO7B 3PHMA 3T2PA 1W9YA 4NWWA 3RZZA 4N9IA 2GC1A 2VTFA 3VKMA 1K5MC 4CDWC 3T0AA 5F3CA 1BYHA 3SXWA 4QGMA 1AR83 3M3OA 1U5ZA 3AKSA 1MS4A 2LM3A 1CAXA 2ET1A 2YXSA 3KT7A 3OG2A 3VL8A 3DKWA 2EIDA 4Q4Y2 4XF0A 3JBG3 4QX7A 2ZACA 2E51A 4O65A 2RS31 2CHHA 4DEQA 5HI0A 1UO9A 1JZ5A 4IGPA 5LRSA 2BJSA 1IG3A 2VECA 1CQ9A 2P3JA 5GLUA 1NOVA 1U12A 3K75B 1ZZ9A 3PJYA 5FPBA 2GMPA 3AKPA 3VBRB 3VZNA 5FOBB 1U5XA 3MYXA 3OOXA 2W47A 1NCQA 1LAJA 1O4YA 1UPIA 2QQWA 2Y60A 4QU1A 1AVBA 2HJIA 5FP9A 4DZGA 4UBGA 4YZ1A 4LUMA 1OPMA 2AUYA 4LBKA 1JS9A 4M0NA 5FTTC 4CCCA 4FTEA 3LOBA 3WF2A 5IVYA 2R16A 3N7JA 2PTMA 3ACGA 1H9PA 2LALA 4JRLA 4CCLA 4JZRA 3KGLA 5EV7A 2JB8A 4IGOA 3DXUA 1ZM1A 4Q8LA 2WZPP 5EWSA 3AP5A 3KM5A 4QXCA 5F8PA 1IG0A 1XQNA 4JVAA 4B29A 3VDBA 1BMV1 3IMNA 5FZ1A 1LB2A 4OQ9A 2HWF1 2IZWA 2Q1ZB 4ASKA 1EUUA 1HJGA 3CF6E 1NT0A 3DPRB 2ZCWA 3NNMA 4FI9A 3WCRA 1SEFA 3F2ZA 4W6XA 4GZ9A 5F39A 1PIV2 3T1LA 5LY1A 3MICA 5GZEA 1X8MA 2D6MA 4LUKA 1N1YA 4X6QB 1ULDA 1UY0A 3AMPA 4FPYA 4Q1PA 2B9UA 1CESA 2HEVF 1DQ2A 1F9KA 1MR5A 3GM8A 4HN0A 4CCDA 5FK8A 2WNUC 4F3JA 2ET7A 2A7AA 1IS5A 4ZONA 4GB32 3PL0A 2VG9A 1NCRC 4ZPIA 3AC0A 5GLZA 2DCTA 2YG0A 4AGVA 2G4IA 3OBZA 1OF4A 1DQ0A 2W68A 1R091 4HG6B 1QXPA 3HEIA 2XQRA 4XETA 4MG2A 2C9AA 3FLTA 5DG2A 2EA7A 3NW4A 5ERLA 2QQKA 5I0DA 3RZHA 1BK1A 1C57A 4FPLA 3MLKA 3CBNA 2D97A 2DU0A 2FDJA 4PQ9A 1DQ5A 5IVCA 3ATGA 4DO0A 3LB9A 4OYUA 2J42A 4MYEA 4EN0A 1F4HA 2NM1A 2PAKA 4XBLA 4LTAA 1QNYA 4LA3A 4COYA 1ODNA 2QKDA 2ZABA 1WCUA 5DZEA 2WZR2 3O1OA 5J7MA 5L9VA 1GP4A 2FCVA 1GU3A 3LCPA 3N35A 3GJAA 3WXPA 1ZBE1 1H2MA 1VBE2 1XXNA 4XAEA 3TYJA 5EPAA 3VBFB 1CAWA 1ENXA 1TME2 4EE2A 4Q8KA 1STMA 2WLPA 3NWKA 1FX5A 4UW6A 1VB4A 1BCXA 1P8JA 4AVVA 1XYOA 1PM7A 3ZSKA 3H1YA 3EB7A 5FBJA 1IS4A 5F37A 4D7SA 5A3PA 1NCQB 2Y8KA 1QJU2 3AP4A 5J36A 2RJLA 3NVCA 1M4WA 1UYYA 3FHIB 3PMEA 5FDBA 4MH0E 1RMU2 1ZA7A 4Q1RA 3VBSA 4CEWA 3UK9A 3BYWA 4P08A 2QQUA 1E5SA 1MS8A 1W0NA 5DG1A 2Y6KA 2WSUA 1JZ8A 1YQ8A 3ASIA 4RS5A 3SKVA 4MGKE 5LEJA 1NCQC 2ARAA 1GKBA 1S0CA 3DL3A 4H3WA 5L73A 4H2AA 3ZPOA 3BPZA 2BNOA 4JGZC 3IIIA 3ZXGA 1QJFA 2RS33 1CZTA 3RPQA 1ASJ2 2UWAA 3QD6A 4Y20A 3POFA 1R64A 1J1TA 4MO3M 5IVJA 4D69A 1UD1A 2XR4A 1MACA 4LJHA 4AGGA 2VMDA 3WF3A 4QX2A 1LR5A 1R1A2 2ZEXA 2GC3A 4BCUA 3RYPA 4A3ZA 4BMEA 4MHRA 1UY1A 3USUA 3O1TA 4YZ2A 1S0EA 5CZKA 2GP3A 5LA1A 3C7EA 4Q4X1 3EJKA 1AR71 5FYVA 2BNMA 4EZHA 2AEYA 1Q43A 2WC2A 3SKJE 1JN2P 5CFDB 3O0WA 1OH3A 1VAVA 2XG3A 2XMLA 1WMDA 1YC61 5FJHA 1HXS1 1OMIA 3D5OA 3GHNA 5A7SA 4AQ2A 1AYN2 2A73B 3B00A 4QX5A 1RUC1 1D4VB 5F3IA 4XOGA 3J7MA 2VH9A 3VL9A 2WINB 2JDZA 2A70A 3ME2A 5A3MA 3GALA 1FT9A 3WP5A 1UZWA 4O61A 1ZZCA 1J58A 4CP9A 2W3JA 1GUIA 3OF1A 4AQSA 1H4HA 2VNVA 2XH6A 1V9U3 3HBZA 3I2IA 4G4FA 5DPNA 2CU5A 3NRUA 4PBOA 4XJ8A 1DQ1A 1EY2A 2ZKLA 3MFCA 1RHI2 3MIFA 1QOTA 5H9QA 2Q8DA 3MF9A 4K8RB 4DY5A 4CEWB 3VD5A 2IWGB 1AL23 3WDWA 4COUA 5BNNA 2RS32 4XMAA 1CAVB 2EVXA 3HPNA 4F8AA 5K0UA 5C8WA 2CTVA 4LBQA 4PIXA 2C5DA 1LGCA 2C9KA 4Y24A 2XVKA 4FOWA 1L7LA 1DGRA 2BW8A 2XUMA 4L92A 1VMFA 4QGNA 3MW4A 4XIKA 3HR9A 2AEZA 2XJPA 4GIQA 4HANA 3ZMNA 5F5CA 1S55A 2VW1A 5JZGA 3IDEA 5CA6A 4CU8A 2PHRA 2P34A 3ETPA 2VMCA 3WP6A 4FOYA 4FFIA 5FCCA 1G9FA 4CUCA 1SACA 2J1UA 1PO11 2E7AA 3H42B 3AZWA 3AYEA 5LW9A 4UOJA 2P6HA 4D6RA 4CDXB 1HX6A 3G6JB 3ZIWA 4XBQA 1TG7A 1XBFA 2CGOA 2MEV2 1RUG1 3Q8EA 4EN7B 1VAMA 5FKCA 3CMGA 1UCXA 2EXHA 3A4UA 5SV8A 4URAA 1J3PA 2WS91 1MZ6A 3UKVA 1WW5A 2BEOA 1W3XA 2EXKA 4LO4B 3WDTA 2H0BA 4JQRA 3WNXA 1VJ2A 2BERA 2P1BA 4GH4C 5GJ6A 1YLLA 3RS6A 1XC6A 2PMWB 1X8EA 1I3HA 3WHUA 1DU3D 4I3PA 2A3YA 5DAXA 1H8TC 4PLMA 3FUOA 1UMHA 2YBPA 3NKGA 4CUAA 3MIGA 4IE7A 1WW7A 5FIXA 5FZFA 1G9AA 3AYDA 2VZTA 4X8NA 2KA3A 2JXAA 4CDUA 2VMFA 5JPMB 2VVDA 5J48A 5C5UA 2JWPA 3ABZA 2FZ2A 5FYBA 1R1A3 1W03A 3K48A 4LNVA 2HBTA 1MQTC 2BPA2 2FBEA 5FZ0A 2WZ8A 2BGCA 4P9LA 2XGXA 2VTXA 4ZXEA 5LA0A 1LHNA 2RS52 4RGAA 2HEYF 3NSTA 2EF6A 2GC0A 4YSFA 2JD9A 2E7TA 5L9RA 1FYUA 3H9AA 2QZ3A 3QLQA 3S6PA 4OHZA 4M4PA 1YWKA 2JDNA 2YFUA 1NY72 1PO12 1WMEA 2F4LA 3H8OA 2WBKA 4OZXA 