2MEV2

Structural refinement and analysis of mengo virus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
249
Chain Sequence
ENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGEHPASCADTASEKILAVERYYTFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGATLRRHYLVKTGWRVQVQCNASQFHAGSLLVFMAPEYPTLDVFAMDNRWSKDNLPNGTRTQTNRKGPFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLTYSTGASTSLDITASIQPVRPVFNGLRHEVLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
total genus 51
structure length 249
sequence length 249
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev200
1MQTC 1FMD2 1QJX3 5CFCC 1QQP3 3ZFGB 2HWD2 1CJDA 5BNPA 1QJY2 4WM8B 2RS51 1ND3A 1HXS1 2HWF3 2TBVA 1K5MA 1TMF1 1V9U3 1ZBA3 4IV3A 1ZBA2 1RUE3 2BPA2 5A32A 4Q4X2 1AL21 3HAGA 1TMF3 2HWD1 1RUG3 1NCQB 3ZFGC 1H8TB 4QPGB 1VRH2 3VBUA 5C8CB 4YVWC 2RS52 1AR82 2X5IA 3M8LA 3LOBA 3JB8A 4IV3B 1TME3 1VBA2 1ZBA1 4RS5B 4N43B 1POV0 5J96B 1FPN3 4QPIA 1VB4A 1M06G 1NA1A 4Q4X3 1WCDJ 1AR81 1HRI2 4RR3C 1NCRB 1OOPC 3VBOC 2PLV3 1VBA1 1AR73 2XBO2 2R073 2WFF2 4FSJA 5DDJ3 1C8M3 1HRV3 4IV3C 4Q4Y3 4EJRA 3FBMA 4FTBA 1NCRA 2RR11 3VBRA 4CDWA 4RQPC 1ND2A 4N53C 1QJU3 2R042 3ZFEC 3VBOB 1RUC3 1RUH2 2WFF3 5BNOC 4Q4W3 3DPRA 1HRV2 3CJIC 4WM8C 3ZFFB 2BBVA 1MEC1 4CEWC 2MEV3 4Z92B 1GFF2 1C8NA 4GH4B 3VBFC 1NCQC 4JGZA 1RUD3 4CDQB 5C8CC 3NAPA 2RM21 1MEC2 1RUH3 3CJIB 3VBFA 3ZFFC 1AL23 4WM7A 4CEWB 5JZGC 2WS92 4PDWC 2R043 1EAH1 4RS5C 1HXS3 2HWF1 2WZR2 4CDUA 3VBHA 4CDQC 4NWVA 4CEYC 4CDXC 5CFCB 1PVC1 4Q4V1 1D4M1 1B35C 2HWF2 2WZR1 1QJX2 2RMU1 1A6CA 1AUYA 1RUE1 2HWC2 3VBRC 1RMU3 1AR71 5K0UB 1QJZA 1VBE1 1EV12 1RHI2 5L7OB 5DDJ1 1POV3 2RS53 3JBG2 1PGW1 1QJX1 5J98B 4RHV1 3ZFEB 2VQ0A 1RUC1 2IZWA 1AYN2 1AR72 1R082 2HWB1 1OOPB 5GKAC 1AR61 1AYM1 2R072 3VBSA 3JB4C 3ZXAC 1PIV2 5L7OC 5A32B 1V9U2 4YVWA 4JGYA 1PGW2 1HRI3 4RHV2 1NCQA 5C8CA 1AYN1 1PO22 1R081 2HWB2 1FPN2 1AR62 4WM7C 2MEV2 3ZFGA 1PIV1 3NAPC 1H8TC 4QPGC 4YVWB 1QJY1 5JZGB 1ND3B 3CJIA 1K5MB 1TMF2 4QPIB 5C9AC 4CEWA 5BNOB 4IV1B 1PO21 1VBD3 4Q4X1 3IDEA 5LK7B 3J8F2 1EAH3 3DPRC 2RS13 1AR63 1VRH1 1RB8G 3VBHB 1VBC1 1RVF3 2HWE3 5ACA2 4RHV3 2GH8A 4GH4C 1AR91 2DF7A 4GB31 1RVF2 1ND2C 2HWE2 4JGYB 4SBVA 3VBRB 5ACA3 2PLV2 1R1A3 1ZBE1 2ZZQA 1VBB2 1Z7S3 5AC92 1HRI1 5ACA1 1DDLA 1RMU1 4YVSA 1AR92 1E57A 4GB32 1SMVA 5CFDA 4GMP3 2WFF1 4GB33 4JGYC 2PLV1 1EV13 1VBB1 5D8AC 3VBSC 5A33B 2RR12 3TN92 3JD72 5AC93 2RS32 2R041 5ABJA 1ASJ2 2RS33 4Y5Z0 3JD73 4WM7B 1NCRC 1RUH1 1QJY3 4GMP0 4AEDC 1R083 1ND3C 3JD71 1K5MC 1AR93 1RUI2 5K0UC 4LLFA 4CDUB 3VBUB 1OPOA 4CEYA 4CDXA 1ASJ1 4RFT0 5ABJC 2HWC3 5BNOA 4GH4A 4RQPB 1MQTA 1F8VA 1FOD3 4RS5A 1PO23 1VBD1 2RM22 4CDQA 2WWSA 1IHMA 1RUI1 1TME1 5D8AA 5C9AA 2WS91 4CDUC 1COV2 1QJU1 1RUF1 1RUJ1 1VB2A 1VBE3 1COV3 2Y26A 1Z7S1 4YVSC 3ZFFA 5JZGA 1PGL2 1H8TA 4QPGA 3JBG3 1BEV2 1COV1 1R1A1 1OOPA 1QJU2 1C8M1 1D4M2 4BCUA 1AYM3 1VBB3 1RUE2 1PO12 1X33A 5BNPC 2FZ1A 2WLPA 1VBE2 4GMP1 2RS11 5L7OA 5DDJ2 1VRH3 1BEV1 4Y4YA 1R1A2 4RQPA 4CDWC 3DPRB 3JBG1 4NWWA 3ZFEA 1RUC2 2FZ2A 1W39A 4N53A 3J8F3 2X5IB 1AYM2 2R071 4Q4W2 4IV1A 4FTEA 1PO13 2RMU3 1FMD1 4JGZB 4N43A 4CDWB 1VBC3 1PVC3 5BNPB 5FOJB 3VDDC 1B35A 1HXS2 2WZR3 1FPN1 1MEC3 3VBOA 1BBT3 2MEV1 1NA1C 1AL22 3VBHC 1R093 1AL0G 5D8AB 1FOD1 1RUD2 1R092 1RUG1 2R063 4YVSB 3J8F1 3VBUC 4CEYB 4CDXB 1VBC2 1RUD1 1FOD2 1VBA3 1NA1B 1R091 1RUG2 2ZTNA 1RUI3 1RVF1 2HWE1 5A33A 1AYN3 1HX6A 2XPJA 2WS93 5C9AB 2QQPA 2XBO1 1ZBE2 5C4WB 1B35B 5ABJB 1RHI3 5AC91 5BNNB 1RMU2 2ZAHA 5CFCA 5FMOL 2GSYA 3TN93 3VBFB 5C4WA 1NOVA 1QQP2 2RM23 1POV1 1PIV3 3TN91 1NY72 2RS31 4RR3A 1AR83 1HRV1 5BNNC 1BEV3 1RUJ3 1RUF3 1D4M3 1BMV1 1QQP1 1OHFA 1NY71 2XBO3 4RR3B 4QPIC 2BUKA 3NAPB 5K0UA 5BNNA 1VAKA 4N43C 1X36A 4AEDA 1BMV2 1EAH2 4IV1C 1VBD2 2R061 1TME2 4Q4V3 1F2NA 1RUF2 1RUJ2 4AEDB 2BFUL 1PVC2 2HWB3 1Z7S2 4Q4V2 5CFDB 3VDDB 1BBT1 2R062 1ND2B 2RMU2 1PGL1 2HWC1 1NG0A 1CD3G 4N53B 1HQNA 1C8M2 4PDWA 1EV11 1RHI1 1ASJ3 4Q4Y2 2BFUS 1MQTB 4FTSA 1PO11 3VDDA 5CFDC 1BBT2 1FMD3 2X5IC 2RS12 3S6PA 2HWD3 2RR13 4JGZC 1ZBE3 4PDWB 3VBSB 4Q4Y1 5C4WC 1V9U1 5FMOS 4WM8A 4Q4W1
chains in the Genus database with same CATH superfamily
5JXIA 4AHYA 1ZZCA 1YI9A 3SH4A 3P6BA 5HXMA 4LITA 2I07B 4Q8KA 2HWD2 1CJDA 2VUAA 3SEEA 4QM8A 3WVJA 2GNBA 2RS51 2EVXA 4PQQA 3C7OA 2DCTA 3IAPA 3N7LA 1DQ5A 1K5MA 4XETA 2ZBJA 3T30A 2Y38A 3U1XA 5CVRA 1XNDA 4IW3A 3HNYM 5HCBA 1LGNA 2JE7A 2HJIA 4AI9A 5A32A 5LA1A 1W28A 4Q4X2 3VKOA 2BPA2 3HAGA 4OUEA 4Y1UA 5FZ9A 2D98A 1TMF3 3GF6A 3N9LA 2HWD1 3UJQA 4DB5A 3E5UA 2L9LA 1YYNA 4RGKA 1TE1B 2ZABA 1VRH2 3AVSA 2TUNA 2RS52 2VECA 3PVNA 4YVWC 3WINE 5CADA 1AR82 2X5IA 2A75A 4UAPA 5C5TA 3MI8A 3M8LA 3AL5A 1BKZA 1ONAA 4HBNA 1ZBA1 4IE4A 2BZDA 3RZZA 3QCWA 2Y6LA 4N43B 1FPN3 4OVEA 4TLGA 4UFKA 1C4RA 1N1TA 3SISA 2PA7A 2ID4A 3MDPA 5FP4A 1NA1A 3ROUA 1WCDJ 5C33A 1SFNA 3LIGA 2XXZA 3POYA 4R8HA 4DPNA 2VM9A 3MLKA 1NQJA 1XSRA 3KD4A 1WLWA 2BTVC 3MV11 2D6LX 4AHWA 2AR6A 5G05L 3ZIXA 3ZIWA 5DDJ3 3LWCA 5IFTA 2EXHA 2WN2A 3GDBA 3K48A 4EJRA 3HD8B 3FWEA 4DFSA 2RR11 2W9XA 4FP3A 3NNMA 1O8SA 2A6VA 5FZGA 2I45A 4GJYA 1DLCA 1ND2A 4RQPC 3ES1A 4QAWA 