2MEV3

Structural refinement and analysis of mengo virus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
231
structure length
231
Chain Sequence
b'SPIPVTIREHAGTWYSTLPDSTVPIYGKTPVAPANYMVGEYKDFLEIAQIPTFIGNKVPNAVPYIEASNTAVKTQPLAVYQVTLSCSCLANTFLAALSRNFAQYRGSLVYTFVFTGTAMMKGKFLIAYTPPGAGKPTSRDQAMQATYAIWDLGLNSSYSFTVPFISPTHFRMVGTDQANITNVDGWVTVWQLTPLTYPPGCPTSAKILTMVSAGKDFSLKMPISPAPWSPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
total genus 33
structure length 231
sequence length 231
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev300
1GFF2 2RM22 2X5IA 1POV3 4GMP1 4N53B 1AYN2 1AR91 1EV12 5CFCA 4Q4Y2 5C4WC 1MQTA 2XPJA 3ZFGC 3NAPC 1ASJ2 1B35A 1BMV1 1FOD1 1RUJ2 1VBB3 2RM23 5DDJ2 4AEDA 2R062 1PGW2 3VBUC 5C8CA 3VBOB 1RUJ3 1AR62 5DDJ3 4N53C 1VBA2 1AYM3 2WS91 2BPA2 1VBD3 1R093 2R071 3VDDC 1ND3B 5A33A 1RUC1 1AR63 5C9AA 1RMU2 1FPN3 4QPIB 4Q4V1 4CDQC 2RR11 1POV0 1QJZA 1RUD3 1VRH2 3VBOC 1RB8G 4YVWA 5ABJA 2HWD2 1POV1 4WM7B 1PIV2 1ZBE3 4QPGA 1QJY2 3ZXAC 4JGZA 3LOBA 1RUG2 4JGYC 1HRI3 1M06G 1VBB1 1ND3C 1NG0A 3JB4C 3FBMA 4QPIC 5C4WA 5BNOB 3ZFGA 3NAPA 1BEV2 2HWB2 1AL0G 4RS5B 1TMF2 4FSJA 2HWF3 5L7OB 1AYM1 3VBUA 1RUH2 3VBRC 1OHFA 1AR73 5AC91 1VBD1 1R091 1MEC1 2FZ2A 1RUI2 1NY71 1QQP1 4N53A 4FTEA 1FPN1 5BNOC 4CDXB 1HXS2 1RUD1 5J98B 3VDDA 4RR3B 1R1A2 1RUI3 1HRV3 3JB8A 1ZBE1 1R082 2GSYA 4Q4X2 1AUYA 1PGL2 2Y26A 5BNNB 5L7OC 4CDQA 1AR82 4PDWB 1ZBA3 3VBOA 1BBT3 4CDWB 1R083 5FMOL 1QJX2 1ND2C 4JGYA 4NWVA 1C8NA 5D8AB 4Y5Z0 3JBG1 4CDXC 1TME3 2XBO1 4RR3C 1ND3A 5ACA3 1COV2 1PVC2 1C8M3 5CFDC 1PO23 4CEWC 1QJX3 1QJU2 1Z7S2 1D4M3 1RUF2 2ZAHA 4QPIA 2MEV3 3VBFB 5BNNC 1AR71 1K5MB 4IV1B 4PDWC 4CDWC 4WM7A 1RUE3 4GB33 1NCQB 2WFF3 3VBRA 4RFT0 1QJU3 5D8AC 1VBE1 3ZFFB 4YVSB 1RHI1 4FTSA 1HRV1 2RS52 2WLPA 5BNOA 4FTBA 1X36A 1ZBA1 1OPOA 2RS32 2HWC2 1BBT1 2RS12 2BFUL 4RHV3 5L7OA 1NCQC 3VBHB 1NA1C 1TME1 5A32B 5ACA1 1ND2A 1AYN3 1EV13 1PO21 1D4M1 4Q4Y3 4CDXA 1VBC2 4RR3A 1ASJ3 1RVF2 1RUE1 4GB31 2R063 2R042 5CFDA 4CEWA 5BNNA 2WFF1 3VBHC 2WZR2 4PDWA 4Q4W2 1NCRB 4N43B 4CDWA 2FZ1A 5FOJB 1VBA3 5D8AA 1F2NA 4RQPB 1V9U2 1OOPB 1F8VA 1QQP2 2VQ0A 4RHV1 1RMU3 3TN92 4IV1A 2BBVA 1AL22 1VRH3 3JD72 4N43C 2RM21 2HWD3 1PIV3 1QJY3 1AYN1 1EV11 1NCQA 3DPRB 1RUG3 4Q4Y1 1NA1A 4RQPC 3VBSB 5JZGB 1ASJ1 1RUJ1 4Z92B 5DDJ1 4WM7C 5BNPB 2PLV2 2R061 1PGW1 1PO12 3JBG2 1CD3G 2XBO2 1BEV3 2HWB3 1AR61 1TMF3 1VBA1 1FMD2 3VBHA 1RUH3 1PO13 3VBSC 4EJRA 2RMU2 2HWE2 1NOVA 4RS5C 5BNPC 4SBVA 1HXS3 1HRI1 1MQTB 1VB4A 1EAH2 1VBE2 1VRH1 1R1A3 1B35B 2HWD1 1PIV1 4Q4X3 1RUG1 1AR83 3J8F2 3CJIB 4N43A 2HWF1 1AR92 4RQPA 5FMOS 1OOPA 3J8F3 1BEV1 1BMV2 2HWB1 1FOD2 4BCUA 1TMF1 1COV3 1PVC3 1HQNA 1Z7S3 1DDLA 1RUH1 1RUF3 1CJDA 4CEYB 3CJIC 1RUI1 1FOD3 5ABJB 4QPGB 3DPRA 2WS92 3VBFC 1K5MC 4CDUB 4IV1C 3VBSA 5JZGA 1W39A 2R072 4RS5A 5K0UB 2TBVA 5BNPA 1RUC2 1R081 2RS53 3ZFEB 1PGL1 2WS93 4Q4V2 2RR12 1AR81 3ZFGB 4CEYC 3ZFFC 4YVSC 3HAGA 2RS33 2HWC3 2RS13 1C8M1 1QJX1 2BUKA 2MEV1 4CDUC 4WM8B 1VBB2 5K0UC 2ZZQA 3ZFEC 1COV1 1PVC1 1A6CA 1QJU1 2IZWA 1Z7S1 1RUF1 1VBC3 3VDDB 1RVF3 2R043 1AYM2 4CDQB 2WZR3 4Q4W3 4IV3B 3CJIA 5AC92 1VBD2 5GKAC 1R092 1MEC2 1NY72 4WM8C 2RS51 1FPN2 4JGYB 3VBFA 1K5MA 1NCRC 1V9U3 1E57A 1RUD2 5AC93 2RS31 2HWC1 1MEC3 2RS11 1ZBE2 1QQP3 4Y4YA 2DF7A 3TN93 4CEYA 4IV3C 4YVSA 3ZFFA 1OOPC 1AL23 1HRI2 3JD73 2WWSA 3VBRB 1VBC1 4CDUA 4GH4B 1X33A 5K0UA 1H8TB 3ZFEA 1RVF1 4NWWA 2PLV3 1SMVA 2R041 2HWF2 3DPRC 5LK7B 2ZTNA 2WZR1 4Q4W1 1AR72 3JBG3 5A32A 5JZGC 2XBO3 2X5IB 1HX6A 1RMU1 3IDEA 5CFCB 1FMD3 1V9U1 4GH4C 2RMU3 2HWE3 1RHI2 4WM8A 1HRV2 1H8TC 4AEDB 1QJY1 3TN91 1ND2B 3S6PA 1NCRA 5C8CB 1ZBA2 1VBE3 1AL21 1EAH3 3JD71 1BBT2 5J96B 1RHI3 1VAKA 2X5IC 5CFDB 4CEWB 5CFCC 4IV3A 1MQTC 1TME2 1WCDJ 1B35C 4AEDC 2PLV1 4GMP3 5A33B 5ACA2 1C8M2 5C9AB 1AR93 1PO22 1D4M2 1PO11 2MEV2 4GMP0 5C8CC 4YVWB 1RUE2 4GB32 4JGZB 2WFF2 2QQPA 1FMD1 1HXS1 2RMU1 2HWE1 1R1A1 1VB2A 4Q4X1 5C9AC 4LLFA 1IHMA 4GH4A 5C4WB 1NA1B 3NAPB 1EAH1 2R073 1H8TA 3M8LA 4YVWC 1RUC3 5ABJC 4QPGC 4RHV2 4JGZC 2GH8A 3VBUB 2BFUS 4Q4V3 2RR13 3J8F1