4Q4V3 1GYKA 5FLJA 1HLCA 1RXGA 5L19A 4BLIA 4IETA 3LEKA 1JYIA 3F95A 4BYYA 5EJ1B 3I2FA 2RHPA 2VPVA 1KS4A 1Z7S2 1K5MB 2RMU1 3HBKA 3IPVB 4GJYA 4KG0A 4CDWB 2V72A 2E6VA 4Y5TA 3I7DA 4ZU7A 1PX4A 5C4WC 2FDGA 1NA1C 1VR3A 2NLRA 4XPVA 4IV1A 3RNSA 5HPOA 4E4HA 2YZ4A 1CZSA 3GZUC 1GOGA 3OPWA 5C4WA 5C5TA 5K0UB 4OCTA 1HB2A 3GGLA 3AXDA 3M7AA 4XHXA 4AI0A 4DOUA 4HKWA 4Y1XA 3NJXA 2E9QA 5CISA 1FNZA 2DCJA 1SFPA 3R05A 2I45A 4QKNA 3ST7A 5FY8A 3RZMA 1BKZA 5DAQA 4CEYA 3LIGA 3P3NA 5T5LA 5A3TA 1RUI2 3AZYA 2OT7A 2SLIA 2XXZA 3WZ1A 4JQTA 2D6LX 2Z69A 2H6BA 4EQVA 4X8PA 2E26A 4JTOA 4CDQA 5KHHA 3T0DA 1ND2C 1QJX3 2ZKNA 3PUAA 1EP0A 2PLV3 4M3CB 1CONA 2A6VA 3T4VA 3T08A 2IVJA 1OSGA 4NWVA 3PU8A 3ZDVA 3O1RA 1W06A 1W2OA 2J1SA 2TUNA 4I0AA 3WX5A 3FJSA 5EIYB 1LOCA 3VDDA 5A7QA 4FSJA 1EUTA 2VL4A 5JMOA 3LPGA 1RUH1 1Q8SA 2Y6HA 2PLV1 2XKOA 4GULA 5KXCA 1LEDA 1W8TA 2P2KA 1QU0A 4FQZA 2VC9A 2VGDA 4XEZA 1GMMA 1OKOA 2EXJA 4P9JA 4FAGA 4S2HA 2IVIB 2E33A 1JZ6A 1VBC1 4HLTA 4ORFA 4AHXA 5BNPB 3AMQA 3POSA 5A7NA 3NV1A 3PURA 3ZIXA 5BY5A 2JDAA 4K20A 2F6BA 2YC0A 4XIOA 5GZDA 2VAUA 4PQQA 1QGLA 3SITA 5JCTA 2FDKA 2AR6A 1RUE2 2XUEA 3QCWA 4IEZA 3FE5A 4P9XA 4QXBA 3CHXA 4L9BA 5FZ6A 4AVSA 3VKLA 1CJDA 3PIGA 3WF4A 2D43A 2WO2A 1TNFA 4RFT0 3RMYA 3ZLIA 2VCAA 3B94A 2WT1A 3T30A 3U78A 3D0SA 4GWMA 5FY7A 1XB9A 2XL7A 5FXWA 3U10A 3WVJA 1WCQA 5EXOA 5HXVA 3ZXEA 3N36A 4C8DA 1XOYA 1Q8QA 2E63A 2RR12 3FZ3A 2Y6LA 4PI0A 4QPIA 3RJ2X 4Y5SA 1PVXA 3OJBA 4UI9L 2E31A 2XHNA 2Z2SB 2JECA 3PTRB 4CCOA 3OYWA 4PLNA 5JVVA 3VHNA 1W6NB 1GFF2 5JMCA 1I6XA 5KBFA 4NHLA 3CDZB 3ZYJB 5ABJC 1UU4A 1U5YA 2JDUA 3ZXLA 2HWB1 2BOIA 2F4PA 2ZGOA 1LHVA 2ZX2A 3WUDA 3ZYGA 2OQ7A 3KLSA 5F2SA 1DZQA 4CUBA 4DNYA 4Q0VA 4W6YA 5T54A 5K0UC 4BK4A 4AHZA 4ASLA 2NP0A 2XJRA 4XABA 2HWB3 1DLLA 2WNOA 1UMIA 1W8NA 4ET7A 2FCTA 3IMMA 5JSRA 1ZNPA 1REFA 5IVFA 4ZU4A 1RVF1 5HCAA 5J1XA 1UNBA 2E7QA 2A6ZA 3I2OA 1EYBA 3O12A 4DFSA 1H1MA 1PMJX 5IAXA 1QJY1 2RG4A 4NJ4A 4RA0A 1H8TB 4IE4A 3HIFA 3USSA 1H8VA 1QDCA 1RUD3 3WP3A 1VRBA 1X33A 4DY3A 4ZXKA 4B1LA 1UXZA 4CDUB 4NIAA 4CP2A 5T50A 1H2LA 3KV9A 1PX3A 2I74A 4Y4RA 3J7HA 5A32B 2K46A 2VULA 3NNLA 3IAPA 2WRAA 3B5LB 3MPPG 4DQAA 3TNQA 2A3WA 3MGUA 3VD9A 1APNA 3RMXA 3WQ7A 3PLQA 1L7QA 1KGYA 3VD4A 5K7PA 2WFPA 3DECA 2C0ZA 2BFUL 2XHKA 4WM8A 3GCXA 5BV6A 4NHYA 4Q4V2 2WQ4A 2CNAA 1C3HA 4DRRA 5CBLA 1XNKA 2O1QA 2V73A 4GKXA 1ULFA 3JXSA 4Q0UA 1UY3A 3IDAA 5HV0A 1CX1A 1F8VA 4XCAA 4IDZA 4YRDA 3ZN6B 4AFDA 4LQRA 1W3VA 5AC93 3VDCA 1AHSA 4CCEA 2OPWA 1DZRA 3AJYA 4FPKA 4GH4B 1QNWA 2E32A 2WFF3 5DZFA 2ENRA 5FMBA 5FPAA 5JIAA 3QACA 1GANA 2CL2A 4JHZA 5FZHA 4AHYA 4XJZA 2BGOA 1HDKA 4OHYA 1RC6A 2R30A 3LSDA 3OUIA 4LK6A 4RD7A 4KL1A 4CEWC 5K9YA 1XE8A 3KF5A 3K2OA 4CDXC 4EZ4A 2WL1A 3UL2A 1CR7A 4YVSC 2JE8A 2OUHA 5A1FA 1H1AA 5A3UA 2RDRA 4H7MA 3I2JA 1GZTA 1AZDA 1XSQA 4FO9A 3T2OA 2VY0A 5HCBA 5IJRA 4NRMA 3DPRA 4RS5C 5FMOS 1HKDA 2LTNA 2VCMA 2WFF2 1SZBA 3EO6A 5EZWA 4DMIA 1W9WA 1AX1A 5FZOA 5BYNA 3FFQA 1QHDA 3JZVA 5E88A 3VBSC 1OXCA 3HQUA 1Q8VA 5JXJA 4RHV3 1OLME 2ZEYA 4UW4A 4AAXA 4KGQA 1RUI1 3RGBA 2XJUA 3UV9A 3B69A 4A44A 4CVUA 1UOFA 2FDIA 1WUVA 4LE4A 3AP6A 1W99A 5FY4A 3BUCA 4N9HA 4TN7A 1GZ9A 3ZR6A 1EPWA 3R4SA 1OFSA 2L9LA 1CPNA 1C8M3 2VU9A 1HB4A 3HD8B 4FCAA 4LBQB 4NRQA 3J7LA 4YVWC 3BIEA 3S5AA 3DCQA 5LBFA 3W5MA 1CAUB 4RGGA 4NHKA 2LUWA 5BNNB 3RZGA 1W0OA 1X82A 3EXUA 3FLPA 1G9CA 3CZUA 3RG0A 1UPSA 4Z82A 1AR61 4UAPA 4MGQA 1WGPA 2XQXA 2ZZQA 4UWDA 4A6OA 3N9OA 4E4SA 4FPGA 4XDOA 1RINA 4A7KA 2YB7A 5JI7A 3RDIA 1RUC2 4NPMA 3ZFGC 1O3TA 5JR2A 4IXLA 4RL7A 4UFIA 4MUVA 1GP5A 2TBVA 3I54A 4TXWA 4YGBA 4D3WA 2XKPA 1UX7A 2A6WA 1YJLA 2XVLA 2ZX3A 3DYOA 3OGGA 2P5BA 2Y38A 2VZSA 1PZ8A 2CV6A 1KD7A 1HN0A 1MS5A 4AAPA 4COZA 1Y9GA 2VJXA 1ENSA 5IYYA 5AFBA 4BQ5A 1L3JA 3SMHA 2ZEZA 1GNHA 3WW1A 1HV1A 2R071 2VMGA 5SV5A 2W46A 1RUJ3 2WYFA 4U36A 1YQ2A 4COWA 2ZJCA 5ANQA 1AL0G 4INDA 4Q4X3 1B35A 5IWFA 5FPXA 2ZHKA 5JIUA 1XU1A 3TB0A 1LOEA 4CSWA 3VKFC 2OQ6A 4QB1A 2W1QA 1ZZ6A 3SEEA 2DVFA 2CGNA 1PIV1 2XB6C 4PT6A 1QF3A 4AQTA 1LOFA 3K3NA 3EYPA 4G9SB 