4D94A 2K0GA 4BK5A 3WW2A 4JX0A 2ORXA 2Y6GA 5D2AA 3RQ0A 1PZ8A 3VBOB 1LCLA 3RZJA 3BU7A 1GOGA 3KT1A 1HB2A 2O0OA 4Q4W3 3VKLA 2CAVA 3IDAA 1DZQA 2O8OA 3NNFA 3OGVA 2BBVA 1CAUB 1RC6A 1W2AX 2DV9A 4QX7A 4URTA 3SH5A 4FPLA 4EQVA 1WLTA 1OURA 3CL1A 2K46A 3M3EA 3QH6A 2WO1A 4H2AA 4I02A 4UW5A 2VCBA 2JDNA 1XNTA 4HT1T 1QY4A 3UV9A 3ZMOA 5FZCA 2XQRA 4C0HA 1C8NA 4GH4B 3ALQA 3FZ3A 2ORZA 2Y6HA 3GYDA 4JGZA 2AENA 1WCUA 1RUH3 2PELA 4I30A 5FY0A 1AL23 2P17A 3I59B 3ORJA 1G86A 3AXDA 3HEIA 3WUCA 5BNQA 4FFIA 4RS5C 3FLPA 2FCTA 1STMA 1XC6A 4MGSA 3LFIA 2OZ6A 4NO4A 2WZR2 5IT6A 4E8DA 1X9TA 1YFXA 1PX4A 4IEOA 4E2QA 1W9YA 2PAMA 2ZCWA 3AKRA 3PUIA 4YW1A 1CJPA 4AEMA 3BN6A 4BXFA 1K3IA 2VVFA 3I59A 1A3KA 1YRZA 3PU8A 2CTVA 3BTAA 3GBGA 4AWDA 1JZ7A 5HXVA 2VULA 2NMOA 4ZHNA 1LJ7A 5ERLA 3OBZA 2HWF2 2RMU1 4KMQA 4IEQA 1AUYA 2O1QA 1PM7A 1UAIA 1UIJA 1UY3A 1N3QA 2NZ9A 1UMHA 1Y9MA 1YNAA 2VTFA 4QX2A 3THDA 1FT9A 4OHZA 1JXNA 2GALA 4XW3A 4AW7A 2AGSA 5JXHA 4IDZA 4XF4A 1POV3 5H9SA 5A70A 2MHFA 5CISA 4IETA 2CGNA 4QXCA 3J7HA 2JIJA 3UGHA 4DINB 2VQ0A 1RUC1 2WA3A 3SCGA 5FUNA 5KXDA 1GYKA 1DU3D 4W6XA 5L73A 1BCXA 2ZGRA 3DKWA 5GKAC 4P9GA 1H1AA 2XJUA 4XQDA 3JB4C 2VUJA 1XPWA 2JENA 3WV6A 3ZXAC 5KHJA 3QH7A 3SHRA 3BGAA 4LO7A 5FR3A 1JHJA 1HB1A 4ASLA 5JUVA 2P3JA 5HCFA 2EAKA 4JGYA 1DP0A 3T08A 1DGRN 4D69A 1NCQA 5FZFA 3R4UA 4SLIA 2QNKA 5I8SA 1CWPA 4EN7B 1R081 3TRSB 4WM7C 1NQDA 3E6DA 4MGTA 2MEV2 4FBFA 1H8TC 1LGCA 2WLQA 5J36A 2Q1FA 3M3OA 4XIOA 1TMF2 4XJWA 4CEWA 1WLDA 4B1MA 1LR5A 4IV1B 3KZ4C 2YHJA 3A7QA 4ZXKA 2EXKA 4Q4X1 1GOHA 1HJGA 3ASIA 4X6RB 5C5UA 5LK7B 1J3PA 4QKFA 2RS13 4BM8A 5FMDA 1AR63 1CAXA 5ANQA 3I3MA 1RB8G 3NQHA 1I5ZA 1WW4A 3THTA 3VBHB 1LAJA 1HB3A 2QQVA 1RVF3 1H4GA 5ACA2 1OQDA 4FPCA 4GAZA 4RHV3 2PHLA 4JKKA 4QGNA 3WNOA 1O4YA 2DF7A 3AKSA 4CXYA 1QOOA 4GD4A 3VBRB 4S2DA 5DXDA 1A8DA 3R0RA 4XACA 1R1A3 1KRIA 1NE4A 1UIKA 5CG8A 1C1LA 1W6PA 1YIPA 4UW4A 5D21A 1N3OA 3J26N 3I2FA 3M4FA 5ACA1 2E6VA 2CL2A 4DEVA 2P3IA 4E2SA 3APBA 4KWKA 3LOIA 1O59A 4GB32 3PTYA 5E1RA 3FFQA 5DZFA 3NJZA 3PL0A 2WFF1 1JU4A 5AFEA 4Y22B 1VMHA 1I9RA 2VL4A 4JGYC 4KWJA 4NE9A 2RDSA 1OKQA 3WLUA 3ZXKA 1HQLA 3U0ZA 4KNCA 1MVQA 3VBSC 5A1AA 5FPXA 3OD4A 5A7WB 2XUMA 1VIWB 2LRPA 2RR12 4OMCA 4BLIA 4P9IA 2CYFA 3ECQA 2WZPP 3VD7A 4IEVA 3DN7A 4AAPA 5LW9A 3NVCA 1D4VB 4AE2A 3AMMA 1OPMA 4L97A 4ONUA 5GLTA 3TYJA 3ZKUA 4EN0A 3O7OA 1ST8A 5FV3A 3RZHA 3OBTA 1LOBA 4JAAA 2JE8A 2PXJA 3AZVA 1JHNA 1CAWB 3MPPG 1W0PA 4Q0QA 2AACA 3EQEA 4AI0A 4LLFA 4MHRA 2E53A 1OPOA 4CDXA 5BXXA 4D0QA 5IVCA 2AEYA 2B42B 1GZTA 2BERA 5GLVA 4FFFA 2HWC3 3MHZA 2XJRA 3R4SA 2EIGA 1F15A 4P9JA 2P1BA 4RQPB 2WO3A 3QOPA 5JXJA 3POWA 1F8VA 1TVGA 4D6SA 2EF6A 5EWSA 4B7EA 4OQ9A 1TME1 4P5YA 2JG8C 3WP4A 5A6QA 4ZZ5A 5C6CA 4CDUC 4LBOA 2IVIB 3V0BB 1QJU1 4P02B 3K4DA 4A4AA 1QF3A 2D40A 1RUJ1 4NRPA 3WP6A 4LIVA 3WZ1A 4Z2AA 2N7GA 3WOGA 1VBE3 2GC3A 4BQ5A 3JQWA 4QXBA 4QPWA 1W6OA 3S5AA 4JDOA 4COVA 3MW2A 4U2AA 1GZ9A 2VZPA 4ZU7A 1H8TA 2OQ7A 5A3PA 3BCWA 2ZGKA 1R1A1 2YU1A 3LB9A 4PLMA 1QJU2 5HCHA 2UY8A 5EIYB 1D4M2 4AG4A 3MF6A 2ZPXA 4BCUA 1SDDB 2ZOEB 4G4FA 5LBBA 1VBB3 1GQPA 1GQHA 2W95A 2XWBB 2ZEZA 1S0GA 4IEUA 4MVTA 5JR7B 3T4HB 5BNPC 2WLPA 2B39A 1ZNPA 1SDWA 3WDUA 4XQWA 1R1A2 1I3HA 1LHVA 4Y1YA 1LB2A 4LBQD 4BQ1A 4K7JA 2VCAA 1LGBA 2FDGA 3ZFEA 2ES3A 4LE4A 1RUC2 1JZ2A 1F4HA 1Z78A 1V0AA 2FZ2A 4N53A 3J8F3 1H1IA 2QQMA 2YGLA 4YZ3A 4Y4RA 4YGDA 3KGLA 4E9KA 1W6NA 2DUOA 3K3NA 2R071 1W8TA 2ZHLA 5FXVA 2Z5WA 1PO13 1UN1A 1FMD1 1QXRA 4LBMA 2XH6A 4XCAA 3THCA 3S7IA 1W6MA 4GXLA 1VBC3 2ARCA 2GN3A 4XILA 3VKNA 3WG2A 3VDDC 4BDVB 2VCCA 1B35A 5FAXA 1HXS2 4KWLA 4XUQA 3LEIA 1XSQA 3VL8A 4Z82A 1BBT3 3GALA 2MEV1 1NA1C 4C0BA 5JIUA 3O1RA 3LPFA 2WYFA 4LHKA 4XYXA 4QQLA 2ERFA 1W2TA 4UXAA 3DYPA 4X6QB 1AL0G 1FOD1 1RUD2 5BY5A 3CLPA 5FYCA 4DUXA 3P3PA 2ET1A 5GZEA 1V6NA 4HVRA 1W6QB 5SV8A 4PIXA 1ZRCA 2DVAA 4UFHA 4YVSB 2BQPA 2B8MA 2C4XA 2QVSB 3FX3A 4I01A 4AQTA 3S57A 1T2XA 3N7JA 2ZXQA 4KBBA 3DYMA 1ZZBA 4CDXB 2XJPA 2V4VA 2GZWA 2QQIA 1OMIA 3KS7A 4RYDA 1D0GA 4TWTA 4XTMA 4E4HA 3B5LB 5F7UA 5I0SA 1H30A 4BB3A 1MACA 1VBA3 1H2LA 3HNBM 3BALA 1US3A 3JU9A 5A3WA 3TBDA 3CQOA 3N9QA 1MZ5A 3TEWA 1AYN3 2EIBA 3GNEA 4UFMA 2Y60A 1IZ3A 1T6BX 1Q8OA 4HVQA 1C28A 2W1QA 3FLRA 2XBO1 5DMYA 3SKVA 1RHI3 3MIFA 5AC91 5BNNB 3AM2A 4JCKA 1OC1A 4LK6A 3GHNA 5IVVA 4MXWB 3FHQA 1YHFA 5EYYA 5FYYA 4HN0A 5FK8A 4WBBA 3P3NA 2WKKA 4CUCA 3HMYA 3INAA 3H1MA 4PIYA 1GMMA 5F5QA 4OHWA 3TN93 4Q0VA 3VBFB 1JZ4A 5FZ8A 3BTYA 1RUNA 3ILRA 3O1TA 3NNLA 5C3SA 1CIYA 2RE9A 5C4WA 5FPZA 1YQ2A 1NOVA 3NV4A 4B7KA 2UYAA 4LOTA 1JYTA 4AR2A 2P3YA 2G9FA 2GH2A 2WFPA 1NY72 3PMEA 2LS6A 2VY0A 3IZOA 4GQ7A 4QQHA 5FIXA 4KQ7A 5I0TA 4C91A 3VD9A 1XJAA 2OPWA 5F3EA 2VO5A 3KHBA 3KQRA 3MLJA 1UU5A 3I49A 5GJ6A 3KGZA 3V56A 2DTWA 4I3GA 1OFSA 3ZOIA 2QKDA 1NAEA 2PHFA 4XBLA 1K5JA 1BMV1 4L2NA 3ZXJA 3WW1A 1IQAA 1BXHA 2IXLA 1OHFA 1FAYA 1UD1A 4MGQA 3T09A 1PZ9A 4F8AA 1YQ6A 2BWAA 2IXHA 3W59A 1W2NA 1H1MA 1DYOA 5IUQA 2J7MA 1RJ7A 2ZGQA 3AP4A 2IXJA 4QX8A 2IXCA 1YIFA 4NJ4A 4Y22A 5C70A 3PUSA 4H14A 1UZ0A 3WDXA 5DAPA 3TAYA 2J1RA 4AEDA 3KHCA 1BMV2 3D6EA 1CONA 1CIWA 2W47A 1TZOA 3BPSA 2IWGB 5FFOC 4M00A 4IV1C 