chains in the Genus database with same CATH superfamily
3VZNA 4GKXA 3O1MA 1DFQA 3WEZA 3ZN5A 5JR2A 1POV3 5FKBA 4N53B 3H3ZA 3PVEA 4B7KA 5FPXA 2EICA 5CEHA 1KS4A 1KXGA 5ERLA 2B45X 5T5OA 4FFIA 2N7GA 2ZGLA 3RRDA 1NX9A 1B35A 2GU9A 4GA9A 1FOD1 1RUJ2 3IPVB 3Q8CA 2VXJA 2JDMA 1ACCA 5A1FA 1YJKA 2IXLA 3U14A 1TQ5A 3NV2A 3U07A 2YPDA 4FXGB 2VVEA 1XYNA 3UKNA 2C5DA 1FT9A 4CCLA 4MHUA 2JDZA 4LUMA 5F5CA 4D94A 1RUJ3 3OY8A 5FK7A 1AR62 2V4AA 5A7QA 4E4SA 3JQXA 3GJBA 1CZVA 3LCPA 2YGMA 4E8CA 1OMIA 1ZYBA 3ZOIA 3KCCA 3WNMA 3LQCA 2ADEA 2E6VA 2PAMA 2R071 1VMFA 3OBRA 4LBOA 4BQ3A 2XDVA 1W6PB 1VPHA 2V09A 5A33A 1PVXA 5A6ZA 1AR63 4CDQC 3RZJA 2WNEA 3BIWE 3GBWA 4A6OA 5C9AA 2KM2A 4QPIB 4B4RA 4Q4V1 1AHSA 2K46A 2RR11 3Q8AA 4AFMA 1POV0 2B5HA 3POWA 1ODMA 3WNXA 2OZ6A 4JDMA 4YG0A 2VNGA 4YW7A 2DURA 4CCNA 1POV1 1PIV2 4QPGA 4QQ2A 2XH6A 3L2YA 4V2VA 3H1MA 3U0ZA 2XHKA 1GQHA 4JGYC 4ES9A 2EAAA 4IEUA 2DVAA 2E51A 4E4ZA 3UKTA 1M06G 1Q8SA 2ZEYA 1HV1A 5T5JA 5C3SA 3KCXA 4M0NA 2XR4A 4Q0PA 4DEQA 3JB4C 5BNOB 4D0QA 1B09A 4AHXA 2HWB2 1HJGA 2X53S 4YRDA 5JOWA 4LA3A 4LEJA 1TMF2 1WBLA 1OC1A 1Y43B 4J25A 5FV3A 3E5QA 2QBXA 3N9NA 4Q5OA 5L7OB 4D8MA 5A3OA 5GJ6A 2TUNA 4FCAA 2VCBA 1UYXA 3CQOA 1MEC1 3R4DB 1RUI2 4Y3OA 4CA9A 3RZKA 1NY71 3DXUA 3NVCA 4GWMA 2QQIA 3E6CC 4FTEA 2W1WA 3CZJA 3IDAA 3E97A 3IDCB 1DHKB 1W6QA 5FBJA 3AP5A 5DMYA 2JD4A 1KGYA 3LDKA 3O7OA 4TYSA 5L9BA 2RDSA 3POGA 2AR6A 2Y64A 2A3YA 2EALA 1RUI3 2RDRA 1OI6A 2DDUA 5F6KA 4QX2A 4QT6A 4WV8A 1J84A 2F17A 3B9CA 4CDQA 4GJZA 1J3PA 3B69A 1W6NB 3V0AB 2X09A 3KT1A 3WX5A 3H3UA 1KDKA 1PMJX 5D1IA 4I0WB 4FBFA 4H2AA 3UK9A 4K6BA 3OUJA 3M2MA 4MGQA 2PHRA 4PF5A 1OUXA 4EV0A 2JG9C 2A3XA 4JGYA 4U36A 2ZS6B 1NAEA 2WNVC 1H4HA 4AGGA 4IEZA 4XF0A 1FAYA 2XBO1 2PTMA 2JDNA 5IVJA 4HPKA 2V4VA 2ZHKA 1COV2 4G3YC 4KGQA 5CFDC 1WD4A 4LBQA 1D4M3 2QQUA 4XDPA 2DCJA 5DZEA 4PDWC 4Y1ZA 1ULFA 2E26A 3HIFA 3N35A 2GC1A 4UXAA 2W3JA 2K0GA 1AJOA 2XLFA 4UFKA 5IFPA 4M3CE 5E89A 1RUE3 4UF0B 1NCQB 4FPJA 2ZX4A 1XC6A 3THCA 3ZFFB 3Q8EA 1YCIA 4QXBA 3T0DA 2SBAA 3H9AA 4R9CA 2YZ4A 1S0GA 4KH9A 5DUXA 4BOWA 4UAPA 4XXPA 2CV6A 1T2XA 1X36A 4M3CA 3JQWA 3SKJE 1BVP1 1W8UA 2BVVA 2AEYA 2RS12 3QCWA 1CWPA 1UPSA 4TZDA 3GM8A 4RHV3 4YW1A 1A34A 4MLOA 2RVAA 2P3KA 3VBHB 2R1BA 3PTYA 1FNYA 5H9SA 2JD9A 2R7EB 2E31A 5A32B 1WW6A 4I3PA 5A7OA 2VY0A 5FR3A 3VUOA 4GZ9A 2JG9A 2VW0A 3OG2A 2WNVA 1D4M1 4ATFA 2UURA 3RZZA 2PHXA 4GKYA 5J09A 2KD7A 4ARXA 4M00A 4M3CF 1RUE1 1UOBA 2R063 5CFDA 1IPJA 1W8ZA 4NPRA 3WDWA 3HNMA 2WZR2 1I5PA 3HT2A 4PDWA 3WNPA 3QLQA 1MS1A 3KLSA 2Z42A 3ACGA 1GR3A 1XSRA 3ETQA 1OLME 1QDOA 3LEGA 1J1LA 4LA2A 3LIHA 4JQTA 5FOJB 4Y1YA 4LJHA 3T4HB 1F2NA 2VGDA 3OGJA 4GULA 2HBUA 2EIBA 4AVSA 5IT6A 1JOJA 1H2MA 2Z69A 2OQ6A 1W8TA 5FP8A 3V64A 4RHV1 1RMU3 1DGWA 4XF1A 3D6EA 5A1AA 5FK8A 1OLMA 3C7EA 1PX4A 2ZX2A 2JG8B 2ZKNA 1CAUA 5CKNA 3W5NA 3NMBA 3MHZA 4LBQD 1SZBA 2VZTA 5LRRA 2O1QA 5LK5A 3MLJA 4INDA 2R30A 3WCRA 3O14A 4UFMA 4RQPC 3OF1A 4OI0A 3VBSB 5JZGB 3FN9A 1NUKA 4LTAA 5ANNA 1RTVA 2ZX3A 4XAAA 1MS5A 1MS9A 2PLV2 5JOYA 2R061 1HN1A 3VZMA 1GNYA 1AVBA 2GNMA 4HKLA 3ZDVA 1PO12 2VNVA 1AX2A 4H14A 3JBG2 2BWCA 1NE4A 4RN5A 3IWZA 3OEBA 4Y22A 2Y6HA 2VCMA 2PAKA 3WHUA 5SV8A 1SG3A 2WAOA 2YBKA 1L3JA 4FFHA 4AF9A 2BGOA 4R9AA 1RUH3 2JEMA 2YV8A 1PO13 3PJQA 4E2GA 4KWUA 4EJRA 1SBFA 1GBGA 2RMU2 4FPLA 4MXVA 5HBAA 3NNFA 4CCCA 3RQ0A 1BJQA 2EA7A 1IGOA 1ZZBA 1UY4A 2E9QA 2BOJA 1ALYA 4IESA 