2JG9B 4QQ2A 4D7TA 2WS92 1ZBA1 3ZYRA 4ATFA 1IKQA 4UFJA 3LD8A 2RR11 3P1IA 4YGEA 4P9GA 4XQDA 1PHMA 4RFRB 3WDYA 2J1RA 5FZGA 3I3BA 5HCFA 3WQBA 2ZGKA 1LU2A 3UNPA 5CB7A 3BPSA 4LKEA 2B45X 4I0BA 3AZXA 2SBAA 3ZYHA 1RXFA 4MGTA 1NLSA 3CZJA 4YZ3A 5FPLA 1WMFA 1W8UA 2B7YA 2JJ6A 2VE1A 2XOMA 3H3ZA 2XJTA 1ULCA 3O14A 1JUHA 3BB6A 3WNOA 3UKTA 1O91A 1HXS3 4XC9A 2ZAHA 4JKMA 2R0FA 4M3CE 4R8HA 1TZOA 4XILA 1ULGA 3AVSA 3MIBA 4ZKTB 3V0AA 4E9KA 3B01A 1WCKA 4LA2A 1RHI3 4RYDA 3TN91 4QMAA 4QWNA 1JU4A 3UT0A 5FUNA 4HVRA 1Q8OA 4XFGA 4Y26A 1O3SA 4HK8A 2BVVA 2HYXA 1GBGA 1W0PA 2WZR1 2OIIA 3OCPA 2PLV2 3OB8A 3DYPA 3ZFFC 3ZPYA 3LEMA 1AYN3 2GH8A 3OD0A 1UW8A 3L9JT 3VZLA 1AXKA 1DQ4A 5H9SA 2OYZA 4CU7A 1Q8PA 3JB4C 4D6QA 1YUDA 2O0OA 3ACIA 1D7PM 4JDNA 4N43C 4EN6B 5DDJ1 1T2XA 4GWIA 2BYVE 4QHOA 3T3YA 1W6NA 2K9ZA 1O4TA 1S0GA 2WNEA 2ZGQA 4M3CF 2WWUA 4FPHA 1AYM3 2F17A 1UZYA 1XSRA 5IUQA 4Z8BA 5AC92 2ZGMA 1K45A 4WVWA 2VZRA 2BGPA 2KM2A 1Y3TA 4P14A 4ARYA 1UMZA 1GOHA 1MZ5A 1JI6A 1X50A 5FQ0A 2AACA 1IKPA 3SCFA 3THDA 3VUOA 4CXXA 1YFYA 1X36A 1CWPA 4YW2A 1AR93 2DVGA 2QQOA 4S2DA 4C0HA 5FFOC 2MEV1 3NAPA 3OPZA 4FPJA 1QEXA 3VBOC 4AXOA 3WD5A 4YM0A 2OZJA 2ZZJA 5D8AB 4LO8A 2VOWA 2W52A 1IGOA 3PJQA 5I8SA 4OI1A 1BMV2 1UXXX 1AR91 5FZAA 4M0HA 4GWJA 3VZKA 3KV6A 3E6DA 3RFRA 5LASA 2ZGSA 5DN2A 2PAMA 3UGGA 3O1PA 4I30A 2RDQA 4LITA 1HRI1 1RUJ2 5LY2A 3WW2A 1MVQA 5JZGB 1W6OB 4TZDA 3VD3A 2ES3A 2RMU3 4AFMA 3H7JA 2DV9A 1VPHA 1S1AA 1S0IA 3KMHA 4W65A 1RJ7A 2R073 1W05A 4IERA 4BQWA 3UJOA 4E2SA 3CO2A 4AZZA 4HPKA 3KZ4C 5JXHA 3LEGA 4CCJA 3M3QA 5DXDA 5FP7A 1DGLA 2JD4A 4DEVA 1KS5A 4W50A 5DAVA 1JZ3A 4CDQB 5FY1A 2R072 3R6SA 3WCSA 2CWSA 4MLOA 1EV13 4PDWA 4IEQA 3WT3A 5IK8A 2HLEA 2OX0A 3TOJA 3GBWA 1RTVA 3BTAA 2D6OX 1M06G 3RJRA 1GQPA 1AR73 5CNAA 4A2UA 3V0BA 4OMDA 3W5NA 3FUQA 3ALQA 3K4AA 3QH7A 3I2KA 3FFZA 4BPZA 2X5IB 1LHUA 4YG6A 5CVRA 3LF7A 3S0MA 3DV8A 1XNBA 1EV11 3A7QA 4OUEA 5I0TA 3MHZA 4KU8A 4AE2A 2DYCA 2NYYA 1UU6A 3I59A 1OKQA 3WF0A 1PGW1 2HWD3 2OS2A 3N9MA 4F83A 2W87A 5LBCA 1JBCA 2QQVA 2FZ1A 4AI3A 5A3LA 3OGJA 4WVZA 5BNPA 1ZVFA 3PVEA 1OUXA 3AYAA 2CYFA 3NJZA 2VOXA 3A21A 2MHFA 3TNPB 3VGIA 4JKLA 4XFCA 5FO8B 4Z92B 1NE6A 2FMDA 4XZPA 2VMHA 4XTMA 4DXSA 1O5UA 3W9AA 2CDPA 2Z5WA 1NE4A 2OXBA 3SH5A 5KR7A 1W8ZA 2BRTA 2YGMA 2V4AA 2WNVC 3POGA 2X05A 1IOAA 1FMD3 2WSVA 1TMF3 1VBC3 2RV9A 5FY9A 2GC2A 4CEYC 1SG3A 4B3NA 4YFZA 1R1ZA 3VHOA 1OD5A 4D7YA 4R4ZA 4M4RA 2RM22 4E8DA 2ZEWA 2BWAA 3KHBA 5A33A 3T1MA 1RGSA 1FMD1 3KT1A 1V9U2 5ACA3 4AF9A 1QY4A 2QCSB 5FZBA 4AVTA 5DMYA 5M0TA 2DURA 2HBUA 3U4XA 3HT2A 1ZBA2 4CP1A 1LOAA 2ORXA 2DBNA 2B39A 3FBMA 1CIYA 1H6XA 5DAWA 4QQOA 2VBDA 3LPFA 1E5RA 3M2MA 3JD71 5GLVA 1LOFC 1FXZA 2IUWA 2PFWA 4AFBA 4RQPA 4BLJA 1YFUA 4HT1T 5FYCA 3W59A 1L7RA 1YO8A 4KWKA 1JODA 4TLFA 1VBA1 1QH6A 4QGLA 5C9AA 4FQ4A 1W2NA 4BXSV 5IK7A 3HAGA 3HN1A 4OHWA 1HB1A 3NMBA 1VALA 3NV2A 2WIIB 4UFKA 2BV4A 1PGSA 2GSYA 1XNAA 3ZX7A 3ZR5A 1J84A 2GN3A 2W0XA 4HL0A 1QOSA 3OGVA 1LTEA 3VBFA 3C7HA 1XJAA 2YUEA 2OZ6A 2MEV3 4XXAA 2RDSA 4QU2A 5IT6A 3J8F1 1HRV3 4W8JA 2ERFA 3POIA 2YROA 3MI8A 4CDUC 5KXBA 1FOD2 2P3YA 4PI2A 1TNRA 5FZIA 3VKNA 3O1UA 1Z0HA 3B9IA 1RUG3 5C71A 1LKNA 1I5ZA 1PVC3 2JG9A 1AF9A 2EALA 3I2GA 5EFUA 2GNMA 1WA4A 2ARXA 1HRV2 2PAEA 2PQQA 1JZ2A 4AEDC 1UOBA 1OLMA 3HOBA 1VRH3 3AMMA 5CG9A 5FY5A 2G9ZA 3DUIA 1W6PA 1J3RA 3AB0A 2R041 4FP2A 1HRI3 1J3QA 2OVUA 1B35B 4X6RB 5EYXA 1KDKA 1QWRA 4EJRA 5JSPA 4NIHA 1PO23 2IFRA 2KR2A 4ES9A 3E6CC 3I97A 1PZ7A 4NRPA 1SPPA 1HN1A 2OW4A 4KWUA 4AHWA 2A1XA 2C4XA 4AWDA 5BNOC 4QPGC 3R4DB 4JHTA 2YPDA 4MSVA 3POWA 1ALYA 2RS11 4TLGA 2ZAAA 3WOGA 1HV0A 4OI4A 5KC5A 5FZLA 5FP3A 2AREA 4N90A 2V5YA 3ACFA 4NIDA 1VBD3 4LO7A 5ABJB 1TME3 4BE3A 1FV2A 3POEA 2GDFA 2JIGA 2VVEA 3KV5A 5CG8A 3NQHA 2Q5TA 4J6GA 5DABA 4LBJA 3N9PA 2ZX1A 3SCGA 4AI2A 5JOZA 4XDPA 2FMYA 4L11A 3WDXA 3PMSA 1FPN1 1POV3 2DVAA 4LKFA 2Z79A 5IAVA 4QDQA 3PUHA 2WFF1 4B4PA 2AH2A 4YVWB 4OULA 2BBVA 1UY2A 1JMUB 1JOJA 2YC2A 4MV2A 3H50A 1SHWB 3L2HA 1UZ0A 1V0AA 2ZTNA 3VBHA 3VDAA 3PUSA 1LJ7A 1PK6B 