1W6MB 3QD6A 5A3OA 4YG6A 4QPYA 1TME2 3HIFA 4D8MA 4HG6B 4ARXA 5F9TA 4FAHA 1OSGA 3OUIA 4XZUG 3POBA 3Q9OA 4Q4V3 3LSEA 2A71A 5FZKA 1C1FA 4PQ9A 2W92A 1ULGA 5APAA 4COZA 1CAWA 1FYUA 2GMEA 4F3JA 2C5DA 2GP3A 3VDDB 1PM4A 2VZQA 3ZPYA 2D6KA 5IFPA 1JZ8A 3B3QE 4N90A 3WSOA 1ULCA 1NG0A 1RYYA 2DCYA 2HWC1 2JICA 2ZGPA 4UW3A 4XUPA 5LA2A 3RI8A 1UKRA 2CDOA 1GICA 5A1FA 1EV11 1OH4A 1IPJA 2GMPA 1ASJ3 4Q4Y2 4Y3OA 2KA3A 2C9AA 3M7AA 1A78A 1MQTB 3NO8A 4ZU4A 4ET7A 2DWRA 2VQUA 3VDDA 3OEAA 1RJ8A 1XE0A 2X5IC 3ACFA 4ZS3A 4TLFA 2VJXA 5FXXA 4YARA 3C3VA 4PHZA 2WQ4A 3I2OA 4A6SA 5FKBA 3KLSA 4IGOA 2Y6FA 4X8NA 3DECA 2E7AA 1V00A 3K2OA 3VBSB 2C1FA 5DAWA 4NAMA 2R7EB 2X09A 4WM8A 1ZZ7A 3IPVA 3WNXA 1FATA 4MADA 4YW5A 4YZ2A 4Y24A 3HT1A 2HKXA 1LHWA 1MS3A 3ZYGA 1VAMA 1QJX3 2R1BA 2RJLA 3AMQA 3L2YA 4NRQA 5DG1A 4CYDA 5ISLA 3ZYFA 3ZFGB 5BNPA 2KM2A 1CESA 4M3CA 4AK3A 4CVUA 1H2KA 1PK6C 4MSVA 4WM8B 3RVHA 1HXS1 2HWF3 1V9U3 4NUBA 1WBLA 1PHMA 1VE0A 3BYWA 4A42A 3ZO0B 2D44A 3WG4A 2P6CA 1RUE3 2FBEA 4P5HA 2K2SA 5FJHA 3ZN5A 1REFA 4LUMA 2D6PA 5E8AA 1ZX5A 3VBUA 2QQOA 4Y1XA 5LY2A 2TEPA 1F5JA 4XE9A 2A6YA 3LOBA 3AFKA 2VZOA 3LCPA 5FREA 2XB6C 3E5XA 4IV3B 1YI7A 3RZLA 4HN1A 4Y1ZA 1VBA2 4KU7A 2Z42A 1SZBA 5K0UC 4GWMA 3OGGA 1K12A 1O5LA 4I09A 5A7NA 2YGMA 2VZ3A 1OQ1A 1M06G 5FMBA 3POSA 4W6YA 4GWJA 1W2OA 1HRI2 2ZKLA 4E2GA 1UU6A 2QQJA 2ADEA 5KC5A 4OHXA 5FXWA 1VBA1 2XBO2 1QH7A 2ZGSA 3NMBA 3AZXA 1OH3A 1UX7A 1W8FA 2WR9A 3PU3A 4LO8A 1C8M3 1LEDA 4OMDA 4XQ4A 3ZDSA 2YBKA 5KXCA 4L92A 5EHDA 4CSWA 1VRBA 5JAXA 5LCWL 2WO7A 4CU9A 2OYZA 3WQ7A 2OVUA 5JVVA 1NCRA 3TEXA 4N9HA 4N53C 1QJU3 2D3PA 2R042 1EPWA 1MR5A 2VGDA 4Y5SA 3ZFEC 4LNVA 3V0BA 1GNYA 3OY8B 5F3CA 5J37A 2E33A 2W94A 1O5UA 1RUC3 2IXIA 1RUH2 2WSUA 3SH3A 2CV6A 2YB7A 4FPEA 2W2IA 4E8CA 2FCUA 3CJIC 5FO8B 5FYBA 1MEC1 2R6QA 1GNZA 3AKPA 4CXWA 4Z92B 1N3PA 4XJAA 3A23A 2VG9A 2ZX0A 4UBGA 3IN9A 2B9UA 5E16A 1PNGA 1JOPA 3QLQA 3VGIA 1KDMA 2ARBA 1GFF2 4DOUA 1QJFA 1AF9A 4URAA 2A1XA 2YROA 2YYOA 4S2FA 4BJ0A 3VBFC 1W06A 4K8FA 4C90A 3R6SA 3IWZA 2RM21 1MEC2 3POEA 5GZFA 3VBFA 3HOBA 3FJSA 4ISRA 4XXPA 4LHLA 2DU1A 3KV4A 3POJA 4QKDA 1EUTA 2WS92 3FL7A 5FZBA 4EZ4A 5JZGC 4XC9A 4XMIA 1WA6X 1EAH1 2PTMA 5KBFA 2G19A 3WF2A 2FD8A 3HT2A 1AXZA 2WABA 4CDUA 2P5BA 1GWMA 4BMBA 2VXRA 3WX5A 3IM0A 5L9VA 2PAKA 1UNBA 4TTGA 4NWVA 3DGTA 4CDXC 2A6XA 4HLTA 5LASA 3H7JA 3M3QA 1LU2A 5T50A 3ST7A 2GAUA 3OG2A 4Q0PA 4N8MA 4LUKA 2HBUA 3B69A 4PF5A 3T3YA 1A6CA 2D93A 2QQLA 4IEZA 4XBQA 5A7PA 4CP0A 1ZVFA 2V72A 5JWPA 3WDVA 1ZZ9A 2WL1A 4NHLA 3AP5A 1VBE1 3ZDVA 1EV12 1QOSA 4OYUA 1PMIA 5CZKA 4CUAA 2WT1A 2RS53 3DL3A 4CU8A 2BOJA 3OF1A 3JBG2 3Q8EA 4PT6A 4A7ZA 3O5SA 4KG8A 5FZ7A 5J98B 4RHV1 1EUUA 4E4DX 3ETQA 2G4IA 1AYN2 1WLCA 2OZJA 3A0NA 2HWB1 1OOPB 3DKQA 1UL9A 1AR61 4MHUA 5FOBB 4MXWA 2W87A 1DYPA 2XLFA 2AEZA 5LATA 5A3TA 1G9CA 1QU0A 3W5NA 4XBNA 5A32B 4ORFA 4KGQA 4BQWA 2IFWA 1QXJA 5GZGA 1SLLA 3DCQA 3BOPA 3AVRA 5IVJA 3IAQA 4Z1VA 1AYN1 1REEA 3NL1A 1BQPA 1FPN2 2HEYF 2QZ3A 4AI2A 1AR62 4AI3A 1ULEA 1UMIA 5ANNA 2Z4FA 1NLSA 4FOYA 3CMGA 4A6OA 2DCZA 2IUWA 4LHSA 4MGKE 4OHVA 4YVWB 1QJY1 1G9BA 1ND3B 3FN9A 4Q4W1 5EPAA 4YW3A 1XNCA 1K5MB 2QTWB 3WDWA 2DUPA 2DU0A 1ULPA 4RD7A 5BNOB 2NP0A 1VBD3 3UKTA 1IS4A 4XUNA 4C1WA 3NJXA 1UYPA 2E7QA 3MF9A 4UT5A 4Y20B 5FWEA 3HBKA 4Q5OA 3T1MA 3J8F2 1EAH3 1LOEA 1WBFA 3DPRC 3MGUA 1LULA 4XDQA 4BZ4A 5JOZA 3OJBA 4P9WA 1KS5A 4XDPA 2C6SA 1BHGA 3QACA 3ITQA 1DQ4A 1AHSA 1VBC1 5JDBA 4W50A 1I6XA 4LA3A 3USUA 4NIGA 2WBKA 4LKFA 3ACIA 1OF4A 5CYYA 3KV9A 5EV7A 3BI3A 2XVLA 3AYAA 2CWSA 1RVF2 3RJRA 5ACA3 2OUHA 4AVAA 4LBLA 4HKWA 2IFRA 1ZM1A 4AVVA 4OUSA 4A3ZA 5J1XA 4DQAA 1CX4A 1Y43B 2DVGA 4XFAA 1E5SA 4L99A 1Z7S3 5FPLA 2F6BA 3ACLA 4EZHA 1HRI1 3T0DA 3HN3A 1UOGA 1DDLA 2W91A 3C7GA 4PI2A 3LIHA 3UYJA 3WDTA 1AR92 1GP6A 4Z2WA 2NLRA 1WCQA 1I5PA 5JCTA 4BMEA 5KR7A 1MPXA 3ZXEA 4CCKA 2RDRA 1G6NA 2BNOA 4GB33 1SLBA 1L7LA 1OLQA 5FP8A 3Q8BA 3HQXA 3OSDA 1VBB1 4PCRA 5B4XA 3WQBA 4IE5A 2F4LA 4YM2A 4I2OA 1DHKB 2UWCA 3TN92 1GNHA 1QMJA 3AJZA 3R05A 4QQPA 1BVP1 1PGSA 2JKBA 4E27A 3AYCA 4UFLA 2RS32 3OYWA 4K40A 3WEZA 4A41A 3BKZA 4DEQA 5FBJA 2VMFA 2WNUB 3VZLA 3WF0A 5IVFA 1ASJ2 1WWYA 2RS33 2W0XA 3I54A 3JD73 1EY2A 1G9DA 4M4PA 2Q4SA 4WM7B 2VZ1A 4K1ZA 1RUH1 2G1MA 3IBMA 2P37A 2EXIA 5B2GB 1W9FA 5C71A 1ZRFA 3RZMA 5LWBA 4QB1A 2VMCA 2WN3A 4GKXA 1R083 1ACCA 4RFRB 5JOYA 3JD71 1N47A 2YC0A 1Q3EA 3I2JA 3MFCA 1XXNA 2RHPA 2PHWA 1S0EA 1ASJ1 1YQ8A 2WRAA 1TG7A 3N36A 4RFT0 1N1VA 5ABJC 2VH9A 5KHGA 1MQTA 3ES4A 4GIQA 5FY9A 3PUQA 3ZYBA 4RS5A 1C5HA 2RM22 5FY8A 4A2UA 1JI6A 1RUI1 3VB9A 3EYPA 1QEXA 4GA9A 4XOGA 3K51A 1X50A 2WT0A 4Q26A 1JYIA 2CAUA 1RXFA 3FUQA 1X8EA 5L9RA 3U78A 4AEKA 3O1UA 5LY1A 1WD3A 1CX1A 1COV3 2ARXA 3NWKA 1Z7S1 4CP2A 5A7QA 3TNQA 3ZFFA 1DGWA 3PLQA 4CPBA 3ELNA 5F39A 4J1WA 4NHYA 5DAVA 1PGL2 3W5MA 1IPSA 2UWAA 3BPZA 5FYVA 1C8M1 5CB7A 3VDAA 2J22A 5IHRA 5B4NA 1Y4WA 3UL2A 5FY1A 3RZKA 3M2MA 5DQ0A 2FMDA 1PO12 1UKGA 2ZAAA 5BPXA 1EYBA 5CBLA 1SLTA 4LIUA 4LA2A 2EICA 1TEIA 1APNA 3ETPA 1FXZA 3IIAA 5DDJ2 5FYMA 4Y4YA 4YZ5A 2VMHA 4CDWC 3DPRB 4BK4A 3T0AA 4CXXA 3ZKYA 2W3JA 2P2KA 1W39A 2Q30A 1XYOA 2NN8A 2Y8KA 2JE9A 3D4KA 4FPHA 