3QOPA 1GOHA 1V00A 3M3CA 4QDRA 4Y20A 3ZSJA 1HXS3 5DG1A 2FMYA 1TE1B 4QGLA 4QX1A 1B35B 3MIFA 4Q4X3 3ZSMA 4FP2A 1BHGA 1BYHA 4QHBA 4NUBA 4OHXA 1X82A 1AR83 3J8F2 2OIIA 3M7AA 3CJIB 4CUCA 4YGCA 1X8MA 4IGQA 4ASMB 1LHOA 1CAWA 1LJ7A 4HONA 4QX5A 1OLQA 1LOGA 1XOYA 2ZHNA 5A3PA 5FMDA 3N9QA 4KBZA 2PELA 4RQPA 4C91A 3BOWA 3O1PA 2FDFA 1ONAA 1OOPA 1VAMA 1TEIA 3J8F3 3MIBA 4LHNA 5A6QA 2WA3A 4U2AA 2B4KA 1LOAA 1RUOA 2DYCA 1LU2A 1QEXA 2XJRA 1HQNA 3BUCA 1RUH1 1RUF3 2IXHA 1JI6A 1P8JA 4XJ8A 1W06A 1Z78A 4J1WA 1CIYA 3N7MA 1WMFA 3TNPB 1DYPA 5FY1A 3RI9A 5LATA 3T3YA 4QPGB 5FIXA 2Y34A 2XLAA 5DPNA 4BH9A 3WG1A 3FLPA 2C1FA 1WA4A 1HDKA 4IV1C 4ISRA 3VHPA 2HYXA 2J1SA 1UAIA 4HLTA 4LHSA 5FUNA 5FZIA 2TBVA 2Y8KA 4XZUG 4QD2A 3ZFEB 1GMMA 1R081 4M4PA 1GQPA 2B39A 2W9XA 4FO9A 4PCRA 4M0HA 1AR81 2WL1A 4E9KA 2VMGA 1WMDA 1G7YA 2CHHA 1AJKA 2HWC3 2K9ZA 4QU2A 1W6MB 1IG3A 2MHFA 4ZU7A 3RZGA 4L9BA 1OT5A 2W47A 5F3EA 2BYVE 2ZGPA 2WUHA 4PIXA 3OD0A 4BMEA 5JMOA 4XEZA 1ZNPA 1W8FA 1YI9A 2CU5A 3U78A 4MOAA 3MW2A 4D3WA 1G9FA 1ZRRA 1RXGA 3HJRA 2GMEA 4IE4A 4YGEA 2QFEA 1VBB2 1UY1A 3IAQA 4LITA 3U4XA 1U5ZA 2JDAA 2CWMA 1A6CA 2VW2A 3I54A 1RUF1 3VN4A 2EAKA 1ZX5A 3B5LB 3MIDA 4IETA 1PK6C 3W21A 3OJBA 4QGMA 4JRAA 3I97A 5E8AA 5BNQA 2OYZA 3AVSA 2R043 3K4ZA 3AK0A 5IVVA 2IC1A 3QACA 2WQ8A 4PT6A 4LHKA 1LOCA 3EJKA 4CDQB 3GBFA 3C7OA 3KM5A 2K2SA 4IV3B 4AW7A 5AC92 2BOIA 1IG0A 2XKOA 2Y6KA 1UOGA 2DVGA 1MZ6A 1ZZ9A 4W50A 4LBLA 4WBBA 2Y6JA 2IXCA 1TZOA 3B3QE 3E5UA 5FO7B 5FZ6A 4OHYA 3V56A 2CTVA 1GZ9A 1K12A 2FQPA 4JGYB 2GNDA 1NCRC 4XE9A 2FCVA 3AZVA 1UKRA 5AC93 2HWC1 4D6RA 3KWVA 2VOWA 5FPLA 1EPWA 2Q1MA 2C24A 1ZBE2 4QB6A 3U75A 5LA1A 3WNOA 3TN93 1Q3EA 1VR3A 1GUIA 4C1WA 4HL0A 3U10A 1HRI2 1NXMA 3HNYM 3IIAA 2BBAA 3ELNA 3M70A 3KV9A 3N9OA 4CCKA 3CU7A 5FYTA 3DN7A 3M3EA 3M3OA 2VQAA 1YNAA 1O8SA 4HVRA 5CKQA 1BQPA 5FMBA 3JU9A 4YM0A 4K7JA 3MBWA 3MW3A 4IW3A 5T3NA 1E5HA 1SLTA 2Y6FA 2ERFA 4NWWA 5FPVA 3LZZA 3O1VA 2R041 2VVFA 4UW4A 2HWF2 1RJ8A 1W9YA 2J7MA 3A4UA 5EHDA 1JZ3A 1O4ZA 3RZLA 2P1BA 1NYWA 2QQNA 1W9SA 3G6JB 4W6YA 1PK6A 3M3QA 3W5MA 5A7WA 3H7JA 1NLRA 4PF1A 3WF3A 3BYWA 3ZR6A 4O9GA 3I4IA 4LBMA 1L7RA 4P14A 4X6RB 4XUPA 1YEWA 1W2OA 3I2JA 3GF6A 4AQSA 1CPMA 2WA4A 4MVTA 4GH4C 4CU9A 5CA6A 4O61A 5IK5A 3OBAA 3RS6A 1RHI2 4Z1VA 4AVAA 2ZAAA 4BHPA 2VUAA 2W46A 3TN91 2JG9B 4CCMA 3S6PA 4CXYA 4MGTA 2WNVB 5F6LB 1NCRA 3ON7A 5C8CB 4YGDA 1VBE3 4IGOA 1EAH3 5EWSA 1BBT2 2WQZC 5J96B 1IS3A 1RHI3 2X5IC 2YG0A 2D5FA 3ILNA 5CFDB 5CFCC 4MG2A 5FYIA 4DEVA 4ZY9A 2W94A 1I5ZA 3P6BA 2CY6A 5BUVA 4TN7A 1OQDA 2VZPA 3ACLA 2IXKA 3DYMA 2XG3A 1PO22 1ZREA 4NAMA 4EYUA 2GMPA 2V72A 4YZ2A 5A3UA 4HSLA 2JENA 1V6MA 1WLDA 5G04L 3WQ7A 3PIJA 3WQ0A 1US3A 4P9YA 3WQBA 2AEZA 4GB32 3AYCA 2VAUA 2A6WA 2YDEA 2WFF2 4Y5TA 4J6GA 3T2TA 1SCRA 1UCXA 1JUIA 2DFCA 3RDIA 4W6XA 2QQLA 4KNCA 4A44A 4XDQA 5IFTA 2YMZA 1IHMA 3GZAA 2IVJA 4GH4A 5C4WB 4XFAA 5GLTA 1F9KA 1EAH1 2JE9A 2VZUA 3KVAA 3H7YA 4QGNA 1HQWA 2VZOA 4XHBA 1ENQA 3HMYA 3W58A 3L9JT 2WWUA 2ZA9A 3P1IA 3I3QA 1KJLA 1O7FA 3PVNA 4JGZC 4K1ZA 1W6OA 3NL1A 3LD8A 1IQAA 4ZU4A 3WOGA 1F15A 3ZYBA 2ARAA 5T5PA 3GBGA 4MUVA 3PU8A 1W8WA 4QQOA 1GFF2 2AZ5A 2X5IA 4NR1A 5FYHA 5FZ8A 3WINE 4AHZA 3T0BA 3ABZA 1JMUB 1AYN2 1EV12 5CFCA 4IE0A 2WT0A 1FNZA 4Q4Y2 1Y9QA 1HB1A 3CL1A 1QXRA 3NAPC 1Y7BA 4FOVA 3WLUA 1ASJ2 3C8XA 2XQRA 5T54A 5DDJ2 1W3XA 3CLPA 4OQ8A 5I93A 3KF5A 1YWKA 4KGGA 2Z79A 4Y20B 3WW1A 3ZN6A 1YXWA 2G9FA 2YPJA 2VC9A 3VBOB 2IUWA 3R05A 1KFUL 1OA2A 2ARCA 4YM3A 2UY8A 4LIVA 5DDJ3 4Z07A 5LEKA 1ENSA 1VIWB 3VKNA 2J1AA 4NPLA 4XJAA 3WD5A 1VBA2 1R64A 2D6KA 3D0SA 4CYDA 3NKTA 3AZXA 1BK0A 4K3UA 1VBD3 1CGPA 5FZBA 3EHKA 3C2UA 2VULA 1OF3A 4EWDA 1N3OA 2GMMA 3SH3A 4JHZA 1GOFA 1SDDB 1BK1A 1CAVB 4E8DA 4Q27A 1FPN3 1HIXA 3J7NA 