3M3CA 3A0NA 4YVSA 4HPKB 3ZDSA 1E5IA 2XWBB 1BBT1 5CKNA 3BTXA 1TEIA 2WT2A 4LHKA 3LZZA 1CJPA 1W6OA 1ASJ3 1UL9A 5FMCA 1OLQA 1ENRA 1TE1B 3N9LA 3GBGA 5IW0A 1MEC2 4E27A 5KHKA 3V0BB 4WM7B 1ZA4A 2CY6A 2HWD2 2C24A 4Z1VA 2ZPXA 4CEYB 2VO5A 1JYWA 4XBNA 4GB31 1ND3C 1S2BA 1VBB2 4QKDA 1GOFA 1BK0A 2ZHLA 5ACA1 1SLIA 2UYBA 3A0KA 3OEAA 4YG0A 3EBRA 5D1IA 2EIGA 5FZDA 5CIRA 4EYUA 5J09A 1HB3A 1AUYA 2A75A 2WNUB 2YFZA 4G3YC 1EAH3 4ZS2A 3TRSB 2P3IA 1T6GC 3G7DA 5FYHA 1ZRFA 1IS3A 3ZM8A 1OT5A 1SDDB 3M3EA 3N3HA 5GZCA 3H8XA 1DZTA 2D93A 3B93A 4YGDA 4BQ2A 5LA9A 4HOOA 4XJ9A 5ANNA 5CFDA 4AGRA 4DS0A 4LLOA 4XQ4A 4NR1A 2JDMA 4XAAA 5FQ0B 5JAXA 2I2SA 2IXCA 1UYZA 3ZXDA 3T09A 4CU6A 4WZFA 1UN1A 3L2YA 3U37A 4CXYA 2DUOA 4Z07A 3S5QA 3O0XA 1DYKA 4H14A 1YYNA 4JRAA 4QPGB 5JOWA 1GNZA 1SLLA 2DUPA 4ATEA 3HVDA 3GJBA 1RUI3 2BQPA 2ZMNA 4XFHA 1S2EA 1SFYA 2ZHMA 3M4FA 3KHCA 4MX3A 4WM8C 2B9VA 1VE0A 5EHDA 1GICA 3NAPB 4GWNA 5IFPA 5J96B 3SC7X 2ZGRA 5ISLA 5DUUA 1UYPA 4UF0B 5FXZA 1BEV2 1NAEA 2Q0AA 4KG8A 5T3NA 3N9QA 1GNYA 1G86A 2IFWA 5T5JA 4A6SA 1A78A 5L9BA 2W1UA 1QJEA 1C8M2 2ARBA 4DUWA 2B8MA 3PU3A 5FV3A 4XCBA 2VQAA 3C7OA 4JKKA 4Q0SA 1AR63 2R043 3GNEA 1UYXA 1U0AA 4N7UA 1LOGA 4AK3A 4YM1A 3WDVA 4AI8A 2GH2A 4LKDA 4A4AA 2XDVA 2EAKA 1ST8A 1ONAA 3I2HA 3OPTA 3WNNA 3THPA 2CAVA 4HONA 5BNOA 4A41A 1G7YA 1IQAA 4D8MA 5J3UA 2QE3A 4BQ1A 5C33A 3BN6A 3UKNA 2ZXQA 4QKFA 2ETEA 2IXIA 5GALA 4BH9A 1XE7A 2RVAA 4GAZA 3ZSEA 4BWOA 5GZGA 1JZ7A 2EIBA 3RI8A 1VBE1 1ZZBA 2VZ3A 4QM9A 3LWCA 3SNMA 5I93A 5BXXA 1UOJA 4CA9A 4KGGA 1O8PA 1NQJA 3ZFEC 3IDBB 2XL9A 2JEMA 2WR9A 1RITA 1WWYA 1AR72 2DFBA 2V4VA 3DEMA 1QJY3 3PUQA 4Q4X2 3ZSMA 4LT5A 3VHPA 2GNDA 4UW3A 1D0HA 3KGZA 1G9BA 1T6BX 2J1TA 4NUBA 3AK0A 4HSLA 4DRVA 1BLZA 3LAGA 2JX9A 3NNFA 3UJQA 5AC91 4LOSA 1D4M2 1N47A 2XLGA 2BDRA 2P37A 3KV4A 1F15A 3POYA 4LE3A 3PDQA 1D4M1 2D7FA 2YY1A 2GP5A 1YIPA 4NE9A 3SHRA 1N1TA 3AP9A 5J98B 1N1VA 1RIRA 2V5DA 5FUIA 1G6NA 4AI1A 3JD72 1OD3A 5B2GB 4ZHNA 2A71A 4OI2A 2D40A 4RQPC 4UW5A 4D0QA 3TEYA 2WYSA 2DUQA 2GAUA 1DCSA 3IT8A 4LORA 3ZVXA 3VDDC 2WJSA 4FAHA 4HXCA 4LHSA 1E5HA 1GQGA 1Q3EA 1IS6A 1WCSA 5CEHA 1KRIA 4RR3B 4EN8B 4BQ3A 1POQA 2JB4A 4JC1A 1VMHA 2B42B 1MVEA 2WO1A 4XW3A 1LULA 4I2OA 5LA2A 5I0UA 1MEC3 1UKRA 5C9AC 3WY6A 4P5HA 1EPZA 3WF1A 4URTA 2O8OA 3VN4A 3ZYIB 1EAH1 2HH9A 5DUVA 5C6CA 3HNMA 4XDQA 1WLDA 1ZYBA 1REEA 2Y6GA 3I8TA 2A3XA 1RVF2 5L7OC 3MO4A 5F32A 2NQYA 4RHV1 4WVMB 2DF7A 1LNSA 1ND2A 3KCYA 3PIJA 1AL22 2R1BA 4K1YA 1QMJA 4Q4W2 4CDQC 1CD3G 4JGYB 1NA1A 1ULPA 1RB8G 5GKAC 2BU9A 4OUSA 4ZU5A 2TNFA 3UGHA 5L7OA 1S0FA 4K1ZA 1RUOA 4B1MA 4IEUA 4PHZA 2QQIA 5BNPC 4LHLA 2W94A 1D2QA 2VR4A 1S0DA 5E89A 2ZOEB 4M00A 4QX3A 5JWPA 1W90A 1XNTA 1YRZA 1H9WA 4FT8A 3V56A 2O8QA 4OVEA 2PHXA 2XLFA 1QOOA 4BXFA 4B7KA 4YW7A 1CAXB 3GDBA 2CWMA 1OHFA 4WBBA 3LQCA 4HSJA 2OKXA 2JE9A 1U5IA 4FOVA 4FOQA 5E16A 5C4WB 4AFAA 1J83A 1WLWA 3N9NA 5D2AA 4IE0A 1JYCA 2A6XA 2XONA 1OH4A 3IAQA 4IEPA 1OPOA 2J1EA 4IEXA 4AEDB 2R063 4HMZA 1AR82 1PO22 1SLCA 1A3KA 1XPWA 2QTWB 4E8CA 3PTYA 3KF3A 2K2SA 2ATFA 3BALA 4K3UA 5CKQA 2C26A 3HNBM 4GKYA 4Y1YA 2DVDA 3MPBA 4LK7A 4XURA 5KHJA 5GM0A 3WV6A 2QZ2A 2R061 2NZ9A 1QQP2 1ZRIA 4GH4A 2BUKA 2D5FA 1MS1A 1GZWA 1HW5A 2Y6JA 1QQP3 1B09A 5F6LB 5C7GA 3T0BA 4KH9A 3PVNA 1DP0A 2CDOA 1H2KA 1QJZA 3ILNA 1QKQA 1WW6A 2QQNA 3WR0A 2VUDA 3VBOB 1C5IA 3J26N 3BGAA 3KVAA 1KITA 1US3A 1QJU3 4BB3A 3KSCA 2IXJA 3E5UA 1V6KA 1REDA 2WKKA 1BEV3 2RE9A 2PQSA 1OOPA 1RL3A 1C28A 1RUJ1 4LBMA 3HN3A 4MGYE 5FYYA 3R0RA 5FYZA 5A32A 5FMDA 3AXEA 5JZGC 5CU1A 4L97A 1Q5OA 2J1AA 3CJXA 1IPSA 3ZO0B 3M1HA 4KBBA 2X10A 4M01A 4O9EA 1GR3A 3AKQA 1OF3A 3J7NA 3ZN6A 1OVPA 4SBVA 1DQ6A 1DGRN 1G9DA 1LHWA 2G1MA 2DU1A 4LEJA 2QFEA 1UIJA 4V1PA 1SFNA 3NAPC 2WN3A 2QDNA 4IEVA 5BNNC 1ZBA3 4WM8B 4K8FA 3VZMA 3N4MA 1GWMA 1R082 2ZMKA 5G05L 1H30A 3GZTB 3D6EA 4BHPA 1S4CA 5I8YA 4WM7C 2QQJA 4EWDA 1RUC3 1NLQA 1D0GA 4A3XA 2WA4A 1PNGA 3LA3A 4E2GA 1VP6A 2IC1A 1X7NA 1C4RA 1TMF1 2W1WA 3W20A 3V0AB 4AW7A 2J7MA 1TMF2 2XWJB 3D82A 3ORJA 4LR4A 5F3GA 5FR3A 2LS6A 1WMXA 