4Q4W2 4IV1A 1YUDA 2VXJA 2RMU3 5T54A 4FTEA 3KV6A 3ATGA 1J1LA 3VV1A 3OGJA 3BB6A 4DRRA 3AMPA 3OPWA 1F9KA 1JODA 1DQ0A 2EAAA 2VNGA 3H3UA 3IMNA 5JSOA 3U37A 1ULOA 1FNZA 1R64A 2E9QA 1MEC3 1FV2A 4HETA 2BP6A 3VBOA 3WNNA 5HV0A 2YU2A 4NROA 2E31A 2JG8B 5A3NA 5LEKA 3VBHC 4XABA 1LECA 5AVPA 2Q8CA 5H9QA 4CP1A 1S2EA 1YFWA 2WUHA 2YY1A 4F83A 4IEPA 3AK0A 3LPGA 2VMEA 1YC61 1RUG1 1DGRA 1JN2P 4B1LA 1ZA7A 3GCWA 3OCPA 4DUVA 1CZVA 2VW0A 2JB4A 3FFZA 4D6RA 1VALA 4GKYA 3U4SA 4K9SA 3NJYA 5JPMB 4XPVA 1QXPA 4ISQA 3T2TA 3VBUC 5FK7A 2A6ZA 2JXAA 2MPFA 5FZLA 1VBC2 4DXTA 3T0BA 3NV1A 4XEZA 1GQGA 3V0AB 2XUEA 1LEMA 1UX6A 5E89A 4QD2A 4BQ3A 4ES8A 2BVVA 2HWE1 5A33A 2EIEA 4UFIA 2Z69A 2NMNA 3B9IA 1IKPA 3HQRA 4R9BA 5C4WB 2QQPA 5ABJB 1DFQA 4HZFA 5FZOB 3H8XA 2A3WA 1C5IA 1LODA 3ZXGA 3N9PA 3O12A 1RMU2 2ZAHA 4LKEA 3PTRB 4IQPA 4L0PA 3U4XA 4Q1PA 2VZTA 4DUWA 3ME2A 3AP9A 1U5IA 2PHRA 4AVCA 5FZAA 3IB3A 1L7QA 5G04L 3K3OA 1H0BA 1QQP2 5A1LA 1POV1 4QWNA 3GBWA 3MIEA 1PIV3 3T2QA 5J09A 1GKBA 3MIBA 1YWKA 3TN91 4MOAA 3UGGA 2BVBA 3TNPB 3T2PA 4BYYA 4MZUA 4QHBA 4KG0A 1ODNA 1HRV1 3Q8AA 4CE8A 4P9LA 1BEV3 1LHUA 5DZGA 4QDQA 4Y1VA 4MV2A 5I0DA 3T2OA 1UZWA 2ATFA 2GNTA 1JYVA 2JG9A 1U0AA 5JI9A 4RR3B 2WQZC 2VMIA 4LK7A 1WUVA 5LB6A 3ZXLA 2CHHA 2JDZA 3TOJA 3ZX7A 5D1IA 1VAKA 4N43C 3RYRA 5FZHA 1E5IA 1PMJX 1W0NA 2OX0A 4XCBA 2RJKA 4DXZA 4AI1A 2VUCA 1WW7A 4LHNA 4YGEA 5EYXA 3VN4A 5HCAA 1Q8QA 3KCCA 1OI6A 2I74A 3NV3A 4QB2A 3RG0A 1H8VA 2QDNA 4JQTA 5CNAA 1PZ7A 4AQ2A 1O3RA 4FAGA 1BJQA 4QX5A 3NNGA 3O0XA 4ZZ8A 1OFNA 2WNVA 3AZZA 2W1WA 4QKNA 3A22A 3THPA 4EN6B 3IT8A 1PVC2 3ABZA 1HN1A 2HWB3 1Z7S2 3I3EA 5FLHA 5CFDB 1BBT1 1QDOA 4XAEA 1WMFA 1J84A 2R062 2RMU2 4M3CB 1PGL1 1CZSA 1BZWA 4I0AA 5I8YA 3BOWA 1SPPB 1MZEA 1HQNA 4B4RA 4LBQA 3BU0A 4FFGA 4YG0A 4OFGA 5FZ4A 3UKNA 1RHI1 4E4ZA 1GLHA 1W3XA 4EROA 1VMJA 2ZX4A 4YW4A 5F2WA 1CAVB 4MH0E 4GJZA 3RDIA 2QJVA 1PO11 3I3BA 1O4ZA 2XLGA 1BBT2 3MV01 2VC9A 4INDA 4CUGA 2JEMA 4YZ4A 1V6JA 4NMIA 3S6PA 5DUUA 2RR13 5FZ3A 3VZJA 5FO7B 3M70A 1S2BA 1LOGA 3B01A 3KSCA 4M3CE 1MS0A 4DXSA 3KQ4B 3I97A 2PQSA 1SBDA 3HN1A 4Q1RA 1BVVA 3OB8A 3ZXFA 5FMOS 3FLTA 2VOVA 1O91A 1NKGA 3N7MA 5GM0A 3FBYA 1UY4A 4XDOA 1W6NB 2ZGNA 2WNUC 4XF0A 4BHPA 5BYNA 2CGPA 1W8HA 2PHTA 1MZ6A 3KB5A 3RGBA 3EMRA 3G7DA 1BK1A 4JKMA 5CFCC 2OA2A 3TEYA 4EE2A 3H8OA 1QQP3 1Y3TA 5F6KA 2FCVA 5F5IA 3URFA 3SC7X 1X82A 3NRUA 4HANA 4NPMA 4XJ8A 4AEJA 1TMF1 5C8WA 1WCKA 4K21A 1ZBA3 4XHBA 4XURA 4YW6A 1XNAA 2VBDA 2ZX2A 3BUCA 4IV3A 1B09A 4I0BA 1ZBA2 1SLAA 1IS3A 4QDSA 3OGSA 2JX9A 2PYTA 3I2HA 2BV4A 2GN7A 3RMYA 3VD4A 2XLAA 1VP6A 1UXZA 3EBRA 1RUG3 1WD4A 3F2ZA 4QMAA 1NCQB 2A6WA 5CKMA 3ZFGC 4QPGB 5C8CB 1WW5A 2AUYA 4LULA 2RDNA 4ZONA 5AVAA 3VD5A 1D7PM 2WC2A 4WVMB 2WSVA 1TQ5A 5DUXA 5FP7A 1AXKA 3WF4A 5FWJA 4AVBA 1KEXA 2B7YA 1GSLA 4QQOA 4QHOA 1RIRA 2ZEYA 3K75B 3OPZA 4LPLA 5IWFA 5IVBA 2DVFA 3H1YA 4KL1A 4QB6A 4ZS2A 1OLME 4AYUA 4QPIA 2OIIA 5F37A 3SNMA 3K46A 1XOYA 3IDCB 1VLNA 3GZUC 1IG0A 3KF5A 4JDNA 1AR81 5I8TA 1XBFA 3MUY1 4LBQB 4RR3C 1NCRB 5F5AA 5FP3A 1V6IA 3VBOC 4D3WA 2VOXA 1AR73 5I93A 2CY6A 1LOFC 4HONA 2WFF2 1E5HA 3RJ2X 4GWIA 1HDKA 4QHZA 1GWKA 3CIHA 1N1YA 1QOTA 4BQXA 2LTNA 5GZCA 3MIDA 3RNSA 3FBMA 4KI5M 1NE6A 4FXKB 3EB7A 5FZDA 4CDWA 2GC0A 3NKTA 1S0FA 2ZACA 1ODMA 3I3DA 4LQRA 2E63A 4MO3M 4BOWA 4YYOA 3N4MA 1LNSA 2NPIA 3PJYA 2HEVF 1U5YA 2D6MA 2PFWA 1HV1A 1XYPA 5DZEA 3V0AA 2RDQA 2WFF3 1NLRA 4FP2A 3Q8FA 5CA6A 1OXCA 2JD9A 4BXSV 5CKQA 3DPRA 1HRV2 1ZYBA 4WM8C 3VKMA 3ZFFB 4CEWC 1JTZX 3C7FA 2ZGOA 1PVXA 5CKNA 3VDBA 2J1VA 2VW1A 3WQ1A 4K3UA 1SBFA 4YM3A 1JYNA 3FE5A 3S0MA 1QKQA 3K4ZA 4CU6A 3V65A 2QBXA 2JECA 5FZ1A 5IATA 1RUD3 4CDQB 2FDKA 3NAPA 1SEFA 2A70A 3CJIB 1UPIA 2VCMA 4CP9B 2D5FA 2R043 2J42A 5DAQA 1Q8PA 1XQNA 3N7KA 3I2GA 4NHKA 3PUHA 1HXS3 2HWF1 4XFBA 1ZA4A 2K9ZA 2WA4A 2JG8A 4Y5TA 1AXYA 4Q0UA 1WKYA 2ZHKA 5FUPA 5FY7A 3VDCA 4A45A 2CWMA 2HYKA 3HNMA 4JVAA 1OT5A 5FY4A 1JZ3A 2DBNA 1NUKA 2QCSB 4S2HA 4YGCA 1W8ZA 5CFCB 2Q8OA 4P9XA 1OVPA 2VBPA 1PVC1 3D82A 4LO6B 5IK8A 4LLOA 1OUSA 1D4M1 2QE3A 2ZHMA 2UYBA 2ZX1A 3LGRA 5T5PA 2NM1A 1QH6A 1V6MA 1B35C 2WZR1 4AFCA 5LZ6A 3SKJE 1ZZ6A 2P6HA 1H2MA 1W8WA 2V5YA 5A6YA 3IPVB 1IKQA 1AR71 2ZX3A 3ILFA 1GBGA 2XJVA 4OI0A 1RHI2 5L7OB 4UI9L 4XFGA 4LO5B 1JOBA 2E26A 3ACGA 3TEZA 1Y7BA 4FI9A 3QBQA 3H0OA 1XRUA 1PGW1 1TNRA 1VR3A 3CDZB 4PBPA 3UJOA 5K7PA 1QNWA 2C9KA 3ZFEB 3J9SA 3WD5A 2IZWA 1SLCA 2XL9A 3T1LA 4LR4A 2R30A 1AR72 1R082 1G8WA 4YW2A 3VD3A 1AYM1 2R072 1JUIA 3K77A 4K6BA 3VBSA 5H9RA 1F35A 2VNRA 3ZR5A 3TB0A 4FVVA 2BWCA 4CZSA 4LORA 5JPNB 4LEJA 2W1SA 4YVWA 1W9SA 1YEWA 3CEWA 1GANA 2G9GA 1PGW2 2ZA9A 1HRI3 2DDUA 3OEBA 2WNOA 3WNLA 5A3UA 5HI0A 2J1TA 1W8NA 1PO22 3ZYHA 2JDKA 4DNYA 2FDIA 1LOCA 2F4PA 4LO4B 1NLQA 2HH9A 2VZVA 3ZFGA 4QQ2A 2BJSA 4B4PA 5JZGB 1RL3A 4XUTA 3CJIA 3ZN4A 5EJZB 5L9BA 3USUB 1U5XA 2XVGA 4CCNA 1O4TA 2VAUA 4NHMA 1PO21 3W9AA 1CZTA 3CZUA 5KWRA 3RSJA 3ZSKA 1US2A 3IDEA 3FUOA 3W21A 4GWNA 5DUWA 3N9OA 1VRH1 1KFXL 3PDQA 2HWE3 1C57A 1NZIA 1W8UA 2DFCA 1UY0A 2GH8A 1GV9A 4GH4C 5HV4A 3O1OA 2BRTA 2YFZA 3O0VA 4FOWA 4GB31 2P4EA 3WQ0A 4DMIA 5FYHA 1KD7A 3AMHA 4SBVA 5FQ0B 4YLZA 5HBAA 2D43A 1IPKA 1DF0A 