4BK4A 1W9TA 3MFCA 4AVVA 1W0OA 1QJZA 3MO4A 3CO2A 3USUA 1VRH2 2VPVA 1RB8G 2ILMA 2A71A 1LENA 2JIJA 1Q8OA 4IEPA 4GAZA 1QJY2 2A73B 4P9IA 3FUQA 4JGZA 3U11A 3ZXAC 5FQ0A 1RUG2 1JZ4A 2PHLA 5FP3A 3WCSA 1OVSA 1OD5A 3CIHA 3EQEA 2OS2A 3R4SA 4CPBA 4DXTA 5JLVA 2NN8A 1G9DA 4UFHA 2XLGA 4NIIA 1ND3C 2GZWA 4ZS3A 1PX3A 4LO4B 1NG0A 1UYYA 1FATA 4MYEA 5IK7A 5JOZA 4YW6A 1SCSA 1X50A 3BCWA 3NAPA 2BW8A 4CUGA 1BEV2 2A6YA 1LHNA 4MADA 3UJOA 2DVFA 3WG4A 1H9PA 1GANA 2QE3A 3PVOA 4XJZA 4DMIA 4FSJA 3FLRA 3OPZA 3RYPA 3URFA 3VBRC 3FBYA 1AR73 4N7IA 1VBD1 5KHHA 2ZOEB 4QKFA 5GALA 4CP9A 4ISQA 1V6NA 2A5ZA 4E2QA 1CR7A 3AL5A 3I2GA 1QQP1 4YZ1A 5T52A 4M01A 1D2SA 3VKLA 5IK8A 4AQ6A 1FPN1 2JECA 5FZ1A 5K9YA 2W1SA 1S0BA 4CDXB 1LR5A 1C3HA 2HH9A 5J98B 3WVJA 4JDNA 4S2GA 4BA6A 1R1A2 2W2IA 1J3QA 4OHZA 5FDBA 2W1QA 1FX5A 4I02A 3ZXJA 4BISA 3MUZ1 3B00A 5BNNB 3OPTA 3RVHA 1DZRA 3OPWA 2ATFA 3DF0A 4C0HA 3A0KA 1W0PA 1LHVA 1UMHA 4BQ1A 2Y6GA 5FMOL 3MPBA 1QJX2 2E7AA 2IXIA 4NWVA 5L73A 1JW6A 5DAQA 4Y5Z0 3MLLA 3E1F1 3ZX7A 1BCXA 2KR2A 1TME3 2VCAA 4RR3C 1AXKA 1ND3A 4BDVB 3V0BA 5ACA3 1YLLA 1YQ6A 3OB8A 1C8M3 4NIGA 3VKFC 1ZVFA 2O8OA 1DYKA 1QJX3 1QJU2 1BKZA 1S0FA 4KG8A 5FZ9A 2MEV3 1QY4A 1AR71 2W91A 4IV1B 5FYBA 2CGNA 1T6BX 4AZZA 2XVKA 3H50A 3ATGA 3NNJA 5BV6A 1J1TA 3HR9A 4BWOA 1ZM1A 4CDWC 4WM7A 4YW5A 1ST8A 2Y0OA 2VOTA 3FHQA 3VBRA 2W5FA 1QJU3 3I2KA 4RFT0 1UYZA 1ZZ7A 5D8AC 3ZSEA 1YQ2A 4COWA 3D0JA 4MH0E 2Y38A 1YQCA 2PHUA 4FTSA 4QM8A 1H2NA 3ZXDA 4KWJA 1CX1A 4RGAA 2P3YA 3UGHA 3K51A 4CPBD 4PIYA 2Q1ZB 4LE3A 1RIRA 1OPOA 5IUQA 4JCKA 1VE0A 3IM0A 2B46X 1H9WA 3PHMA 4HMZA 3A23A 2BFUL 3VLBB 2P37A 3UGGA 3NSTA 2WSVA 3BVCA 2D93A 1NA1C 4UFJA 1TME1 3LIGA 5FZOA 3O5SA 5EP9A 2Q5TA 1CAXB 4HXCA 4LXLA 4LQRA 5A7WB 1WWYA 4MGKE 5LA0A 5ACA1 2Z2SB 2RJLA 3UGFA 1JN2P 1H0BA 4WVMA 1RJ7A 4ZZ5A 5M0TA 4KBBA 4QQLA 5JIUA 4RR3A 2CAVA 3I59A 5J37A 2FMDA 4XETA 3K4DA 3KV4A 4BMBA 1RVF2 1YFXA 4ES8A 3KQ4B 4ASLA 2YY1A 4DIQA 3RZMA 4NIAA 4YZ4A 2XQXA 5IVEA 1NKGA 4Q4W2 1NCRB 1C5HA 3ZSLA 2XJTA 2ZACA 4N43B 4CDWA 1Y3TA 3KT7A 2D43A 2AYHA 3FFQA 5IJRA 4N8MA 1YIFA 4A4AA 3ACHA 2DCZA 3WXPA 3GHMA 5D8AA 4FP3A 1CJPA 1I6XA 4RD7A 1YQ8A 4Y1VA 4XAEA 1K42A 5LCWL 1DQ1A 3U4SA 4EN8B 1IOAA 1LHUA 1WCSA 2A1XA 2DTYA 3AJZA 3MEPA 4LLOA 4I30A 4XMAA 4ZXEA 4H55A 4B29A 5FZ7A 3FWEA 3AKTA 2CNAA 1AL22 3BTZA 5A7NA 2QVSB 1UOJA 3WF0A 1PIV3 2VZVA 3F2ZA 4W8JA 5FLIA 3I3BA 1Q43A 1WCKA 4AXOA 1NA1A 2F4LA 3TEXA 5CBLA 1M4WA 2MPFA 2VMIA 1XB9A 1RUJ1 3WNLA 2QJVA 4EROA 3OGSA 2BGPA 2B7YA 1DU3D 4HKWA 2CGPA 5FZKA 1L7LA 2D97A 3J7LA 3POJA 4QKBA 3T1MA 2RG4A 1OF4A 2ZX1A 2XBO2 2VUDA 2HWB3 3MGUA 1JYNA 4COUA 2X05A 1AR61 3MZHA 1TMF3 1KQRA 1FMD2 2YB7A 4DO0A 3UETA 2MNGA 4XOGA 5JXJA 2JB8A 1F31A 1UYPA 5FO8B 1NOVA 3APBA 3O12A 4BE3A 1QOTA 5BNPC 1NXD1 5A3WA 4OMCA 3AYEA 4XABA 3UYJA 4AHWA 2NYYA 4BZ4A 2YU1A 4ZU5A 1PGSA 4KU7A 3ZLIA 1S0CA 5EYYA 5GLZA 3FJSA 2ZPXA 1PIV1 5JXIA 1IZ3A 2EIDA 3DUIA 4XCBA 2HEYF 1ULGA 2PAEA 5EXOA 5E88A 4YLZA 3VD5A 1UPIA 4GJYA 3LWCA 5FZAA 3O1RA 2VE1A 2A6ZA 3VDAA 2RHPA 5FY8A 4AQTA 2V5YA 3LA7A 5J3UA 5F9TA 1J58A 1AR92 1KEXA 3SISA 4BXFA 1SPPB 2NLRA 5JR7B 4COZA 4HFSA 4YYOA 2VMHA 3AKQA 4KI5M 4L92A 1BMV2 2HWB1 1QXPA 4A3ZA 3I2HA 2BV4A 1TMF1 1COV3 1UU4A 5FZFA 3ZIWA 2Q30A 4CCJA 1UNBA 5C70A 2YFUA 2WZ8A 3WDUA 1H8VA 1UU5A 4Q0UA 2AGSA 3OUHA 3BPZA 4FFFA 1A8DA 1RUI1 3MICA 4XFBA 4NROA 5CAZA 3DV8A 2YBPA 4AOCA 3OCPA 3KCYA 1WLWA 5CZKA 3ROUA 4QXHA 3DPRA 5FZDA 3H8OA 2WS92 3WSOA 1QDCA 3VBFC 4JVAA 3CNAA 3THDA 2R0FA 5F3IA 2D5HA 1GZWA 3AP6A 3M1HA 4FVVA 1D4VB 5C3RA 3KHCA 4Z82A 2BVBA 3IN9A 1J3RA 5BNPA 3EO6A 1RUC2 4LBNA 3JCIA 4CU8A 5HPOA 4L99A 2WNUB 3RYRA 2WS93 1JYCA 3POEA 4QKDA 2XHNA 3ZMNA 3TEWA 2R16A 4CEYC 5GZCA 4YVSC 1URXA 4A2UA 4LK7A 4DY3A 3O0WA 2RS13 2VZRA 