3FX3A 3ZOIA 2C6SA 1PO13 5L36A 5I8TA 4Q2FA 3AP7A 2D6KA 3TN93 3E5QA 4QHBA 4RQPB 2Y64A 4UFHA 1LGNA 5LB6A 3TWIA 3ZYBA 3H8RA 4P5YA 2D5HA 4FTSA 2PHWA 4NN0A 3AL6A 5J37A 1OURA 3K46A 2VUCA 1DBNA 1GWKA 1VBB1 2ZA9A 2ZX0A 4XYXA 3RVHA 3FLRA 1NQDA 4NIIA 2VMEA 3ZFFA 1Y9MA 4MADA 2BBAA 4BOWA 3D0JA 5JR7B 1CIWA 3S57A 2PHFA 4OHXA 5FKBA 4NAMA 2OA2A 5A3OA 3ITQA 2NN8A 2GNTA 1W6MA 3O7OA 1DYPA 3AMHA 3CKHA 4XFIA 1SMVA 1JH5A 3VHRA 3ZN4A 2GMMA 4CRQA 3THTA 1NUKA 2B4KA 1VLNA 4PLOA 4Y1VA 5C3QA 3PVOA 4D6SA 1ND3A 3MUY1 3FMGA 1VRH1 2VMIA 3K51A 3WQ1A 1QXRA 1SLTA 3VBHB 4LO6B 1LEMA 1V6LA 3C2UA 1AYM1 1BVVA 4FP3A 3SH4A 2G9GA 3BCWA 3NJYA 5AVPA 3RWNA 4BZ4A 4IGQA 4YW1A 1JYNA 1O7FA 5C70A 2WQZC 1R1A1 2PHTA 4HBNA 1Q56A 3H7YA 1DYOA 3BOPA 2VQUA 1B35C 1Z7S1 2R7EB 2RMU2 3WNLA 4DUXA 1JOPA 3ACLA 5F9TA 3O1SA 4MGZE 4R9DA 4XUTA 4NMIA 4COVA 4XUOA 4LOTA 2W5FA 5FZ8A 3SQOA 1H6YA 1CGPA 2W1SA 2H0VA 4UT5A 5A3NA 3OUJA 2K0GA 2GN7A 2Y34A 1ACCA 3E1F1 2JKBA 2OPKA 3JUUA 1W2UA 3OY8B 4RR3A 4ZZ8A 5JPNB 2AGSA 4GMP1 3I3DA 4QX0A 4Y22B 4YLZA 1WLCA 2XVGA 4RGKA 1VB2A 4LLFA 1UU5A 4BQ4A 3RYKA 4KWJA 1FPN3 1H2NA 3KB5A 5FLHA 4BU2A 1CN1A 5IK4A 1RUD1 2ILMA 2VZVA 4Z2AA 4YYOA 1DDLA 2VNGA 1O59A 4AVCA 4EWAA 5K8SA 3MUZ1 1YI7A 4PIYA 1AX0A 1GSLA 3B7MA 2Y6FA 3H1MA 1W8FA 2O14A 2R042 1LODA 2H6CA 3HNYM 3IB3A 3W21A 2YDEA 2G19A 1HQWA 1Y4WA 4M3CA 3NNGA 2KXLA 4PCRA 4ZY9A 1MS9A 4NHMA 2DFCA 3LDBA 1GQHA 1OLRA 2YU2A 2RS53 5LWBA 3INAA 2VZPA 2HWE1 3ZFFB 4AL9A 2QDRA 4HKOA 3WLUA 2HWE2 1WCDJ 5FZOB 2GNBA 3CL1A 3RSJA 3VV1A 2IXHA 1ULOA 1PM4A 4UFLA 2ADEA 5LBBA 1JW6A 2HWE3 4DUVA 1OI6A 4E2QA 1G8WA 5CAZA 2HWF2 4GJZA 4B8EA 1Y9QA 2VNRA 1LOBA 1VBA2 5JXGA 1NCRA 4META 1WLTA 2PELA 1F35A 1OFNA 1ASJ1 3EHKA 3MV11 3Q9OA 3VBUA 3VBFC 2Q8EA 5CFCB 5KXEA 3BKZA 3VZJA 4EWEA 4WVVA 3TBDA 1RUNA 1CX4A 1YFWA 3AZVA 2RJKA 4AEJA 1OOPB 1O4ZA 1I5PA 3MFAA 2P17A 4F7ZA 4K6BA 4XFAA 5A6XA 3LDKA 2ZS6B 4YGCA 1N3PA 3TEWA 1F4AA 3LE0A 3QH6A 3M3IA 4IV3A 4ISRA 3DGTA 4RR3C 2A6YA 4UF0A 1GZCA 4C91A 1VBB3 4XE9A 2YMZA 3DPRC 1XYPA 5I0RA 4KU7A 3FHQA 4KBZA 4NO4A 3EMRA 4R9AA 1H1IA 2YYOA 4NIGA 4YG3A 4CPBD 1PMIA 2R49A 4QD2A 4YW5A 4KMQA 4Q4Y1 5E6HA 4IV3B 5FRAA 3JB8A 1GWLA 3UGFA 4AI9A 3V64A 4XVHA 4CDXA 1LHOA 4PIZA 5A7WA 2HEWF 1W9TA 1H0BA 5BUVA 2DTWA 4W4ZA 1URXA 1PMHX 2W92A 3ZN5A 3BOWA 5FXXA 4WZCA 3POBA 3B3QE 1IHMA 1SBFA 1UY4A 3Q8AA 4JX0A 2BFUS 5H9PA 1ZBE2 3C7FA 1PVC1 4BA6A 1COV3 4MXWB 1S2KA 3CNAA 5KHGA 1NX9A 1SCRA 2X8KA 2D6PA 3LFIA 4XXPA 1ZRDA 4L99A 1CVNA 2CSGA 2WNVA 4I02A 4BM8A 2DCYA 1D2SA 4I3GA 2HWC2 3BTZA 5F5AA 2WWSA 4YNIA 5C8CC 3U0ZA 3NV4A 4ISQA 2DVBA 2XBO2 1QXJA 4FXGB 2EIEA 1PO21 2PXJA 3OBRA 1WBLA 4XF4A 1AR81 1GP6A 4BDVB 4LPLA 1NG0A 1JTZX 4QB2A 2RS12 1MS0A 1J59A 4R9CA 5ACA2 1GLHA 3BI3A 3JBG1 5LCWL 4WM7A 1BQPA 1MZFA 4A42A 4CE8A 4GXLA 1R092 2UWCA 5A70A 3JBG2 2RM23 1W9FA 1VBD1 4AEMA 3ZYFA 1VIWB 2UY8A 1V6OA 4FXKB 3FHAA 2WT0A 3FBYA 3HMYA 2VNOA 4UFMA 2WABA 4CP0A 1W2AX 4FFHA 1C8NA 2VZOA 1FMD2 3KD4A 5FYMA 4IW3A 1PK6A 1RMU1 5FMOL 1IPJA 2JE7A 3QOPA 4NPRA 1UOGA 4YW6A 4PDWC 5FZ7A 3P3PA 2ORZA 1CAVA 1OUSA 3ZFGB 2BTVC 1POV1 2D3PA 1RUF2 5AVAA 5JUVA 3SEPA 5IVEA 4B4QA 1YEWA 4JV4A 3HJRA 3RZLA 1PVC2 1OOPC 1PIV3 1W8HA 3ETQA 4XHBA 1GV9A 1RUE3 3LIHA 4QQLA 3ZSJA 1UQXA 4OQ8A 1TME1 3FC0A 3O1VA 2ZX4A 4RHV2 1UZZA 4R9BA 4N43B 3E5XA 4AVAA 3WDUA 1ND3B 4E4ZA 1RUF3 1JUIA 1XNCA 4J1WA 4K40A 3PVBB 5F3EA 1WD4A 3DN7A 4ES8A 1R083 5ABJA 2D3RA 3GZAA 1RUE1 2FHRA 2VVFA 1ND2B 3O5SA 2VTXJ 4MGSA 4N53A 5LBEA 2PYTA 3JQWA 2X29A 4V2VA 5HV4A 4WVMA 1D4M3 3JCIA 5A6ZA 2YBSA 2JICA 3N7LA 2FD8A 4AFCA 1RUF1 2JG8A 3GZEA 4QPIC 1SPPB 4S2FA 4CCKA 1X9TA 4I01A 1FI2A 4Q29A 3VBSB 3ZXKA 3CIHA 4Q26A 2HWF3 2FDFA 1NZIA 4NPLA 1PGL2 3WQ0A 1O3RA 1UZVA 1V6JA 1BXHA 4GD4A 1O8SA 4PF1A 3X29B 4HVQA 4O7XA 4E4DX 1BZWA 2VUAA 3AFGA 1MS3A 3E6BA 3Q8BA 4XF1A 3H1WA 1CAWB 4P02B 4GQ7A 4QXKA 4Y1ZA 1Y7BA 4KQ7A 2GMEA 4H55A 2VW2A 1HRI2 2XBO1 3VZOA 4AVBA 1VBC2 2GU9A 4PF5A 2XLAA 3BU7A 5FAXA 4DB5A 2VZ1A 2YU1A 2ZGTA 3J8F2 3U14A 1OC1A 4CCNA 5JI9A 5C3OA 3I3EA 5D8AA 1X9PA 3AL5A 3ZXJA 