4MX3A 2PLV2 4NN0A 1J3RA 1LHNA 2P3KA 4WZCA 5C7GA 2ZZQA 3CKHA 2QDRA 2XKPA 4CP9A 1AVBA 5AC92 1EPZA 2G9ZA 2ZHNA 3AXEA 2WAAA 2DVDA 3MUZ1 1F5FA 1G9AA 2VZSA 2JDHA 1DQ1A 4GMP3 1XE7A 3RZGA 2CNAA 4FCAA 4AI8A 2PLV1 2QQKA 2OS2A 4LKSA 1EV13 3L9JT 4QXHA 1NZCA 4HK9A 5LRRA 1GP4A 1JYWA 3HWJA 5D8AC 1W03A 3LQCA 2GNMA 3O1VA 3ON7A 2H6BA 4B3NA 4DY5A 2D6NA 3JZVA 3NW4A 1IOAA 5AC93 2VQAA 4Q0SA 2YFUA 1UQXA 2ETEA 1KFUL 3HQUA 4OI1A 2JD4A 3DXTA 5JSRA 5FYTA 1DBNA 1NCRC 5FKCA 4NAOA 4Y26A 1DGLA 3JQXA 5T55A 3WCRA 3J4UH 1QJY3 3O1PA 2R1DA 1H9PA 4OI2A 1XNKA 1ND3C 4H3WA 1K5MC 1AR93 2Y64A 3PNAA 5LEJA 3GCXA 2FDJA 4CEYA 1SPPA 4J1XA 1UYYA 4QKBA 3HVDA 4H55A 4H7LA 1AZDA 5BNOA 1DGWX 1NT0A 4GH4A 4V2VA 1YXWA 1FOD3 1PO23 4IL7A 4OHYA 1K45A 3KM5A 3FHAA 2WWSA 3SMHA 2B45X 2AH2A 4R4ZA 1IHMA 5D8AA 4HSLA 4N9IA 2W52A 1X9PA 2WZ8A 4PJYA 4UYBA 1JH5A 3KV5A 1OKOA 4PBOA 4L8QA 1VB2A 1ZRRA 3I8TA 1PNFA 1S0CA 1UY2A 5GZDA 5JZGA 1U5ZA 2WDBA 4M4RA 4QT6A 4AFMA 1QHDA 2WJSA 2R32A 5IAVA 1WGPA 2Y0OA 5JOWA 5FP9A 1AX1A 2X29A 3I4IA 3VHOA 5SV5A 4FXGB 1OOPA 5GLWA 2XWJB 2FQPA 3H42B 1DZRA 3ZYIB 1S0JA 1KDKA 4KBZA 4BQ4A 1AYM3 4EN9B 5I0RA 4LT5A 4O65A 3AJYA 3M1HA 2FHRA 4RGAA 3OPTA 5CU1A 1UZZA 4TN7A 1VRH3 2QQWA 1UU4A 3I7DA 2BGOA 1WW6A 1ENXA 4IXLA 2YUEA 2NQYA 2R49A 2VNVA 2ILMA 5A80A 5IK7A 3ZSEA 3ZVXA 3U11A 1AYM2 5GLZA 4JDMA 2C26A 1RUOA 4YFZA 4JGZB 1UPSA 4Z8BA 3WY6A 1S55A 2JJ6A 4CDWB 4EWAA 1WA4A 5BNPB 5FOJB 3MFAA 2XOMA 1CAXB 3BODA 1H2NA 2WZR3 2YDEA 2WNVB 4TXWA 1G7YA 1SLIA 2QUOA 3F95A 4RSUA 4XFFA 3WR0A 4D7SA 5FO9B 1GZWB 3E97A 4NR1A 3JXSA 3VKFC 3KVAA 3WCSA 4MXVA 3WT3A 4YRDA 2YPDA 1AL22 2XR4A 3ZR6A 2XHNA 4PIZA 1R093 3LA3A 3NJVA 1UOJA 1ZRIA 4HFSA 4FPFA 4UFJA 4OULA 5D8AB 4IGPA 4BIFA 3D0SA 3POFA 2JDMA 5E6HA 4ATEA 1R092 4UOJA 1UXXX 1DCSA 2R063 2GC2A 1HIXA 2A73B 3GM8A 4AHXA 1J3QA 1V6OA 4YSFA 2XL7A 1OUXA 2PHUA 4CEYB 5FTTC 2WZEA 2VTXJ 2ZGLA 1HB4A 1FOD2 1RUD1 1YO8A 3GHMA 1PK6A 1NA1B 2VMGA 1WMEA 2WQ8A 1IS6A 1R091 4W8JA 3WW3A 2ZTNA 1PX3A 1RUI3 3HR9A 4Q8LA 2XPJA 3ZN6A 4CCCA 1NXD1 3HJRA 2RJ2A 1BYHA 1F4AA 2BGPA 2JG9B 2CDPA 1WMXA 2WS93 3NNJA 4BU2A 1ENRA 3POGA 5DG2A 1DIWA 1B35B 5FYSA 2A5ZA 1SCRA 5JIAA 3CNAA 4YG3A 3H7YA 2UY9A 2ET7A 3VHNA 4IERA 1L3JA 4IE7A 5FYZA 3ZPOA 4META 2V09A 2Y34A 3CF6E 1W90A 2HYXA 4UW6A 5FYIA 1WMDA 2GSYA 4WV8A 3E5QA 3O1MA 1J83A 3B93A 1CGPA 1OQEA 3W20A 4AZZA 4FPJA 3DEMA 1LTEA 3P5BA 3WG3A 4WVZA 1ULDA 2RM23 4KH9A 4R4XA 4WZFA 1HV0A 1LHOA 1V6KA 4QX0A 4JC1A 3WNMA 1ZZ8A 2EXJA 4RR3A 3OBRA 3HPNA 4AVTA 1AR83 4BWOA 1XB9A 5J48A 5BNNC 4OI4A 4F7ZA 1LOFA 1RUJ3 2QQNA 4PLOA 5IW0A 2XVKA 4C8DA 1JW6A 2EALA 2WT2A 2X53S 1DYKA 1H6XA 5C3PA 5JMOA 4WVMA 2OPKA 1NY71 2XBO3 3C7EA 3B02A 3DV8A 1V6LA 1G9FA 3ZYPA 1QJEA 1S4CA 1X7NA 4QPIC 2B46X 3GZTB 5K0UA 5BNNA 2A3XA 3KT4A 5DUVA 2KXLA 1OD5A 1X36A 3AP7A 4XIKA 3O14A 1JU3A 2XGXA 2DUQA 1DQ6A 1POQA 1W0OA 3LA2A 3POIA 2BNMA 2ZS6B 1EAH2 4NHXA 4P08A 4S2GA 1AJKA 2CU5A 4FPOB 1OD3A 1W2UA 4EN8B 2VOTA 3VZMA 2YPJA 2D5HA 3AZWA 4IEYA 1HLCA 4R9DA 5L36A 2VU9A 3OOXA 1F2NA 1RUJ2 1Q8SA 5FLIA 3SITA 4P14A 3MIHA 1O3SA 1CAVA 3H3LA 4JZRA 4Q4V2 4TZDA 2FDFA 4Z07A 3MW4A 1O7FA 1JOJA 2E7TA 5FUIA 1SBEA 3D3AA 2ZJCA 4R9CA 1UY1A 2JIGA 1CD3G 3IDBB 4N53B 4UF0B 4YFWA 4YM1A 1UMZA 2WWJA 4BIOA 1BK0A 5F3GA 3AP6A 3AYEA 2BFUS 2DCJA 2ZGTA 4FTSA 1JS9A 2RVAA 4XJZA 5CFDC 2BU9A 1FMD3 2YXSA 1CPNA 1OVSA 1URXA 4I0WB 4WVVA 1ENQA 3I2IA 2XJQA 1PK6B 3U07A 4K20A 1Z0HA 2QQUA 5FZ6A 2Y33A 1K42A 5FZEA 1VMFA 5K9YA 4PDWB 4O7XA 2B4KA 3MIGA 4Q4Y1 4TSVA 4P9YA 3LDBA 1Q56A 3AYDA 1SG3A 1V9U1 4XJ9A 1O3TA 1MZFA 3FHIB 1NX9A 4COWA 1VJ2A 4FT8A 2X8KA 3BIWE 4JKLA 1AJOA 1MS8A 1MQTC 1XU1A 3AX4A 1FMD2 4ES9A 2PQQA 5CIRA 2WO2A 1RITA 3PVOA 4FPKA 3UGFA 3NV2A 1QNYA 3DYOA 5FDBA 4HKOA 2Q5TA 3EO6A 2VMDA 2X10A 1QJY2 1FV3A 4HOOA 4UWDA 4COYA 1ND3A 1OF3A 2PMWB 2TBVA 4RA0A 2OKXA 4JV4A 2JDAA 2BBAA 4A3XA 3RWNA 2W1UA 4CPBD 4AQ6A 3RRDA 5IAXA 1JUHA 2VPVA 3SQOA 1AL21 1UZYA 1OBNA 3DF0A 3AB0A 2ZMLA 3GGLA 1H4HA 1H8TB 1W9WA 3CO2A 2ENRA 4AXOA 1UZVA 4CA9A 2HEWF 1UO9A 3AZYA 4QGLA 3D0JA 3LFMA 3JB8A 3PVEA 1TME3 4HMZA 5EQUA 1YFUA 4RS5B 5J96B 1POV0 1S0BA 2GP5A 1DLLA 3B7MA 4AAXA 1UOBA 5K4LA 1VB4A 2H0VA 4ARYA 3BTZA 3KCYA 4Q4X3 1YFYA 1OOPC 4KU8A 4Y20A 2PLV3 2R16A 2PN5A 1ENSA 2FMYA 2XONA 4IGQA 4DIQA 4ZKTB 1W8OA 2R073 4HPKB 4FSJA 3LAGA 2XJTA 3K4AA 4R52A 5A3MA 1OA4A 3L2HA 4LJHA 4YM0A 1HRV3 1L7RA 4IV3C 4Q4Y3 2RV9A 4BQ2A 4FTBA 3S7EA 4XFCA 1D2QA 2XQXA 3VBRA 4NVPA 4OUMA 2XHKA 5A6XA 4RGGA 2QZ2A 3EHKA 4ITCA 2ZKNA 3J7NA 1DZTA 5TSWA 4FQZA 1W6PB 3CU7A 4LE3A 3M3IA 5FZ0A 1XE8A 5LBCA 1Q8VA 3EXUA 5EFUA 3AL6A 2EA7A 1GWLA 1T6GC 1XYNA 1LESA 5BNOC 3RMXA 4UBHA 1JYCA 1W99A 3H8RA 2MEV3 1EP0A 2W68A 3UNPA 1GUIA 4AF9A 2D6OX 5A7OA 2ZEXA 5FCCA 1HW5A 5FPVA 5FY5A 3IIIA 4G3YC 4EV0A 3OYWB 1LKNA 1NCQC 3CHXA 1IG3A 1UWWA 1YQ5A 2ZGMA 5FJKA 4AOCA 5C8CC 4DY3A 3ZFFC 4CRQA 3B94A 2YC2A 4MGZE 2VE1A 4WM7A 4JQRA 4CEWB 2BDRA 4CCOA 1QGLA 4PDWC 3RPQA 3OBAA 1NXMA 4AGGA 1VPHA 4LBKA 4CCEA 1SACA 4HK8A 1H6YA 1VAVA 2DURA 3EJKA 4XMAA 3UKVA 5AFBA 3LZZA 2D3SA 3VBHA 4BE3A 4CDQC 2DBIA 3VHPA 4ASMB 4CEYC 4BH9A 5JMCA 5KHIA 1J1TA 3PHMA 3DUIA 4Q4V1 3GZAA 5M0TA 2GMMA 4PI0A 1QJX2 