5FXWA 1S0IA 1O5LA 1G6NA 4IL7A 1LODA 3IZOA 1MS8A 4Q8LA 2JE8A 2QZ3A 4Y26A 3PTRB 2VL4A 4CDUC 5LBBA 4GD4A 1JH5A 1I1EA 4EN7B 3DKQA 5K0UC 2QQVA 4XJ9A 1COV1 3HQUA 3PMEA 3FC0A 5A3LA 1BXHA 4RSUA 4JZRA 4DOUA 4QDSA 2VO5A 1UZVA 1S2EA 4QDQA 5FREA 4LR4A 4XTMA 3HN3A 2DU1A 3KGLA 4XTPA 5HCAA 1MVEA 4BLIA 1AYM2 2V5DA 4KQ7A 2WZR3 3LPFA 4FT8A 4NHKA 1DQ2A 3WUCA 2Y0IA 1O4TA 1R092 2I74A 1QHDA 3H0OA 4H7LA 4UFIA 4WM8C 5LBCA 1HQLA 3BN6A 3VL8A 4YZ5A 5CVRA 4YNIA 4BLJA 5ISLA 5FYUA 1K45A 3G7DA 4XIOA 3VBFA 1XXNA 1GP5A 4AFAA 3SH5A 3GALA 4AHYA 4BQ5A 1RUD2 2CGOA 3ETPA 3V65A 2RS11 4IE5A 3A22A 3V0BB 1S0EA 3AVRA 3FL7A 1Q56A 2JWPA 2VUCA 2LRPA 3EMRA 1PMIA 3VD9A 3E6BA 5JXGA 2ZGSA 3AZYA 4YVSA 4CEYA 4KU8A 1OOPC 4R52A 1XJAA 1EP0A 1UXZA 3B94A 3THTA 1SHWB 3AYAA 4MXWA 3CF6E 3ZXKA 3H42B 4HK8A 4TSVA 2ZABA 1OLRA 3VBRB 3RI8A 4CDUA 1N47A 1JHNA 4UWDA 2P34A 3RG0A 1CX4A 4L97A 4LORA 2XKPA 4P08A 3KSCA 4Z2WA 1JU3A 5K0UA 1H8TB 3GZUC 4PI0A 2PLV3 5FMCA 3J4UH 3T2PA 5LK7B 1N1SA 3SXWA 4YPJA 2WZR1 3JBG3 5HCBA 3WDTA 4F83A 2HBTA 1QOSA 1QNYA 4OUSA 5TSWA 2DV9A 3AXDA 1ZA4A 3MDPA 5F7UA 1RMU1 3IDEA 5HCHA 5EFUA 3N4MA 1E5IA 2CL2A 3D4KA 5BXXA 2ADDA 1S0DA 3C7GA 2RMU3 1H1MA 2VOXA 3D82A 4WM8A 2OPWA 5I0TA 3ALQA 1HRV2 5A1LA 1XQNA 5IVCA 1SBEA 3TEZA 5FYVA 1EY2A 3BPSA 3BTAA 4IEXA 4AFBA 4WVMB 3PVBB 3ME2A 3DEMA 4URTA 1ZBA2 4JTOA 4RL7A 1QOOA 4Q1PA 4X8PA 1Q5OA 2Q8OA 3S57A 5FPUA 1U5YA 3OY8B 1LTEA 2ENRA 3ILRA 1YFUA 2DWRA 4MV2A 1UOFA 1MQTC 3B9IA 3LSDA 3FUOA 5E16A 1V70A 1WW5A 4NHLA 4XVHA 4AEDC 2PLV1 4GMP3 5A33B 5KHJA 4D7YA 2DTWA 4JTNA 2VR4A 5C9AB 5IW0A 3SLIA 2WT1A 5F39A 1PO11 1RINA 1S4CA 4GWJA 4UW5A 1KRIA 3AYDA 2SLIA 4XQ4A 1YHFA 4HK9A 1W04A 4KL1A 5HV0A 2JJ6A 4P9JA 2WBKA 4QB1A 5KC5A 3OBTA 1GYKA 1HXS1 1L7QA 4TWTA 5C5UA 2RMU1 1VB2A 3DYOA 5EPAA 4Q4X1 4YG3A 4MSVA 4PBPA 1VAVA 2E32A 3GGLA 4AG4A 2Q0AA 5H9QA 1NA1B 2PHDA 3AFGA 2O14A 4CCEA 4XDOA 1UO9A 5I0RA 3W59A 1AX0A 1WZXA 4FPOB 3NV1A 5L9RA 1YC61 2ZMNA 4YVWC 2VNOA 2AENA 4Q0SA 1MZ5A 2P6CA 4LO8A 2EXKA 1DGRA 3P3NA 5H9PA 3J8F1 2QUOA 4FQ4A 4GMP0 4EQVA 4YARA 3UJQA 1W90A 2VBBA 2RM22 2DBIA 1LOBA 3T4VA 3VD4A 1UU6A 2G9GA 4GMP1 3I2OA 5F32A 3VZOA 2D98A 1W2NA 1HW5A 1W6QB 2P17A 4XFFA 3RWNA 4ATEA 1MQTA 1REEA 3MIEA 2WABA 2IVIB 4R4ZA 4NJ4A 1VBB3 2RM23 4AEDA 3U37A 5B2GB 4V2WA 1DGRN 3KVBA 3IKWA 1PGW2 4UW6A 4R8HA 5I8SA 5E1RA 3VHOA 5KHIA 2HEVF 3WF2A 3VBUC 1DQ6A 2J1VA 3WQ1A 1XRUA 1QH7A 2C9AA 2WQ4A 3FHAA 2BTVC 3PURA 1XYPA 4P02B 5FYZA 2KXLA 4CCOA 4EN9B 1UX7A 4N53C 5FOBB 3MF6A 2C9KA 3A21A 3WW2A 2OPKA 2P4EA 1GSLA 3MLKA 3POBA 5F8PA 5H9RA 1NLQA 3O1TA 4N7UA 1IQDC 2IFWA 4NN0A 2VZ1A 3GHNA 1LAJA 2XMLA 3VDDC 1O91A 2VBDA 3R4UA 1IPKA 4CXWA 4RYDA 4HPKB 5DABA 3IBMA 4AYUA 1PNFA 2GC2A 2C0ZA 4MHRA 5FYSA 5FRAA 4ZHNA 1OQEA 2D6LX 4P00B 5K8SA 4LBQB 2B42B 4FFGA 2YGLA 5IAXA 1ZZ6A 2XONA 3K75B 1O3TA 2ZEZA 3HPNA 4BXSV 5CB7A 4QPWA 4DUVA 4YVWA 2HWD2 5AFBA 1ZBE3 1V6LA 1SBDA 5FY5A 3LOBA 2Q1FA 3NW4A 2FCTA 3UL2A 3W9AA 5IYYA 2JE7A 3BU0A 1HRI3 2NQYA 1JU4A 2QZ2A 3HD8B 4L0PA 1VBB1 5LA2A 1PHMA 4QU1A 3WP6A 1BZWA 5FUIA 1OH3A 2QCSB 2ZGTA 1U0AA 2WN3A 3FBMA 3K2OA 4QPIC 4M3CB 1JTZX 1O4YA 4PLNA 1GZWB 1WW4A 1VRBA 2ZHLA 1AL0G 1I9RA 4AGRA 4A7YA 3H8XA 5GLVA 4HSJA 2HWF3 3AMPA 3K4AA 3WUDA 3K77A 2A7AA 3VBUA 2BZDA 1OHFA 2W39A 3D8CA 4URAA 5AC91 2LUWA 4K21A 3RGBA 1UZ0A 4AEMA 1IKQA 3LE0A 3QH7A 2A3WA 4N53A 3SMHA 1RL3A 4EWAA 4I0AA 1DQ5A 5BNOC 5C3PA 4UW3A 2UYBA 5DAPA 1XSQA 2Q8EA 3VDDA 5JSPA 1WMEA 1H6YA 3IPVA 5F1RA 4XILA 3JB8A 1ZBE1 2GSYA 1AUYA 1PGL2 2DUQA 3I8TA 3LKJA 2BEOA 3SKVA 3TYJA 5L7OC 4D7TA 4CU7A 4F8AA 3GDBA 1LKNA 4PDWB 1QGLA 5FZGA 4DQAA 1O6UA 4XHXA 4BQWA 4AAPA 4CRQA 2WWJA 1ZRIA 4X6QB 1BBT3 5A3TA 1G86A 2PHWA 3F95A 4A3XA 4F7ZA 5F3CA 4EWEA 3J7HA 4UBHA 1LEDA 4XXAA 1TNFA 4Q0QA 