1YNAA 2J1VA 2YGLA 4C0BA 4DXTA 3V65A 1UX6A 4FFFA 2BOJA 1RUG2 4LIVA 4P00B 2NMOA 1YI9A 2DCZA 1FNYA 5FUPA 2XJQA 5E8AA 4YM2A 5BNOB 3AZZA 1AJKA 3T2QA 4OFGA 4MXWA 2UYAA 3LA7A 3ZKUA 2QBXA 5LATA 2JDPA 3KCCA 3KWVA 5EP9A 2XJSA 3ZYPA 3AYCA 4FFGA 2JIJA 3NO8A 1AYM2 3MF6A 1ZRRA 1DGWX 4J25A 4LKSA 5CKMA 3OUHA 2UWBA 1HQLA 5A7WB 5B4XA 3VLBB 2B46X 4N8MA 3S30A 3POJA 5FYSA 5C8CB 1OQDA 3A23A 4B4RA 4Q5OA 4I09A 1QDOA 5A33B 1TQ5A 4EROA 3SISA 4C90A 1FAYA 4FPCA 1PZ9A 3CJIC 5A7PA 1Y43B 4Q27A 3M8LA 1WD3A 2RM21 5BPXA 3I2DA 5FZ9A 4BISA 3A22A 2Q4SA 1ENQA 2QQLA 4PBPA 2YV8A 3HQRA 4AOCA 3C3VA 3AFKA 4YFWA 1QJU1 2HWC3 1RJ8A 3D3AA 4GMP0 4JTNA 2QUOA 5D8AC 5GLTA 1DF0A 2VOTA 4DXZA 1UIKA 3H8UA 1HXS2 2PHUA 1IQDC 5T55A 2WLQA 1QQP1 1LCLA 5GLWA 1OQEA 1JXNA 3ON7A 3I59B 1H8TA 4GALA 3IWZA 1W9SA 3IN9A 2BWCA 4SLIA 3WP4A 5EJ3A 1MQTA 3ENRA 1TVGA 3RYRA 2X5IA 4IE6A 1VRH2 2LROA 3ACHA 2DTYA 2X53S 4HVOA 5IK5A 4OHVA 3TEXA 1WKYA 4CZSA 4YM3A 2X09A 1Z78A 2VOKA 3ZFEA 1US2A 1BHGA 1SLBA 5JXIA 5LK7B 1XRUA 4QM8A 5F5QA 1I1EA 1YQ5A 2VQTA 4ONUA 1O3QA 3OEBA 2HWD1 4Y1UA 4A7YA 2HYKA 2EXIA 1NZCA 3WUCA 1SQ4A 3ZFGA 4CCMA 2J22A 1AJOA 2R0HA 5CADA 2UURA 1C1LA 3APBA 4OLLA 2ID4A 1A6CA 3KCXA 4A45A 1QH7A 2RJ2A 4P9WA 3IBMA 2C1FA 2MNGA 3BVCA 4FPFA 4YVSB 2AC1A 4JGYA 4N53C 1MEC1 1PNFA 2W91A 3URFA 1AXYA 3MEPA 1V6IA 4YWAA 3VBRA 2DWRA 3MIEA 3RQ0A 4QXHA 4TWTA 4BIOA 5FXVA 3ZMOA 3JQXA 4YVWA 1V9U1 1YCIA 2ZGLA 2EICA 4AEKA 1W8OA 2JG8B 2JKXA 4YARA 1R093 5FPZA 5DDJ3 3WSOA 1QJX2 1QJY2 1AL21 1RHI1 4CP9B 3BODA 4IUGA 4N53B 4AG4A 3RWKX 2XJVA 3J4UH 5FP4A 4K21A 3HWJA
chains in the Genus database with same CATH topology
5CFCC 3CU7A 1C5HA 3OY8A 2XBO3 3IIAA 5L7OB 1UAIA 3MZHA 4JCKA 2WNVB 1NA1B 2WZR3 4LBQD 1KJLA 4N7IA 1YJKA 3OTFA 2I07B 1OA2A 1N1SA 1ZZ7A 3MIHA 1N3OA 4QQHA 1YHFA 2Y0OA 1ZBE3 1C8M1 1EAH2 3IM0A 5JOXA 3PNAA 4GA9A 4CTEA 3GYDA 1V00A 3VDDB 1W6PB 1J1LA 1FOD3 4IEYA 4WV8A 4Y20B 4OI0A 3AKRA 2PA7A 2WS93 3ES1A 3WHTA 5LK5A 3LOIA 1HRV1 3J9SA 5C8CA 3WW4A 1W6MB 4R4XA 5FBZA 3B02A 4NOTA 1RUD2 1YFXA 1FOD1 3ILRA 4JGZA 1A8MA 4B7EA 4JDOA 5KC6A 2VOVA 1PGL1 2IXLA 3GHMA 5CFDC 3MDPA 4Q4V1 1IZ3A 1BVP1 4OUMA 3VBUB 3NV3A 1YXWA 4ASMB 4R52A 2MPFA 4U2AA 3MW3A 2HWC1 1DIWA 3D8CA 3E97A 3ES4A 1V6MA 5F6KA 1BBT2 3LSEA 5H9RA 1UKGA 4IV1B 2FQPA 3IDCB 2NPIA 3ELNA 4ITCA 3ZXFA 1LU1A 2RS13 2YHJA 4FPOB 3IPVA 2PHDA 3CEWA 3WG3A 4C1XA 2Y0IA 3NKTA 2PN5A 5DZGA 2D98A 4JGZB 3CLPA 3AJZA 1COV2 3BIWE 4UBHA 4IV3C 4XTPA 4W6WA 1POV0 1DHKB 4XF9A 3OD4A 4LBOA 2G9FA 2RR13 4I0WB 4L8QA 4HKLA 1SLAA 2W08A 4LO5B 4HFSA 3VBHC 2CGPA 1F5FA 4XQWA 1KXGA 4QT6A 3T2TA 3KQRA 3VBUC 1H4GA 1NYWA 3JU9A 4JAAA 1BEV1 1JHNA 2D44A 3U07A 1ZREA 4XJAA 2GZWA 4LBLA 5BNQA 1V70A 3MW2A 3LA2A 2R32A 4PJYA 5CFCA 4QPYA 4CYDA 1SCSA 1NCRB 2UU8A 1KJRA 5JDBA 1NLRA 2QQPA 4EN9B 2Q30A 2Q1MA 4K9SA 4XMIA 3EQEA 3VKOA 4XFFA 2WNUA 2BNNA 2VXRA 5AFEA 3SLIA 1AYN1 4XJWA 5KHIA 3GBFA 3JD73 3OBTA 5HBAA 5I0SA 4XFBA 1RUH3 2JG9C 3SH3A 3VBRC 4QPGA 1VBA3 4BMBA 2TEPA 4JGYC 3RRDA 3QBQA 1VAKA 1OA3A 2X5IC 3GF6A 3MLJA 4L2NA 1W39A 1DFQA 4FBFA 1DG6A 2P3KA 1WW4A 2UY9A 2JENA 4AEDA 2EAAA 1SDWA 1UF2C 1FATA 4DINB 5JOYA 4HZFA 1RUH2 4AYUA 3AX4A 2AZ5A 5LEKA 4Q4Y3 3DF0A 4FTBA 1OA4A 2Y26A 4QPIB 5GZFA 1DGWA 1LECA 3D4KA 3H3UA 4Q4W3 4UXAA 5DUXA 3ZFEB 4PDWB 3WG2A 1Z7S3 2GALA 1AR92 1SBEA 3S7IA 3AKTA 3R4UA 4Y4YA 5FREA 5EYYA 1RVF3 3AM2A 3O0VA 2BVBA 2WA3A 4IQPA 1COV1 5FLIA 1MQTB 3ECQA 3NL1A 4Q4W1 3J8F3 2ZGPA 5KWRA 3TN92 2ZMLA 1OQ1A 4GMP3 2N7GA 1RMU3 1FPN2 1K5MA 4CDWA 2ZHNA 1S0JA 4IL7A 2VUJA 2CAUA 2XPJA 4J1XA 5T5PA 4K7JA 2VQ0A 1E57A 1A8DA 1S0BA 2AENA 2R062 1XYNA 2ZGUA 4IEOA 5E1RA 3H0OA 4DPNA 2B5HA 5FO9B 3CJIA 4IV1C 3USUB 1W6QB 4HETA 4MZUA 1F5JA 3RI9A 1NXMA 5TSWA 1ZX5A 1F2NA 4C1WA 1VBE3 1ULEA 4FVVA 1CPMA 4IEWA 4O9GA 1EV12 3WW3A 2QVSB 3IKWA 2A5ZA 3U11A 2Z42A 3ROUA 2ZGNA 4IESA 5T52A 2RS51 4EV0A 4RS5B 4AQ6A 4BIFA 1V6NA 5T5OA 3N7MA 1BBT3 1C1FA 3SCHA 1LRHA 3WINE 2QJVA 4Q0PA 3M70A 2YPJA 1WBFA 1HIXA 4KNCA 4P9IA 1PGW2 2AYHA 1FV3A 2D6NA 4YW3A 4GB33 1AX2A 1SBDA 1R081 3HT1A 