1U12A 4NIDA 4QDRA 2GU9A 1RUE1 2HWC2 4IEXA 4XF3A 3H3ZA 5F6LB 2R0HA 3VBRC 5F1RA 1RMU3 4HPKA 3ZLIA 5K0UB 4M0HA 4HL0A 4FFHA 1QJZA 1XU2A 5C3RA 3I2DA 5DDJ1 3PUAA 1GZWA 3WNKA 2GDFA 5F5CA 2FDHA 4HVOA 3USSA 1W6OB 1GP5A 2W46A 3S5QA 4W6WA 1QJX1 2UU8A 3BVCA 4XJUA 1S2KA 1UYXA 4ATFA 1GZCA 2A7AA 3LDRA 1LOAA 4BISA 3VZKA 1PIV2 5L7OC 3MPBA 3OUJA 1REDA 1V9U2 1UF2C 2OUJA 4A7KA 2PAEA 2V4AA 4XAAA 4JRAA 4J25A 5EZWA 1YLLA 2MNGA 4RHV2 4MUVA 4L11A 5C8CA 3WG1A 1JZ6A 2XMLA 2HWB2 1YJKA 1KJRA 4COUA 5KC6A 5IK5A 4BPZA 1R1ZA 3ENRA 1PIV1 3NAPC 1UYZA 1JBCA 2XDVA 4P00B 4QPGC 3N3HA 2Z79A 3LDKA 1KJLA 1V70A 2VBBA 5JXGA 2Y6JA 4QPIB 5C9AC 3WNPA 4PF1A 4NPLA 1W6QA 3V64A 3GBFA 4HSJA 4D7YA 4KGGA 4U36A 4OZOA 3SLIA 5FQ0A 1OA2A 2HLEA 4AL9A 1LU1A 3VLBB 2OXBA 3GZEA 1PMHX 1JMUB 2VD7A 4NIAA 5FLJA 5KHKA 4X8PA 2VOKA 3NSTA 1MS1A 4JHZA 3W58A 3PIJA 3G6JB 1JYXA 4YZ1A 1HQWA 2YG0A 4NIIA 5LA9A 3WHUA 3RYPA 1AR91 1P8JA 4N7IA 2UURA 2Q1MA 5F3IA 3WF3A 3AC0A 5CG9A 1D0HA 2HWE2 1ND2C 4JGYB 4IEWA 4XTPA 4HXCA 2LUWA 2JKXA 1BLZA 4YWAA 3RWKX 3WP3A 2JDYA 1UOFA 1ZBE1 2ZMKA 3A4UA 1VBB2 2KD7A 3LA7A 4FOQA 1A34A 1GOFA 1RINA 4ZXEA 1TNFA 2VOWA 4NRMA 1W04A 4DZGA 3OY8A 1RMU1 4QX3A 4YVSA 1E57A 3I2KA 3PURA 2WIIB 5JOXA 1SMVA 1HN0A 4GZ9A 5CFDA 5KXBA 4B8EA 2Q1ZB 3BTXA 2XKOA 5E88A 3KT7A 5FZIA 2WWUA 3C7HA 1CQ9A 3LEMA 3X29B 5J3UA 3WW4A 4O61A 3E6BA 3ZSJA 2ADDA 5EP9A 3U14A 4DXRA 4R9AA 5A33B 3A0KA 5FXZA 3JD72 4IUGA 2I2SA 4AGRA 2XJSA 2R041 2TNFA 3CZJA 5FYUA 2PHDA 4Y5Z0 5ABJA 4XFHA 1ZREA 4HKLA 2YBSA 2AZ5A 4QX1A 3MEPA 2VQTA 2VR4A 3WHTA 3M3CA 4ASKA 5F32A 5BUVA 1HJFA 2LALA 3LD8A 3WF1A 3R4DB 4DS0A 4GMP0 3LF7A 4AEDC 4EWEA 4W65A 4DRVA 3SCHA 5LA0A 3JUUA 4QU2A 3AFGA 1RUI2 1MS5A 2WINB 3HBZA 2O14A 5LBEA 1W3VA 3A21A 4A44A 3VBUB 4AFBA 4CDUB 3N9NA 2KR2A 3RFRA 1YJLA 4DO0A 2VUDA 2V5DA 2BEOA 5F8PA 3MYXA 3KCXA 4IE6A 4OQ8A 3P1IA 5GLUA 1LRHA 1H9WA 2BYVE 4CDQA 1VBD1 4CCMA 5IK4A 1SFPA 2AREA 2EIDA 5GALA 3LE0A 5C9AA 2VVEA 1SCSA 4AGVA 2WS91 2YV8A 3GXUA 1Q5OA 3N9MA 1COV2 4LOSA 4QXKA 3SEPA 3MLLA 5A7WA 1CPMA 1D2SA 4JTOA 5A3LA 4MGYE 1RUF1 1UW8A 3U10A 1UCXA 2YBPA 1Q43A 2J1AA 3SCFA 5JR2A 1SQ4A 1YCIA 5DN2A 4NIHA 2Y26A 4YVSC 1IS5A 4ZU5A 1MS4A 4XFIA 1J58A 1IGOA 4RL7A 1MVEA 4QPGA 3E1F1 3J7MA 3JBG3 1BEV2 1M4WA 1COV1 2SBAA 4O9EA 5EJ3A 3GJAA 5L19A 1GU3A 2IXKA 2YZ4A 4V1PA 3ZYJB 4A7YA 1KGYA 2LROA 3GJBA 4GULA 4YGBA 2C0ZA 1C3HA 5A6ZA 1RUE2 4AFAA 4B29A 1S1AA 1X33A 5T52A 4YNIA 2FZ1A 1KQRA 3IMMA 4GMP1 1VBE2 2IC1A 2RS11 2E32A 4OCTA 3ZSLA 5L7OA 2XG3A 2X05A 1BEV1 1YQCA 3T4VA 4RQPA 2W08A 2IVJA 1RTVA 2B9VA 3O1SA 3JBG1 4NWWA 4K8RB 4OZXA 4AHZA 2D97A 2H6CA 3WUDA 3RI9A 3ZXDA 1OLRA 3LKJA 2DTYA 2ZGUA 1FNYA 5T5JA 5FRAA 3AMNA 3C2UA 2Z2SB 2X5IB 1Y9GA 5JI7A 4OLLA 3I3QA 5EJ1B 1SFYA 1OLMA 3TWIA 2BNNA 4D6QA 2B5HA 3H8UA 4IE0A 2ZZJA 4N43A 2QFEA 1PVC3 5IJRA 2DCKA 5I91A 5DPNA 2VW2A 3VZNA 3MO4A 2CSGA 1O8PA 3ZSMA 1DG6A 4QGMA 1FPN1 3PVBB 2GNDA 4ZPIA 5FBZA 2LM3A 5F2SA 2CGOA 4FQ4A 4J6GA 1KXGA 3LEKA 4XXAA 1CR7A 2DVBA 3UETA 4LXLA 4WVWA 1ZRDA 2BW8A 2RG4A 1FI2A 4CCDA 3H9AA 2UWBA 2VZRA 2C24A 3B9CA 3AKTA 3AKQA 4FPGA 4M0NA 4UF0A 3CBNA 3JCIA 4EYUA 1XNBA 3LSDA 2Y6KA 3ZN6B 2WNVC 5T5LA 2ARAA 4Q27A 3J8F1 2BOIA 5J7MA 3FMGA 4AFDA 4M01A 4CU7A 4Q2FA 5T5OA 4LKDA 4FOVA 1CVNA 3N35A 2LW8A 4V2WA 5A7SA 4CTEA 2BGCA 1RUG2 4GALA 3ZMNA 4K1YA 2NYYA 2YMZA 4BQYA 4CCJA 3ACHA 1RVF1 4QU1A 4XF9A 1HX6A 1MS9A 3J7LA 3DXUA 1CAUA 3CJXA 1F31A 1A8MA 3NKGA 4XF1A 4B4QA 5C3OA 5C9AB 1ZBE2 2WNUA 4JHTA 1HKDA 5KXEA 1E5RA 1QIQA 3KVBA 5K8SA 2F17A 3Q8CA 1OA3A 5IVYA 5CFCA 2A3YA 4D7TA 1SHWB 2GC1A 3D5OA 4IESA 1KITA 4JTNA 2DFBA 4LBNA 3UK9A 1FX5A 5FMOL 2J1EA 3S30A 1J59A 3E6CC 1S0IA 2JWPA 4FO9A 4XUOA 5LBFA 1RXGA 4XZPA 5KHHA 4L9BA 4E4SA 5JLVA 1NYWA 3H1WA 2R0FA 2Q0AA 3OGRA 5LRSA 4AQSA 1AX0A 3KF3A 4MLOA 3ZYRA 3OTFA 4RN5A 4MYEA 2VTXA 4YW7A 2RS31 5DABA 1W05A 2OQ6A 2W5FA 3KMHA 5DAXA 5FPBA 3PMSA 2PHXA 1RUF3 3OUHA 3RYKA 2D7FA 2HBTA 2YC4A 1D4M3 3VL9A 1QQP1 4ZY9A 1KS4A 2JDPA 5BV6A 1WCSA 5IVEA 3MZHA 1ULFA 3O0WA 4O9GA 2BUKA 3NAPB 1W9TA 2H0BA 3KWVA 3PJQA 5FZOA 2ZMNA 4H7MA 1GR3A 4M3CF 4NOTA 4W4ZA 2E51A 4MGIE 4YPJA 5JSPA 4EWDA 1QWRA 2WYSA 1RGSA 4BA6A 2JB8A 3VHRA 4LMFA 3D8CA 1VBD2 3C8XA 3RS6A 2R061 5C3QA 1LENA 1Y9QA 2OW4A 2J1UA 3ILNA 2J1SA 4TYSA 5H9PA 3SXWA 4AVSA 4I3PA 3WDYA 1QDCA 4PLNA 4BLJA 2AYHA 2O8QA 2VVDA 1CN1A 2ZEWA 4Y33A 2Q8DA 3WXPA 1RUF2 3BIEA 4AEDB 2WAOA 4Q29A 3UESA 3WP5A 2BFUL 2DYCA 1O3QA 2JG9C 5T3NA 3U75A 2SLIA 5CEHA 1N1SA 1JZ5A 4LBJA 1ALYA 2D3RA 3B00A 4QM9A 4CUBA 5IYYA 3FC0A 1ND2B 2AC1A 2W39A 2WNEA 4C1XA 3MBWA 4XHXA 4FPYA 2VZUA 4NPRA 1X8MA 1C8M2 4PDWA 2OT7A 2VNOA 1I1EA 2JDUA 5FZMA 4MG2A 5FPUA 1O6UA 5HPOA 5EXOA 4G9SB 3MICA 4KWUA 2RS12 4LTAA 2Y0IA 3H50A 2HWD3 3LEGA 2V73A 2P34A 4JGZC 1ZBE3 3VUOA 3MW3A 3IKWA 3OD0A 5FMCA 4N7UA 1WZXA 5C4WC 3ZM8A 1DQ2A 1S0DA 4XVHA 5LK5A 5I0UA 4JRLA 1IQDC 1AX2A 4CCLA 5FPAA 5CAZA 3UT0A 2Q8EA 3PIGA 3VZOA
chains in the Genus database with same CATH topology