4QX8A 3FZ3A 1NZIA 2X29A 1H6XA 1GU3A 3RSJA 1OA3A 1OSGA 4P9GA 3IIIA 1W6PA 4JKKA 2X8KA 3PUAA 4XC9A 2VM9A 2WFPA 3TB0A 3ITQA 4A6SA 5JXHA 1PVC2 4DFSA 4D6SA 1PO23 5IK4A 2FDJA 1Z7S2 4QPIA 2YC0A 3ENRA 3VBFB 4UI9L 1CQ9A 3WF4A 2JDUA 4NAOA 1CAUB 1HLCA 2WO7A 2XVLA 4JRLA 4OLLA 4DRVA 2LW8A 1DG6A 3KMHA 4GB33 3WNKA 2J1EA 1JZ8A 1W99A 2WFF3 1QF3A 2GC0A 5I0UA 4R4XA 1D2QA 4XUNA 3AJYA 1VBE1 3CJXA 4NMIA 4NPMA 3MPPG 4YVSB 3EXUA 1RHI1 1YFWA 1S0JA 2XJSA 1GKBA 4P9LA 2RS52 1WUVA 2WLPA 3LDRA 4QAWA 2XB6C 3ZSKA 3ZO0B 1N3PA 2UWBA 3JZVA 2WC2A 5LA9A 3ZXLA 5BNOA 2W1UA 5CISA 1UW8A 1VALA 4FTBA 4GQ7A 2D3PA 1GQGA 2HYKA 2IXJA 2RS32 4HETA 5LY1A 4XURA 4Y22B 1BBT1 1KJRA 4OUMA 2J1RA 5C6CA 2UYAA 3PUHA 5FZHA 2RJKA 1DGWX 4AAXA 2D6NA 4QHZA 5L7OA 3GJAA 3LSEA 4R9DA 1RC6A 1NCQC 4NVPA 3WDYA 4CXXA 1REFA 1XU1A 3Q8FA 3AP7A 1MS0A 1XPWA 5I0SA 5JPNB 5L9VA 2FBEA 1AYN3 1EV13 1PO21 1LB2A 3AP9A 5EIYB 1RUNA 2XGXA 4Q4Y3 1NT0A 3OEAA 4YW3A 3WP4A 1VBC2 5IVYA 4XJUA 3WDXA 1FV2A 5FKCA 3U1XA 3LFMA 2C26A 1K3IA 1ASJ3 2ZGUA 1YI7A 2R32A 3LOIA 2VG9A 4XBQA 4CP0A 1KFXL 3H1YA 4GB31 3H3LA 2B9VA 4UFLA 2OUJA 4LO5B 2WFF1 3ACFA 1W3VA 3ES4A 3CZUA 1DIWA 4HG6B 4OVEA 3VBHC 4I01A 1W6NA 2P3JA 3V0AA 3ZXEA 5KXCA 5LRSA 4DY5A 4XQDA 4LOSA 2W87A 2PA7A 1MS4A 2AUYA 2G19A 1CAWB 1S2KA 3Q8BA 2FZ1A 2P6HA 1UIJA 1QXJA 2Z4FA 5C3OA 1VBA3 3PNAA 4YZ3A 4RQPB 1V9U2 1JYVA 1NZCA 3NNGA 5LWBA 1OOPB 4FXKB 4WZFA 4XACA 4M4RA 1GV9A 3WP5A 2Y33A 1UMZA 5I8YA 4C8DA 1F8VA 1Q8VA 1QQP2 4P9XA 5FY4A 3HT1A 3WT3A 5FCCA 1MZFA 4HN1A 2VUJA 2BBVA 3VKMA 2D6PA 4QX7A 1VRH3 3JD72 4JAAA 3ZPYA 1KDMA 2JIGA 3UV9A 2WLQA 1QJY3 3VZJA 1AYN1 1EV11 1NCQA 4BU2A 1POQA 1RUG3 4Q4Y1 3K46A 3SCGA 4OI4A 2QQWA 5A3NA 4IGPA 1ASJ1 1REDA 4FAGA 4Z92B 5DDJ1 5HCFA 3JXSA 4WM7C 4CUBA 5F37A 4AR2A 1U5XA 4XUQA 5HV4A 2CYFA 4E4HA 3ZXGA 4AI8A 2W92A 4NRMA 4KWLA 1BEV3 2NP0A 2G1MA 2GNBA 3ES1A 1VMHA 1JOBA 2F6BA 1H1AA 1WCUA 2GNTA 3DGTA 4Y1UA 3R6SA 1VBA1 4QX3A 3VBHA 1W03A 2GAUA 3H8UA 3VBSC 2HWE2 1OD3A 5EYXA 3PLQA 1GOGA 4NHMA 4LPLA 4RS5C 5J48A 3POIA 4IEQA 2QNKA 3NJXA 1YYNA 1IS6A 3T0AA 5FBZA 1MQTB 4UBGA 4OQ9A 1VRH1 4Y24A 1R1A3 3BU7A 1KD7A 4KG0A 4YGBA 2VNRA 1NQDA 5LBFA 4COVA 2DBNA 5KR7A 1RUG1 2DUPA 1MR5A 4LUKA 3AXEA 4AI3A 1UY0A 2NMOA 3I2DA 3DYPA 1XNTA 3N9LA 1LU1A 2IWGB 4AI0A 2D7FA 3NRUA 5J7MA 2OKXA 1XU2A 2JDYA 2XJPA 2R49A 3E6DA 3N3HA 1C57A 4LOTA 4R9BA 2JKBA 3MYXA 5CG8A 3LA2A 4B7EA 5FMOS 3FFZA 1BEV1 2WYFA 1DBNA 1FOD2 4ORFA 4KMQA 4QXCA 3TEYA 4B1MA 1U12A 1WKYA 3AKPA 4OYUA 1DDLA 3VGIA 5JMCA 1NQJA 1CJDA 3SCFA 4YWAA 1N1VA 1LECA 4GWIA 5B4NA 4JKLA 4LIUA 3CJIC 1G8WA 2ARXA 4FI9A 1N1TA 4I09A 5A6YA 4PHZA 5A6XA 4G9SB 2VECA 2UU8A 3WNNA 3K48A 1FOD3 4DXRA 1MACA 1ULCA 4XYXA 1XNDA 4AVTA 2G4IA 2VOKA 1YO8A 3R0RA 4CUAA 3O1SA 4BQ2A 3T09A 4GALA 3RMXA 1K5MC 3AZWA 3VZLA 2R1DA 2YC2A 4XFIA 3VBSA 3DL3A 5JZGA 4QM9A 1W39A 2R072 4Y33A 1QWRA 1SFNA 2CDPA 2LROA 2ZGRA 4RS5A 5DAVA 5DG2A 4CP2A 4H3WA 5JUVA 2DFBA 5I91A 1SACA 2E63A 2HKXA 2WJSA 3H1WA 3NKGA 3KD4A 4Q1RA 3ZYHA 3VDBA 4ZPIA 4Q4V2 2RR12 3O0XA 3ZDSA 5FYYA 4YSFA 2E53A 4WVWA 1PK6B 5FWJA 3HAGA 3IMMA 4NO4A 4XJWA 4LBKA 1JYIA 1C8M1 4P5HA 3AL6A 1W8NA 2W08A 1QJX1 1SEFA 4IEYA 2DU0A 2MEV1 1UL9A 1K5JA 3LFIA 4CCDA 2D3RA 3BTXA 3NJZA 1UY2A 1SLLA 1OVPA 1WW7A 4CVUA 5FZ3A 4PJYA 4BB3A 3AC0A 5CG9A 5AFEA 3KZ4C 3ZFEC 5EZWA 5KXDA 3N7KA 1QJU1 1H30A 2IZWA 2ZGKA 2D3SA 2XUEA 1Z0HA 4LBJA 3PUQA 1UX6A 2QQMA 3VDDB 3ZYGA 1HJFA 1PZ7A 1UY3A 4ONUA 1RVF3 2OA2A 1DYOA 1V0AA 5F2WA 5CADA 1MS3A 1GNHA 5FYMA 4Z2AA 4Q4W3 5JCTA 3ZYPA 3CJIA 2XVGA 2VTFA 5GKAC 1MEC2 2QDNA 2YXSA 1HV0A 3AKRA 3FLTA 1NY72 3POFA 5EV7A 5FP9A 4LULA 4QHOA 1RXFA 2VBPA 5AVPA 5JIAA 3SITA 2PHTA 5CU1A 2Y6LA 1XNCA 1K5MA 3BODA 4P9WA 1E57A 3WG3A 2WDBA 2C4XA 1DQ0A 4CU6A 3BIEA 4HZFA 1MEC3 5DXDA 