4H7LA 3S7EA 1GZWB 1ZRCA 3KT4A 4Q0QA 3TAYA 2VW0A 1I9RA 4MGIE 2NMNA 2OUJA 4YW4A 5LRRA 4XF3A 3KS7A 4MVTA 2QNKA 3W58A 1HQNA 2Q8OA 4QQPA 1AR62 1QJX1 2DCKA 5JSOA 2V09A 3B9CA 2D3SA 2W39A 1KQRA 1AXZA 1LENA 1N3QA 2E53A 5C9AB 3FWEA 4JDMA 4TSVA 2JG8C 4Y5Z0 2HWB2 4D94A 4P9YA 3OYWB 2ZBJA 4Z2WA 4LULA 4TYSA 3N7KA 2R1DA 1IPKA 1BJQA 3WG4A 1F31A 5I91A 1XU2A 4XJUA 3ZSLA 5KXDA 3VBOA 1LGBA 4Y22A 1ZZ8A 1NXD1 5F1RA 5DDJ2 2HKXA 1VBD2 1MZEA 5JLVA 3WG1A 4HN1A 1KFXL 3HQXA 4N43A 3LKJA 2R6QA 1XNDA 2IXKA 4MXVA 3MLLA 4NVPA 4S2GA 5FOJB 1W6QA 4YZ5A 3ZXAC 1KDMA 1O5LA 4LBNA 3CJIB 2PHLA 1KFUL 3AMNA 1PK6C 1NY71 4A7ZA 3LGRA 4KWLA 3I4IA 1CAUA 1LESA 4RSUA 3ILFA 5DUWA 4YZ4A 4FPEA 4LHNA 1YIFA 3MIDA 4HK9A 5FO7B 3PHMA 3RZZA 4NWWA 4N9IA 2GC1A 1K5MC 4CDWC 1BYHA 3SXWA 4QGMA 1AR83 3M3OA 1U5ZA 3AKSA 1MS4A 2LM3A 1CAXA 2ET1A 2YXSA 3KT7A 3VL8A 3DKWA 4Q4Y2 3RYRA 4XF0A 3JBG3 2ZACA 2E51A 2RS31 5HI0A 5LRSA 2VECA 1CQ9A 2P3JA 5GLUA 1NOVA 1U12A 3PJYA 1ZZ9A 3VZNA 3VBRB 2GMPA 3AKPA 5FOBB 1U5XA 3MYXA 1NCQA 1O4YA 1UPIA 1AVBA 2HJIA 4DZGA 4UBGA 4YZ1A 4LUMA 1OPMA 2AUYA 4LBKA 5FTTC 4M0NA 3LOBA 4FTEA 2R16A 3N7JA 2PTMA 1H9PA 2LALA 4JRLA 3KGLA 5EV7A 4Q8LA 1ZM1A 2WZPP 5EWSA 3AP5A 3KM5A 4B29A 1BMV1 1XQNA 4JVAA 3IMNA 1LB2A 2HWF1 2IZWA 2Q1ZB 3CF6E 3DPRB 2ZCWA 3WCRA 1SEFA 4W6XA 3T1LA 1PIV2 3MICA 5GZEA 1X8MA 2D6MA 4LUKA 1N1YA 4X6QB 1ULDA 3AMPA 4FPYA 4Q1PA 2B9UA 1CESA 2HEVF 1DQ2A 1F9KA 1MR5A 4HN0A 2WNUC 4F3JA 2ET7A 2A7AA 1IS5A 4GB32 2VG9A 1NCRC 5GLZA 2DCTA 4AGVA 2G4IA 1DQ0A 2W68A 1R091 1QXPA 4XETA 2C9AA 3FLTA 5DG2A 2EA7A 3NW4A 1BK1A 1C57A 4FPLA 3MLKA 2D97A 2DU0A 4PQ9A 1DQ5A 3ATGA 3LB9A 4MYEA 4EN0A 2NM1A 2PAKA 4XBLA 4LTAA 1QNYA 4LA3A 4COYA 2QKDA 2ZABA 5DZEA 2WZR2 5J7MA 3LCPA 3N35A 3WXPA 1ZBE1 1H2MA 1VBE2 1XXNA 3TYJA 3VBFB 1CAWA 1ENXA 1TME2 4Q8KA 2WLPA 3NWKA 1FX5A 4UW6A 1VB4A 1BCXA 4AVVA 1XYOA 1PM7A 3ZSKA 3H1YA 1IS4A 4D7SA 1NCQB 1QJU2 3AP4A 5J36A 2RJLA 3NVCA 1M4WA 3FHIB 3PMEA 5FDBA 4MH0E 1RMU2 4Q1RA 3VBSA 4CEWA 3UK9A 1MS8A 5DG1A 2WSUA 3ASIA 4RS5A 4MGKE 5LEJA 1NCQC 1GKBA 1S0CA 3DL3A 4H3WA 5L73A 3BPZA 2BNOA 4JGZC 3ZXGA 2RS33 3RPQA 1ASJ2 2UWAA 3QD6A 4Y20A 1J1TA 4D69A 1UD1A 1MACA 4AGGA 1LR5A 1R1A2 2GC3A 4BCUA 3RYPA 4BMEA 3USUA 4YZ2A 1S0EA 4Q4X1 3EJKA 1AR71 2BNMA 1Q43A 2WC2A 1JN2P 5CFDB 3O0WA 1VAVA 2XG3A 1WMDA 1HXS1 1OMIA 3D5OA 3GHNA 4AQ2A 1AYN2 2A73B 3B00A 4QX5A 1RUC1 1D4VB 4XOGA 2VH9A 3VL9A 2WINB 2JDZA 2A70A 3ME2A 5A3MA 3GALA 1FT9A 3WP5A 1ZZCA 1J58A 3OF1A 4AQSA 1H4HA 2XH6A 3HBZA 1V9U3 4G4FA 4PBOA 4XJ8A 1DQ1A 1EY2A 2ZKLA 3MFCA 1RHI2 3MIFA 1QOTA 5H9QA 3MF9A 4DY5A 4CEWB 4COUA 2IWGB 1AL23 3WDWA 5BNNA 2RS32 4XMAA 1CAVB 2EVXA 4F8AA 5K0UA 5C8WA 2CTVA 4LBQA 4PIXA 2C5DA 1LGCA 4Y24A 2XVKA 4FOWA 1DGRA 2BW8A 2XUMA 4L92A 4QGNA 3MW4A 4XIKA 3HR9A 2XJPA 4GIQA 4HANA 3ZMNA 1S55A 2VW1A 5JZGA 3IDEA 5CA6A 2PHRA 2P34A 3WP6A 4FOYA 5FCCA 1G9FA 1SACA 1PO11 2E7AA 3AZWA 3AYEA 4CDXB 1HX6A 3G6JB 3ZIWA 4XBQA 2CGOA 2MEV2 1RUG1 4EN7B 1VAMA 1UCXA 2EXHA 3A4UA 5SV8A 1J3PA 2WS91 1MZ6A 3UKVA 1WW5A 2BEOA 2EXKA 4LO4B 3WDTA 2H0BA 4JQRA 3WNXA 1VJ2A 4GH4C 5GJ6A 1YLLA 3RS6A 1X8EA 1I3HA 3WHUA 1DU3D 4I3PA 2A3YA 1H8TC 4PLMA 3FUOA 3NKGA 3MIGA 1WW7A 1G9AA 3AYDA 4X8NA 2KA3A 2JXAA 4CDUA 5JPMB 2VVDA 5J48A 2FZ2A 1R1A3 3K48A 4LNVA 2BPA2 1MQTC 2FBEA 2BGCA 4P9LA 2XGXA 1LHNA 2RS52 4RGAA 2HEYF 3NSTA 2EF6A 2GC0A 4YSFA 2E7TA 1FYUA 3H9AA 2QZ3A 3QLQA 3S6PA 4OHZA 1YWKA 1NY72 1PO12 1WMEA 4OZXA 4Q4V3 1GYKA 5FLJA 1HLCA 5L19A 4BLIA 4IETA 1JYIA 4BYYA 2RHPA 2VPVA 1KS4A 1Z7S2 1K5MB 2RMU1 3IPVB 4KG0A 4CDWB 2E6VA 3I7DA 4ZU7A 5C4WC 1NA1C 1VR3A 2NLRA 4XPVA 4IV1A 3RNSA 2YZ4A 3GZUC 5C4WA 5K0UB 3AXDA 3M7AA 4XHXA 4AI0A 4DOUA 4HKWA 4Y1XA 2E9QA 1FNZA 2DCJA 3R05A 2I45A 3ST7A 1BKZA 4CEYA 3P3NA 5T5LA 1RUI2 3AZYA 2SLIA 3WZ1A 2D6LX 2Z69A 2H6BA 4X8PA 4JTOA 4CDQA 5KHHA 1ND2C 1QJX3 2ZKNA 1EP0A 2PLV3 4M3CB 1CONA 2A6VA 1OSGA 4NWVA 2TUNA 3WX5A 4I0AA 3FJSA 1LOCA 3VDDA 4FSJA 1RUH1 1Q8SA 2PLV1 2XKOA 4GULA 5KXCA 1LEDA 2P2KA 1QU0A 4FQZA 4XEZA 2VGDA 2EXJA 4P9JA 4FAGA 4S2HA 1VBC1 4HLTA 4ORFA 4AHXA 5BNPB 