4AHYA 1ZZCA 1YI9A 3SH4A 2I07B 4Q8KA 2HWD2 1CJDA 2VUAA 4QM8A 3WVJA 2GNBA 2RS51 2EVXA 2DCTA 3N7LA 1DQ5A 1K5MA 4XETA 2ZBJA 2Y38A 5CVRA 1XNDA 5HCBA 1LGNA 2JE7A 2HJIA 2BPA2 5A32A 4Q4X2 3VKOA 3HAGA 4Y1UA 2D98A 1TMF3 3GF6A 4DB5A 2HWD1 3UJQA 3E5UA 1YYNA 1TE1B 2ZABA 1VRH2 2TUNA 2RS52 2VECA 3PVNA 4YVWC 3WINE 5CADA 1AR82 2X5IA 2A75A 3MI8A 3M8LA 1BKZA 1ONAA 4HBNA 1ZBA1 3RZZA 3QCWA 4N43B 1FPN3 4OVEA 1C4RA 1N1TA 3SISA 2PA7A 3ROUA 3MDPA 1NA1A 1WCDJ 5C33A 1SFNA 3POYA 4R8HA 4DPNA 3MLKA 1NQJA 3KD4A 1WLWA 2BTVC 2D6LX 4AHWA 2AR6A 3ZIXA 3ZIWA 5DDJ3 3LWCA 2EXHA 3K48A 4EJRA 3HD8B 3FWEA 4DFSA 2RR11 4FP3A 2A6VA 2I45A 4RQPC 1ND2A 3ES1A 4D94A 2K0GA 3WW2A 3RQ0A 1PZ8A 3VBOB 1LCLA 3BU7A 3KT1A 2O0OA 4Q4W3 3VKLA 2CAVA 1DZQA 2O8OA 2BBVA 1CAUB 1RC6A 2DV9A 4URTA 3SH5A 4FPLA 1WLTA 3CL1A 3QH6A 4I02A 3M3EA 4UW5A 3ZMOA 4HT1T 1QY4A 3UV9A 4C0HA 1C8NA 4GH4B 3ALQA 3FZ3A 3GYDA 4JGZA 2AENA 1RUH3 2PELA 4I30A 1AL23 2P17A 3I59B 1G86A 3AXDA 5BNQA 3WUCA 4RS5C 3FLPA 2OZ6A 4NO4A 2WZR2 5IT6A 1YFXA 4IEOA 4E2QA 2PAMA 2ZCWA 3AKRA 4YW1A 1CJPA 4AEMA 3I59A 2VVFA 1A3KA 1YRZA 2CTVA 3BTAA 3GBGA 4AWDA 5HXVA 2VULA 2NMOA 1LJ7A 2HWF2 2RMU1 4IEQA 1AUYA 2O1QA 1PM7A 1UAIA 1UIJA 1N3QA 2NZ9A 1YNAA 1FT9A 4OHZA 1JXNA 2GALA 4XW3A 4AW7A 2AGSA 4XF4A 1POV3 5H9SA 2MHFA 4IETA 2CGNA 4DINB 2VQ0A 1RUC1 2WA3A 3SCGA 5KXDA 1GYKA 1DU3D 4W6XA 5L73A 1BCXA 3DKWA 2ZGRA 5GKAC 4P9GA 1H1AA 2XJUA 4XQDA 3JB4C 2VUJA 2JENA 3ZXAC 3WV6A 5KHJA 3QH7A 3SHRA 4LO7A 4ASLA 2P3JA 5HCFA 2EAKA 4JGYA 1DGRN 4D69A 1NCQA 3R4UA 4SLIA 2QNKA 5I8SA 4EN7B 1R081 3TRSB 4WM7C 1NQDA 3E6DA 2MEV2 4FBFA 1H8TC 1LGCA 2WLQA 5J36A 3M3OA 4XIOA 1TMF2 4XJWA 4CEWA 1WLDA 1LR5A 4IV1B 3KZ4C 2YHJA 4ZXKA 2EXKA 4Q4X1 3ASIA 4X6RB 5LK7B 1J3PA 2RS13 4BM8A 1AR63 1CAXA 1RB8G 1I5ZA 1WW4A 3THTA 3VBHB 1RVF3 1H4GA 5ACA2 1OQDA 4FPCA 4RHV3 2PHLA 4QGNA 1O4YA 2DF7A 3AKSA 1QOOA 3VBRB 4S2DA 5DXDA 1A8DA 3R0RA 1R1A3 1KRIA 1NE4A 1UIKA 5CG8A 1C1LA 1W6PA 1YIPA 4UW4A 1N3OA 3J26N 5ACA1 3M4FA 2E6VA 2CL2A 2P3IA 4E2SA 3APBA 4KWKA 3LOIA 4GB32 3PTYA 5E1RA 3FFQA 5DZFA 3NJZA 2WFF1 5AFEA 4Y22B 3WLUA 1I9RA 4JGYC 4KWJA 3ZXKA 3U0ZA 1OKQA 1HQLA 4KNCA 1MVQA 3VBSC 5FPXA 3OD4A 2XUMA 1VIWB 2RR12 4BLIA 4P9IA 2CYFA 3ECQA 2WZPP 4IEVA 3DN7A 3NVCA 1D4VB 4AE2A 3AMMA 1OPMA 4L97A 4ONUA 5GLTA 3TYJA 4EN0A 3O7OA 3OBTA 1LOBA 4JAAA 3AZVA 1JHNA 1CAWB 3MPPG 1W0PA 4Q0QA 3EQEA 4AI0A 4LLFA 2E53A 1OPOA 4CDXA 5BXXA 2B42B 5GLVA 2HWC3 3R4SA 2XJRA 2EIGA 4P9JA 4RQPB 3QOPA 3POWA 1F8VA 2EF6A 5EWSA 4B7EA 1TME1 3WP4A 2JG8C 5C6CA 4CDUC 4LBOA 3V0BB 1QJU1 1QF3A 2D40A 1RUJ1 3WP6A 3WZ1A 2N7GA 3WOGA 1VBE3 2GC3A 3JQWA 1W6OA 4JDOA 4COVA 3MW2A 4U2AA 1GZ9A 4ZU7A 1H8TA 3BCWA 2ZGKA 1R1A1 3LB9A 4PLMA 1QJU2 2UY8A 1D4M2 4AG4A 3MF6A 2ZPXA 4BCUA 2ZOEB 4G4FA 1VBB3 1GQHA 2XWBB 1S0GA 4IEUA 4MVTA 5JR7B 5BNPC 2WLPA 2B39A 1ZNPA 1SDWA 3WDUA 4XQWA 1R1A2 1I3HA 1LHVA 4Y1YA 1LB2A 4LBQD 4BQ1A 4K7JA 1LGBA 3ZFEA 2ES3A 4LE4A 1RUC2 1Z78A 2FZ2A 4N53A 3J8F3 1H1IA 2YGLA 4YZ3A 4YGDA 4E9KA 3KGLA 1W6NA 2DUOA 2R071 2ZHLA 2Z5WA 1PO13 1UN1A 1FMD1 1QXRA 4LBMA 2XH6A 3S7IA 1W6MA 4GXLA 1VBC3 2GN3A 4XILA 3VKNA 3WG2A 3VDDC 1B35A 5FAXA 1HXS2 4KWLA 3VL8A 4Z82A 1BBT3 3GALA 2MEV1 1NA1C 4C0BA 5JIUA 4LHKA 4XYXA 4QQLA 2ERFA 4UXAA 4X6QB 1AL0G 1FOD1 1RUD2 5BY5A 3CLPA 3P3PA 2ET1A 5GZEA 1V6NA 4HVRA 1W6QB 5SV8A 4PIXA 1ZRCA 2DVAA 4YVSB 2BQPA 2B8MA 3FX3A 2QVSB 4I01A 4AQTA 4KBBA 3N7JA 1ZZBA 4CDXB 2XJPA 2GZWA 4TWTA 1OMIA 3KS7A 4XTMA 1D0GA 5I0SA 3B5LB 1H30A 1MACA 1VBA3 1H2LA 3BALA 3JU9A 3TBDA 1MZ5A 1AYN3 3GNEA 1IZ3A 1Q8OA 4HVQA 1C28A 3FLRA 2XBO1 1RHI3 3MIFA 5AC91 5BNNB 3AM2A 4JCKA 3GHNA 4MXWB 1YHFA 5EYYA 4HN0A 4WBBA 3P3NA 2WKKA 3HMYA 3INAA 3H1MA 4PIYA 5F5QA 3TN93 4OHWA 4Q0VA 3VBFB 1RUNA 3ILRA 2RE9A 5C4WA 5FPZA 1NOVA 3NV4A 4B7KA 2UYAA 4AGRA 2G9FA 2GH2A 2WFPA 1NY72 3PMEA 2VY0A 4GQ7A 4QQHA 5I0TA 4C91A 4KQ7A 3KQRA 3MLJA 1UU5A 5GJ6A 3KGZA 3V56A 2DTWA 4I3GA 1OFSA 2QKDA 2PHFA 4XBLA 1BMV1 4L2NA 3ZXJA 3WW1A 1IQAA 1BXHA 2IXLA 1OHFA 1FAYA 1UD1A 4F8AA 1PZ9A 3W59A 2BWAA 2IXHA 1H1MA 5IUQA 1RJ7A 2ZGQA 3AP4A 2IXJA 2IXCA 1YIFA 4Y22A 4H14A 3WDXA 3TAYA 4AEDA 1BMV2 3D6EA 1CONA 1CIWA 2IWGB 5FFOC 4M00A 4IV1C 1W6MB 3QD6A 4YG6A 4QPYA 1TME2 3HIFA 5F9TA 4FAHA 1OSGA 3Q9OA 4Q4V3 3LSEA 2A71A 1C1FA 4PQ9A 1ULGA 4COZA 1CAWA 1FYUA 2GMEA 4F3JA 2C5DA 3VDDB 3ZPYA 2D6KA 3B3QE 4N90A 1ULCA 1NG0A 2DCYA 2HWC1 2JICA 2ZGPA 4UW3A 1UKRA 1GICA 1EV11 1IPJA 2GMPA 1ASJ3 4Q4Y2 2KA3A 2C9AA 3M7AA 1A78A 1MQTB 3NO8A 4ZU4A 2DWRA 3VDDA 1RJ8A 2X5IC 4TLFA 4YARA 3C3VA 2WQ4A 3KLSA 4X8NA 2E7AA 1V00A 3VBSB 2C1FA 4WM8A 1ZZ7A 3IPVA 3WNXA 1FATA 4YW5A 4YZ2A 4Y24A 3HT1A 2HKXA 1LHWA 1MS3A 3ZYGA 1VAMA 1QJX3 2R1BA 2RJLA 3AMQA 3L2YA 5DG1A 4CYDA 3ZFGB 5BNPA 2KM2A 1CESA 4M3CA 4AK3A 1H2KA 1PK6C 4MSVA 4WM8B 1HXS1 2HWF3 1V9U3 1WBLA 1PHMA 3ZO0B 2D44A 3WG4A 1RUE3 2FBEA 4P5HA 2K2SA 3ZN5A 1REFA 4LUMA 2D6PA 5E8AA 1ZX5A 3VBUA 4Y1XA 2TEPA 1F5JA 4XE9A 2A6YA 3LOBA 3AFKA 3LCPA 5FREA 2XB6C 3E5XA 4IV3B 1YI7A 4HN1A 4Y1ZA 1VBA2 4KU7A 2Z42A 4GWMA 3OGGA 1O5LA 4I09A 2YGMA 1OQ1A 1M06G 3POSA 4W6YA 1HRI2 2ZKLA 4E2GA 1UU6A 5KC5A 4OHXA 1VBA1 2XBO2 1QH7A 2ZGSA 3AZXA 3ZDSA 4LO8A 5KXCA 4XQ4A 1C8M3 1LEDA 4L92A 5JAXA 2OYZA 3WQ7A 2OVUA 5JVVA 1NCRA 4N9HA 4N53C 1QJU3 2D3PA 2R042 1MR5A 1EPWA 2VGDA 3ZFEC 4LNVA 3V0BA 3OY8B 5J37A 1O5UA 1RUC3 2IXIA 1RUH2 2WSUA 3SH3A 2CV6A 4FPEA 3CJIC 5FO8B 1MEC1 