3MIHA 3SC7X 5KHKA 2HJIA 2ET7A 1F4HA 3MF9A 4XFHA 4NHXA 3UT0A 5KBFA 2DF7A 3HNBM 1UIKA 1LOFC 2VQTA 2VXRA 4IEOA 4IV3C 5C7GA 1AL23 2DVDA 3IAPA 2D6OX 4S2DA 3A7QA 4CTEA 1YJLA 1JHJA 1N3QA 2XXZA 2WWSA 3OTFA 1IKPA 1X9PA 4BK5A 4GH4B 2VZSA 3K3NA 4DRRA 1X33A 1JZ6A 1PMHX 2VOVA 4XBNA 4QKNA 3ZFEA 1RVF1 2YU2A 2VMEA 4N90A 3T1LA 1SMVA 4ET7A 5LB6A 2ES3A 3DPRC 2G9ZA 1E5SA 3I49A 2ZTNA 4YFWA 5FUPA 1W6OB 4Q4W1 5DUVA 3TAYA 4LHLA 5AVAA 3ZN4A 2VMDA 2P5BA 2XBO3 5LASA 2VZ3A 1W6MA 3AB0A 2TEPA 4MX3A 2X5IB 3IDBB 2D6MA 2PHFA 2BERA 5CFCB 5HXMA 1FMD3 3AMHA 3NNMA 4A45A 3Q9OA 4NIDA 1LOEA 1S2BA 1JOPA 3IB3A 1S1AA 4RGGA 3NO8A 5EJZB 3B7MA 4XQWA 3WV6A 1PM7A 3I3MA 3EB7A 2NM1A 2UY9A 2XL7A 2KA3A 3RPQA 3RJ2X 1LHWA 3SEPA 3SNMA 3ORJA 1AL21 3ZN6B 2OX0A 2BQPA 1GNZA 2BRTA 2YROA 1O5UA 3EBRA 2PN5A 4PIZA 3OOXA 4Q0VA 2ORXA 3POSA 3T2QA 1OKQA 4S2FA 3VHRA 1LOFA 2WAAA 2FDHA 1C1LA 3WR0A 4IV3A 2CSGA 2W52A 3LA3A 1WCDJ 5BY5A 4OI1A 4D69A 5GZFA 5FJHA 3SHRA 3QH6A 1AR93 4B1LA 1ZZ8A 2LALA 1D4M2 2PQSA 4AL9A 4Q29A 5C8CC 3USUB 1G9CA 3AFKA 4OCTA 3IT8A 5BYNA 1RUE2 2B8MA 4W4ZA 3OGRA 1AF9A 4JGZB 3HQRA 5FQ0B 3ZPOA 4Z8BA 1FMD1 4PLOA 4WVVA 3T08A 2ZKLA 3LDBA 4OZOA 5FP4A 4TXWA 5I0DA 3SCHA 5HI0A 2VMCA 1QJFA 2HEWF 1ULDA 1CZTA 1A78A 2VTXA 4NE9A 4IEWA 3UKVA 1DGLA 2UWAA 1DP0A 3NQHA 1HB4A 1LGBA 2AACA 2CAUA 3JUUA 4YW2A 3ZYFA 4B8EA 2YFZA 3NAPB 5F3GA 3N7LA 4N9HA 4BPZA 1ZRDA 1OQ1A 3VKOA 3CHXA 1E5RA 3TOJA 4ZZ8A 3IMNA 1SLBA 2QKDA 2CWSA 3NJVA 1RUC3 2D40A 4OFGA 3WF1A 5ABJC 3M4FA 2GC3A 4RHV2 3E5XA 3MFAA 4G4FA 4TLFA 1J59A 3BGAA 1R1ZA 5GM0A 4AE2A 4OUEA 1FYUA 1WA6X 4CP9B 1QKQA 2WO1A 4O7XA 2YYOA 2X10A 3KQRA 1AR91 2ZHMA 1TVGA 3HBKA 2GN3A 1S55A 2PFWA 5C4WC 1GLHA 3VZKA 3ZFGC 4JHTA 2WT2A 2XPJA 1JZ7A 1IS4A 4BIFA 1G9AA 1BMV1 2E7TA 1C1FA 4L11A 2ORZA 5LEJA 2WSUA 2HLEA 3CMGA 2R062 5C8CA 5FY0A 3ZYIB 2J22A 3ZXFA 5J1XA 3M3IA 1H4GA 3NWKA 4IDZA 3N9MA 5DN2A 3VL9A 4EE2A 5A7PA 3PUSA 4C90A 3USSA 1AYM3 2WS91 5KXBA 5DZGA 3ACIA 2BPA2 2XOMA 3LEMA 1CVNA 3LF7A 3S7EA 1R093 1NLSA 3MV01 4QQPA 4Q8KA 3GXUA 4Y1XA 1ND3B 1UZZA 5GZDA 1RUC1 4JV4A 4UT5A 4D7SA 1FV3A 1RMU2 4FPFA 2VQUA 4LKDA 2GN7A 2XJQA 4XZPA 1OPMA 1GWLA 4RA0A 4AK3A 1J83A 1XNKA 5T5LA 1RUD3 2ZCWA 4A41A 4NIHA 3KV6A 1CZSA 1NE6A 3VBOC 1DLLA 2I45A 5ABJA 4WM7B 2FDIA 3I3EA 4PI2A 2OXBA 1U5IA 5E6HA 5C8WA 5IVBA 4XFGA 5JSOA 5EJ3A 4FPGA 1OH4A 2YBSA 4LKSA 5GLWA 3RYKA 1O3QA 4FAHA 3DCQA 5JI9A 1RGSA 2QDRA 3KV5A 5CKMA 4COYA 2ID4A 1FXZA 5C3QA 1EYBA 1EUUA 2FDGA 1W2TA 4ZONA 4IXLA 3FX3A 4PLMA 5C4WA 1LGNA 2GALA 3C3VA 3HQXA 3ZFGA 3MW4A 4O9EA 1DF0A 2JDHA 4XFCA 5FY9A 5HXVA 5JSRA 2C6SA 1V6JA 4CZSA 4RS5B 1DCSA 1VP6A 4V1PA 5FPAA 2BP6A 1CESA 1AYM1 4Q2FA 1FI2A 1RUH2 1Y9MA 3HEIA 1LNSA 3ZYRA 1STMA 1YFYA 5FXVA 1R091 5FZOB 2FZ2A 2OT7A 2RDQA 4IE6A 4LK6A 5GZGA 3D3AA 4BIOA 1F35A 1LGCA 2OZJA 2BDRA 4XUOA 4MGYE 1WGPA 3ASIA 1XYOA 1HXS2 1RUD1 5FZ4A 1JZ5A 4RR3B 3I59B 2WN2A 4I2OA 1HRV3 2VTXJ 4XF4A 1R082 4Q4X2 4S2HA 4XPVA 2Y26A 3PJYA 1H2LA 2Z5WA 3KHBA 3VD3A 1LCLA 1AR82 4RFRB 1ZBA3 1QMJA 1QIQA 1F5FA 2J1TA 2XWBB 1ULOA 3A0NA 5CNAA 3GCWA 3VBOA 1ZA7A 4CDWB 4LMFA 3MV11 1LRHA 1R083 1ND2C 4B4PA 1C8NA 1EUTA 5D8AB 3JBG1 4CDXC 4IE7A 1O3SA 2ZBJA 2B9UA 2YC4A 4E2SA 4O65A 3C7FA 3J9SA 3T30A 1KS5A 3OBZA 3QD6A 4C1XA 1AZDA 1XE7A 5A80A 2FD8A 3I2IA 3OUIA 3VD7A 1CAVA 1SFPA 4HANA 4IQPA 3WW4A 3TNQA 3ZYJB 4CEWC 4TTGA 2ZEWA 1SFYA 2ZAHA 5BNNC 1RUF2 1RYYA 3HWJA 3ZMOA 1F5JA 1K5MB 5BPXA 2EF6A 3OGVA 3B01A 4XIKA 1SDWA 4HKOA 2EIEA 1XBFA 4BM8A 4DS0A 2VU9A 4NRPA 2I07B 2QQKA 2QTWB 2W68A 5FLJA 4OMDA 5FZCA 5LY2A 3S5QA 1DLCA 1TG7A 3L2HA 3OYWA 4OHWA 1SLAA 4MZUA 2O8QA 1HRV1 5SV5A 4LT5A 1MPXA 2VZQA 1AXYA 2TNFA 3D5OA 4Y4RA 4LKEA 1OURA 1ZBA1 2BGCA 3DECA 2HWC2 1QH6A 4FPYA 1JUHA 4ZS2A 3TBDA 3O0VA 3GZTB 5FYCA 