3AMQA 3POSA 3NV1A 3ZIXA 5BY5A 4K20A 2F6BA 2YC0A 4XIOA 5GZDA 1QGLA 3SITA 5JCTA 2AR6A 1RUE2 4IEZA 3QCWA 4P9XA 3FE5A 4AVSA 4L9BA 3VKLA 1CJDA 2D43A 4RFT0 1TNFA 3RMYA 3B94A 2WT1A 3D0SA 4GWMA 3U10A 2XL7A 3WVJA 5EXOA 3ZXEA 3N36A 2RR12 1Q8QA 2E63A 4QPIA 3FZ3A 3RJ2X 1PVXA 3OJBA 2Z2SB 2JECA 3OYWA 4PLNA 5JVVA 3VHNA 1W6NB 1GFF2 5JMCA 1I6XA 5KBFA 4NHLA 3ZYJB 5ABJC 1UU4A 1U5YA 3ZXLA 2HWB1 2ZGOA 2F4PA 2ZX2A 1LHVA 3WUDA 3ZYGA 3KLSA 1DZQA 4DNYA 4Q0VA 4W6YA 5T54A 5K0UC 4AHZA 4ASLA 2NP0A 2XJRA 2HWB3 1DLLA 5JSRA 1ZNPA 1REFA 4ZU4A 1RVF1 5HCAA 2E7QA 2A6ZA 1EYBA 3O12A 4DFSA 1H1MA 1QJY1 4RA0A 1H8TB 3USSA 3HIFA 1H8VA 1QDCA 1RUD3 3WP3A 1X33A 4DY3A 4ZXKA 4CDUB 4CP2A 5T50A 1H2LA 2I74A 5A32B 2VULA 3B5LB 3MPPG 4DQAA 3TNQA 2A3WA 3MGUA 1APNA 3RMXA 3WQ7A 3PLQA 5K7PA 2WFPA 2C0ZA 2BFUL 2XHKA 4WM8A 5BV6A 4Q4V2 2WQ4A 2CNAA 1C3HA 4DRRA 5CBLA 1XNKA 2O1QA 2V73A 4GKXA 1ULFA 4Q0UA 1F8VA 4YRDA 3ZN6B 4AFDA 5AC93 1AHSA 1DZRA 3AJYA 4FPKA 4GH4B 1QNWA 2WFF3 5DZFA 2ENRA 5JIAA 3QACA 1GANA 2CL2A 4AHYA 4XJZA 1HDKA 4OHYA 1RC6A 2R30A 3LSDA 4RD7A 4CEWC 5K9YA 4KL1A 1XE8A 4CDXC 2WL1A 3UL2A 1CR7A 4YVSC 2OUHA 1H1AA 4H7MA 1AZDA 4FO9A 2VY0A 5HCBA 3DPRA 4RS5C 5FMOS 1HKDA 2LTNA 2WFF2 3EO6A 5EZWA 4DMIA 1AX1A 5BYNA 3FFQA 1QHDA 3JZVA 5E88A 3VBSC 1Q8VA 4RHV3 4UW4A 4KGQA 1RUI1 2XJUA 3UV9A 3B69A 1WUVA 4LE4A 3AP6A 4N9HA 1GZ9A 1EPWA 3R4SA 1OFSA 1CPNA 1C8M3 2VU9A 3HD8B 4FCAA 4LBQB 4YVWC 1CAUB 4RGGA 4NHKA 2LUWA 5BNNB 1W0OA 1X82A 3EXUA 3FLPA 1G9CA 3RG0A 1UPSA 4Z82A 1AR61 1WGPA 2ZZQA 4E4SA 4FPGA 1RINA 4A7KA 5JI7A 3RDIA 1RUC2 3ZFGC 1O3TA 4IXLA 4RL7A 4MUVA 2TBVA 3I54A 4YGBA 4D3WA 2XKPA 2A6WA 1YJLA 2ZX3A 2XVLA 3OGGA 2Y38A 1PZ8A 2CV6A 1KD7A 1MS5A 4COZA 1ENSA 5AFBA 1L3JA 3SMHA 1GNHA 3WW1A 1HV1A 2R071 2VMGA 5SV5A 1RUJ3 4U36A 4COWA 2ZJCA 1AL0G 4INDA 4Q4X3 1B35A 5FPXA 2ZHKA 5JIUA 1XU1A 3TB0A 1LOEA 3VKFC 1ZZ6A 2DVFA 2CGNA 1PIV1 2XB6C 1QF3A 4AQTA 1LOFA 4G9SB 2JG9B 4QQ2A 4D7TA 2WS92 1ZBA1 3ZYRA 4ATFA 1IKQA 2RR11 4YGEA 4P9GA 4XQDA 1PHMA 3WDYA 5HCFA 2ZGKA 1LU2A 5CB7A 2B45X 4I0BA 3AZXA 2SBAA 1NLSA 4YZ3A 1WMFA 2B7YA 2JJ6A 3H3ZA 2XJTA 1ULCA 3O14A 1JUHA 3BB6A 3UKTA 1O91A 1HXS3 2ZAHA 2R0FA 4M3CE 4R8HA 4XILA 1ULGA 3MIBA 4ZKTB 3V0AA 4E9KA 3B01A 1WCKA 4LA2A 1RHI3 3TN91 4QMAA 4HVRA 1Q8OA 4XFGA 4Y26A 1O3SA 4HK8A 2BVVA 3ZFFC 1GBGA 1W0PA 2WZR1 2OIIA 3OCPA 2PLV2 3ZPYA 1AYN3 2GH8A 3OD0A 1UW8A 3L9JT 3VZLA 1AXKA 1DQ4A 5H9SA 2OYZA 1Q8PA 3JB4C 1YUDA 2O0OA 4JDNA 4N43C 4EN6B 5DDJ1 2BYVE 1W6NA 2K9ZA 1O4TA 1S0GA 2WNEA 2ZGQA 4M3CF 4FPHA 1AYM3 1UZYA 5IUQA 4Z8BA 5AC92 2ZGMA 4WVWA 2KM2A 1Y3TA 4P14A 1UMZA 1MZ5A 1X50A 5FQ0A 1IKPA 3SCFA 3VUOA 1YFYA 1X36A 4YW2A 1AR93 2DVGA 4S2DA 4C0HA 5FFOC 2MEV1 3NAPA 3OPZA 4FPJA 3VBOC 4AXOA 3WD5A 4YM0A 2OZJA 2ZZJA 5D8AB 4LO8A 2VOWA 2W52A 1IGOA 3PJQA 5I8SA 4OI1A 1BMV2 1AR91 4M0HA 3VZKA 3E6DA 2ZGSA 2PAMA 4I30A 1HRI1 1RUJ2 3WW2A 1MVQA 5JZGB 1W6OB 4TZDA 2ES3A 2RMU3 4AFMA 3H7JA 2DV9A 3KMHA 1S1AA 1S0IA 4W65A 1RJ7A 2R073 4IERA 4E2SA 3UJOA 3CO2A 4HPKA 3KZ4C 3M3QA 5DXDA 1DGLA 2JD4A 1KS5A 4CDQB 2R072 3R6SA 3WCSA 2CWSA 4MLOA 1EV13 4PDWA 4IEQA 3WT3A 5IK8A 3TOJA 3GBWA 1RTVA 3BTAA 2D6OX 1M06G 3RJRA 5CNAA 1AR73 3V0BA 4A2UA 3FUQA 3ALQA 3QH7A 3FFZA 4BPZA 2X5IB 1LHUA 4YG6A 5CVRA 3S0MA 3DV8A 1XNBA 1EV11 5I0TA 4KU8A 4AE2A 2DYCA 2NYYA 1UU6A 3I59A 1OKQA 1PGW1 2HWD3 4F83A 5A3LA 1JBCA 4AI3A 2FZ1A 3OGJA 4WVZA 5BNPA 1ZVFA 3PVEA 3AYAA 2CYFA 3NJZA 2VOXA 3VGIA 2MHFA 3TNPB 4XFCA 5FO8B 4Z92B 1NE6A 2FMDA 4XZPA 2VMHA 4XTMA 1O5UA 3W9AA 2Z5WA 1NE4A 3SH5A 2YGMA 2WNVC 1IOAA 1FMD3 2WSVA 1TMF3 1VBC3 2GC2A 4CEYC 4B3NA 4YFZA 1R1ZA 3VHOA 1OD5A 4D7YA 4R4ZA 2RM22 2BWAA 5A33A 3T1MA 1RGSA 1FMD1 3KT1A 1V9U2 5ACA3 4AF9A 1QY4A 2QCSB 4AVTA 2DURA 3U4XA 3HT2A 1ZBA2 4CP1A 1LOAA 2B39A 3FBMA 4QQOA 3M2MA 3JD71 5GLVA 1LOFC 1FXZA 2PFWA 4AFBA 4RQPA 4BLJA 1YFUA 4HT1T 3W59A 4KWKA 1YO8A 4TLFA 1VBA1 1QH6A 4QGLA 5C9AA 4FQ4A 5IK7A 3HAGA 3HN1A 4OHWA 1VALA 3NV2A 2WIIB 2GSYA 1PGSA 3ZX7A 2GN3A 2W0XA 4HL0A 1QOSA 1LTEA 3VBFA 2YUEA 2OZ6A 2MEV3 4XXAA 4QU2A 5IT6A 3J8F1 1HRV3 2ERFA