2R6QA 1GNZA 3AKPA 4Z92B 1N3PA 4XJAA 4UBGA 2VG9A 2ZX0A 3IN9A 2B9UA 5E16A 1PNGA 3QLQA 3VGIA 1KDMA 2ARBA 1GFF2 4DOUA 1AF9A 2YYOA 2YROA 4S2FA 3VBFC 4C90A 4K8FA 3R6SA 3IWZA 2RM21 1MEC2 5GZFA 3VBFA 4ISRA 3FJSA 4XXPA 4LHLA 2DU1A 5JZGC 2WS92 4XMIA 1EAH1 2PTMA 5KBFA 3HT2A 1AXZA 4CDUA 4BMBA 2VXRA 3WX5A 3IM0A 2PAKA 4NWVA 3DGTA 4CDXC 2A6XA 4HLTA 3H7JA 3M3QA 1LU2A 5T50A 3ST7A 2GAUA 4Q0PA 4LUKA 3B69A 4PF5A 1A6CA 2D93A 4IEZA 4XBQA 4CP0A 1ZVFA 5JWPA 3WDVA 1ZZ9A 2WL1A 4NHLA 3AP5A 1VBE1 1EV12 1QOSA 1PMIA 2WT1A 2RS53 3DL3A 3OF1A 3JBG2 4A7ZA 3O5SA 4KG8A 5J98B 4RHV1 4E4DX 3ETQA 2G4IA 1AYN2 1WLCA 2OZJA 3A0NA 2HWB1 1OOPB 5FOBB 1UL9A 1AR61 4MXWA 1DYPA 2XLFA 1QU0A 4XBNA 5A32B 4ORFA 4KGQA 2IFWA 1QXJA 5GZGA 1SLLA 3BOPA 4Z1VA 1AYN1 1REEA 3NL1A 1BQPA 1FPN2 2HEYF 2QZ3A 4AI2A 1AR62 4AI3A 1ULEA 1NLSA 4FOYA 2DCZA 4MGKE 4OHVA 4YVWB 1QJY1 1G9BA 1ND3B 4YW3A 1XNCA 1K5MB 3WDWA 2DUPA 2DU0A 4RD7A 5BNOB 2NP0A 1VBD3 3UKTA 1IS4A 4C1WA 2E7QA 3MF9A 4Y20B 3T1MA 3J8F2 1EAH3 1LOEA 1WBFA 3DPRC 3MGUA 1LULA 4XDQA 4BZ4A 5JOZA 3OJBA 4P9WA 1KS5A 3QACA 1DQ4A 1AHSA 1VBC1 5JDBA 1I6XA 4LA3A 3USUA 5EV7A 2XVLA 3AYAA 2CWSA 1RVF2 3RJRA 5ACA3 2OUHA 4AVAA 4LBLA 4HKWA 2IFRA 1ZM1A 4AVVA 4OUSA 4DQAA 1CX4A 1Y43B 2DVGA 4XFAA 4L99A 1Z7S3 2F6BA 3ACLA 1HRI1 1DDLA 4Z2WA 3WDTA 1AR92 2NLRA 5JCTA 4BMEA 3ZXEA 1G6NA 2BNOA 4GB33 1SLBA 1OLQA 3HQXA 1VBB1 4PCRA 4YM2A 4I2OA 1DHKB 2UWCA 3TN92 1GNHA 1QMJA 3AJZA 3R05A 4QQPA 1BVP1 1PGSA 2JKBA 4E27A 3AYCA 1G9CA 2RS32 3OYWA 4K40A 2WNUB 3VZLA 1ASJ2 2RS33 2W0XA 3I54A 3JD73 1EY2A 1G9DA 4WM7B 2Q4SA 4K1ZA 1RUH1 3IBMA 5B2GB 2P37A 2EXIA 1ZRFA 4GKXA 1R083 5JOYA 3JD71 1N47A 2YC0A 1Q3EA 3MFCA 1XXNA 2RHPA 2PHWA 1S0EA 1ASJ1 3N36A 4RFT0 1N1VA 5ABJC 2VH9A 5KHGA 1MQTA 3ES4A 4GIQA 4RS5A 1C5HA 2RM22 4A2UA 1RUI1 4GA9A 4XOGA 3K51A 1X50A 2WT0A 4Q26A 1JYIA 2CAUA 3FUQA 1X8EA 4AEKA 1WD3A 1COV3 2ARXA 3NWKA 1Z7S1 4CP2A 3TNQA 3ZFFA 1DGWA 3PLQA 3ELNA 4J1WA 1PGL2 3BPZA 2UWAA 1C8M1 5CB7A 3UL2A 3M2MA 2FMDA 1PO12 1UKGA 2ZAAA 5BPXA 1EYBA 5CBLA 1SLTA 4LA2A 1TEIA 1APNA 1FXZA 3IIAA 5DDJ2 4Y4YA 4YZ5A 2VMHA 4CDWC 3DPRB 2P2KA 1W39A 2Q30A 1XYOA 2NN8A 2JE9A 3D4KA 4FPHA 4Q4W2 4IV1A 1YUDA 5T54A 2RMU3 4FTEA 3ATGA 1J1LA 3VV1A 3OGJA 3BB6A 4DRRA 3AMPA 1F9KA 2EAAA 1DQ0A 3H3UA 2VNGA 5JSOA 3IMNA 1FNZA 2E9QA 1MEC3 1FV2A 4HETA 3VBOA 2JG8B 5LEKA 3VBHC 1LECA 5AVPA 4CP1A 5H9QA 1YFWA 2YY1A 4F83A 4IEPA 3AK0A 1RUG1 1DGRA 1JN2P 3OCPA 2VW0A 3FFZA 1VALA 4GKYA 4K9SA 5JPMB 4XPVA 1QXPA 4ISQA 3T2TA 3VBUC 2A6ZA 2JXAA 2MPFA 1VBC2 3NV1A 4XEZA 1GQGA 3V0AB 1LEMA 1UX6A 5E89A 4QD2A 4ES8A 2BVVA 2HWE1 5A33A 2Z69A 2NMNA 3B9IA 1IKPA 4R9BA 5C4WB 2QQPA 5ABJB 1DFQA 4HZFA 2A3WA 1C5IA 1LODA 3ZXGA 3O12A 1RMU2 2ZAHA 4IQPA 3U4XA 4Q1PA 3ME2A 3AP9A 1U5IA 2PHRA 4AVCA 1H0BA 1QQP2 5J09A 1POV1 3GBWA 3MIEA 1PIV3 1GKBA 3MIBA 1YWKA 3TN91 2BVBA 3TNPB 4BYYA 4MZUA 4QHBA 4KG0A 1HRV1 4P9LA 1BEV3 1LHUA 5DZGA 4Y1VA 4MV2A 2ATFA 2GNTA 2JG9A 1U0AA 5JI9A 4RR3B 2WQZC 2VMIA 3ZXLA 1WUVA 2JDZA 3TOJA 3ZX7A 5D1IA 1VAKA 4N43C 3RYRA 2RJKA 4DXZA 4AI1A 4YGEA 1WW7A 4LHNA 5EYXA 3VN4A 5HCAA 1Q8QA 3KCCA 1OI6A 2I74A 3NV3A 3RG0A 1H8VA 2QDNA 5CNAA 4AQ2A 1PZ7A 1O3RA 4FAGA 1BJQA 4QX5A 3O0XA 1OFNA 2WNVA 3AZZA 3THPA 4EN6B 3IT8A 1PVC2 2HWB3 1Z7S2 5FLHA 5CFDB 1BBT1 1QDOA 1WMFA 2R062 2RMU2 4M3CB 1PGL1 1BZWA 4I0AA 5I8YA 3BOWA 1MZEA 1HQNA 4B4RA 4LBQA 4E4ZA 4YG0A 4OFGA 3UKNA 1RHI1 1GLHA 4EROA 2ZX4A 4YW4A 1CAVB 4MH0E 3RDIA 2QJVA 1PO11 1O4ZA 2XLGA 1BBT2 4INDA 2JEMA 4YZ4A 1V6JA 3S6PA 5DUUA 2RR13 3VZJA 5FO7B 3M70A 1S2BA 1LOGA 3B01A 3KSCA 4M3CE 1MS0A 4Q1RA 1SBDA 3HN1A 1BVVA 3ZXFA 5FMOS 3FLTA 2VOVA 1O91A 5GM0A 3N7MA 3FBYA 1W6NB 2ZGNA 2WNUC 4XF0A 4BHPA 5BYNA 2CGPA 2PHTA 1MZ6A 3KB5A 3G7DA 1BK1A 5CFCC 2OA2A 1QQP3 1Y3TA 5F6KA 3URFA 1X82A 4HANA 4XJ8A 4AEJA 1TMF1 5C8WA 1WCKA 4K21A 1ZBA3 4XHBA 2ZX2A 4IV3A 1B09A 4I0BA 1ZBA2 1SLAA 1IS3A 2JX9A 2PYTA 2GN7A 3RMYA 2XLAA 1VP6A 3EBRA 1RUG3 1WD4A 4QMAA 1NCQB 2A6WA 3ZFGC 4QPGB 5C8CB 1WW5A 2AUYA 4LULA 5AVAA 2WC2A 4WVMB 2WSVA 1TQ5A 5DUXA 1AXKA 4AVBA 2B7YA 1GSLA 4QQOA 1RIRA 3OPZA 2DVFA 3H1YA 4KL1A 4AYUA 4QPIA 2OIIA 3SNMA 3IDCB 1VLNA 3GZUC 4JDNA 1AR81 5I8TA 4LBQB 4RR3C 1NCRB 3VBOC 1V6IA 4D3WA 2VOXA 1AR73 5I93A 2CY6A 1LOFC 2WFF2 3RJ2X 1HDKA 1N1YA 1QOTA 2LTNA 5GZCA 3MIDA 3RNSA 3FBMA 1NE6A 4FXKB 4CDWA 2GC0A 3NKTA 1S0FA 2ZACA 4BOWA 2E63A 4YYOA 3N4MA 2NPIA 3PJYA 2HEVF 1U5YA 2D6MA 2PFWA 1HV1A 1XYPA 5DZEA 3V0AA 2WFF3 1NLRA 4FP2A 5CA6A 3DPRA 1HRV2 1ZYBA 4WM8C 3VKMA 3ZFFB 4CEWC 1JTZX 2ZGOA 1PVXA 2VW1A 3WQ1A 4K3UA 1SBFA 4YM3A 3FE5A 3S0MA 1QKQA 3V65A 2JECA 1RUD3 4CDQB 3NAPA 1SEFA 2A70A 3CJIB 1UPIA 2D5FA 2R043 1Q8PA 1XQNA 3N7KA 4NHKA 1HXS3 2HWF1 4XFBA 1ZA4A 2K9ZA 2WA4A 2JG8A 1AXYA 4Q0UA 2ZHKA 2CWMA 2HYKA 4JVAA 4S2HA 2QCSB 4YGCA 5CFCB 2Q8OA 4P9XA 1PVC1 3D82A 4LO6B 5IK8A 4LLOA 1D4M1 2QE3A 2ZHMA 2UYBA 2ZX1A 3LGRA 5T5PA 2NM1A 1QH6A 1V6MA 1B35C 2WZR1 4AFCA 1ZZ6A 1H2MA 2V5YA 3IPVB 1IKQA 1AR71 2ZX3A 3ILFA 1GBGA 2XJVA 4OI0A 1RHI2 5L7OB 4XFGA 4LO5B 1Y7BA 3QBQA 3H0OA 1XRUA 1PGW1 1TNRA 1VR3A 4PBPA 3UJOA 5K7PA 1QNWA 3ZFEB 3J9SA 3WD5A 2IZWA 1SLCA 2XL9A 3T1LA 4LR4A 2R30A 1AR72 1R082 1G8WA 4YW2A 1AYM1 2R072