3BTYA 2PMWB 1WMXA 1ZRCA 2LS6A 1D7PM 2P2KA 3WW3A 4FPHA 3ZKUA 4XBLA 4XF3A 4FOWA 1V6KA 2JB4A 5JPMB 1CPNA 4FPKA 4OI2A 2JX9A 1CN1A 3S30A 5JWPA 1GWMA 1ND2A 2H0VA 4DZGA 2E33A 3N9PA 2A6XA 3N36A 4Q26A 4CDXA 4MO3M 4JKMA 1LESA 5KC6A 2WR9A 5FAXA 1O3RA 3POYA 1G9BA 5J36A 3GNEA 4ZXKA 2VJXA 5C5TA 3GCXA 3LEKA 2R042 5G05L 4CEWA 2WRAA 5BNNA 4EN6B 2J42A 1VMJA 1C5IA 3AZZA 5FLHA 2RV9A 4AVCA 3MI8A 5L19A 3W20A 5L36A 3LPGA 4XW3A 4DUXA 2VVDA 1W9WA 2W0XA 3WDVA 2PQQA 2CDOA 2RJ2A 5GZEA 3UESA 5DUUA 3DXTA 2BNOA 4RGKA 4QPYA 5FTTC 4AGVA 3P3PA 4DPNA 2VQ0A 1YQ5A 4GIQA 3ILFA 3P5BA 3TN92 1UMIA 2BNMA 4K20A 4IV1A 5F2SA 1UD1A 4N43C 2IFRA 2GP3A 2RM21 4PQ9A 2EXHA 4IERA 4K1YA 2HWD3 4I3GA 5IVFA 4QWNA 1V6IA 1XNAA 2F4PA 3DPRB 4ARYA 4A7KA 4HN0A 2ZXQA 3O1OA 5I8TA 2A6VA 3PU3A 1CONA 3BI3A 4QXKA 4SLIA 3MIGA 4HT1T 4HVQA 5BNPB 1HB3A 1WLTA 1PGW1 4JX0A 2OUHA 2ZGMA 3VDCA 5CIRA 3FHIB 1CD3G 4B3NA 1W8HA 2EVXA 2WYSA 1D0HA 1I3HA 3RMYA 2Q4SA 5KHGA 1GP4A 2E7QA 2FDKA 3LB9A 4JDOA 5D21A 5B4XA 2ETEA 3KT4A 5JAXA 2P3IA 3N7JA 5DQ0A 1QU0A 1X7NA 1JS9A 1YIPA 3HOBA 2A75A 5JOXA 1CAXA 1W2UA 3GZEA 4DUWA 3BB6A 1UF2C 1O8PA 3MUY1 1T6GC 2OVUA 1SLIA 3K3OA 1ULPA 2JDKA 4SBVA 1PM4A 1XE0A 4W6WA 1VBE2 1HRI1 1VB4A 5FPBA 1EAH2 2Q8CA 5IHRA 2WIIB 3B93A 5EJ1B 3GYDA 2JXAA 2HWD1 5DAWA 1H1IA 3J26N 4DB5A 4OULA 3KB5A 2JDPA 1EPZA 1W2AX 4AEKA 3NJYA 1A3KA 3RNSA 4N43A 4JC1A 4CE8A 4X8NA 4WVZA 2AC1A 4N9IA 3RJRA 4AVBA 2HWF1 5LZ6A 4L2NA 5A70A 3C7HA 4QQHA 4CSWA 2GH2A 1Y4WA 1D0GA 1OFNA 2WO3A 4BCUA 5DZFA 4YM1A 5JVVA 3BKZA 4HBNA 1PVC3 1JODA 5CYYA 4KWKA 4HVOA 3B02A 1Z7S3 2YHJA 3NV4A 4CEYB 2Y60A 3OGGA 1W8OA 5FJKA 3WHTA 2ZGOA 3HBZA 1OA4A 1XE8A 2XJVA 4FQZA 4MGZE 1GZTA 5ABJB 4MXWB 1X9TA 4H7MA 2YUEA 4CDUB 4K9SA 1V6OA 2BJSA 3EYPA 4XF9A 5DUWA 2DCKA 3ZKYA 3CEWA 4PQQA 2ET1A 4AFDA 5K0UB 2JKXA 2RS53 1MVQA 1OBNA 2XUMA 3RWKX 4YW4A 1PGL1 4BYYA 1HKDA 5IWFA 2ZMKA 4K8FA 3ST7A 2AREA 2R0HA 4OZXA 3RFRA 4PBOA 3ZFFC 3ZFGB 2RS33 4LE4A 2BU9A 3WZ1A 1JZ2A 2O0OA 2H0BA 5FWEA 2ARBA 1C28A 4F3JA 1OXCA 2BUKA 3CKHA 5FZ0A 4CP1A 1UXXX 3O1UA 4C0BA 5A7SA 4FOQA 4AQ2A 4YM2A 5K4LA 1HN0A 1QJEA 1US2A 1UZYA 2FCUA 4WM8B 3WY6A 2DCTA 2WNOA 4AWDA 4ASKA 2H6BA 2ZZQA 4GWNA 4XUTA 5C71A 2GP5A 1PVC1 1Q8PA 4E4DX 2VD7A 1WD3A 1Z7S1 2FHRA 2WNUC 3I2FA 3S7IA 3ZM8A 1VBC3 4IUGA 1PZ8A 2WZEA 4UOJA 5FY7A 2DCYA 4QB2A 1ENRA 5FZMA 1BLZA 4L8QA 3I3DA 2H6CA 2OW4A 4LO6B 5IATA 3AKSA 1DZTA 3HVDA 1KITA 1SQ4A 2NPIA 1W05A 5ANQA 2PXJA 3KF3A 4A42A 4NHYA 5T50A 4AEJA 5FP7A 1VBD2 4XMIA 3X29B 1W0NA 4FOYA 1DQ4A 1SLCA 3HN1A 1JBCA 3OD4A 5F5QA 2RS51 2RDNA 5C33A 1ODNA 5A3MA 1BVVA 3OSDA 1SPPA 1FPN2 3FE5A 3T2OA 4D6QA 4DNYA 1OKOA 4I0BA 5D2AA 3WG2A 3WP3A 3KS7A 1V9U3 1IS5A 2VH9A 4BQXA 2ZZJA 2VMFA 2RS31 3S5AA 1C4RA 2PYTA 2QQJA 5APAA 1LEMA 2EXJA 3AM2A 4UF0A 1QQP3 1CIWA 2QQOA 4XCAA 1UKGA 3S0MA 4Y4YA 2ZX0A 1ZRFA 3LAGA 4EN0A 3SH4A 3BOPA 3CBNA 2LM3A 2ZMLA 4J1XA 5DAXA 3ZFFA 4WZCA 3AP4A 2DVBA 2WINB 3JD73 3TRSB 4OHVA 4DXZA 3THPA 1UQXA 4LKFA 4AI9A 5FZLA 3FMGA 5K7PA 1PNGA 2EIGA 2ZGNA 1A8MA 5FZEA 1QNWA 1VBC1 2JICA 3AX4A 2JG8C 2A70A 3OYWB 4P5YA 3ECQA 1UN1A 3LEIA 1PZ9A 2D44A 1JXNA 1AX1A 4Y5SA 5F5IA 2XWJB 4DXSA 3I7DA 2WNUA 1N1YA 4EZHA 2I2SA 1YUDA 4NOTA 5T55A 4JQRA 2EXIA 1AR72 3ZIXA 2GDFA 3ZVXA 1Q8QA 5A32A 2XL9A 5JZGC 3VV1A 4E27A 3PL0A 4K8RB 2BWAA 2AH2A 4FPCA 2R6QA 5GLUA 2NMNA 5FO9B 5FXZA 5KXEA 5FFOC 4ITCA 1LULA 1HX6A 5EQUA 5FPZA 4W65A 5LBEA 3PMSA 4GXLA 1V9U1 1OUSA 4UYBA 3LGRA 2W95A 4AI2A 1ENXA 3J7MA 1H2KA 2HWE3 3H8RA 1TNRA 1YRZA 4META 1H8TC 1GP6A 4FPEA 4K40A 4AEDB 1QJY1 2XJUA 4HOOA 4LNVA 1ND2B 3VHNA 3ZR5A 4QMAA 5FXXA 1UZWA 1GWKA 3CDZB 5F5AA 3SEEA 3JD71 3UNPA 3INAA 1VAKA 1JYTA 2ZJCA 1W28A 5KWRA 3AMQA 2Q8DA 4IEVA 4CEWB 1OFSA 1JYXA 1UWWA 3VB9A 2LTNA 2UWCA 2V73A 4TLGA 1TME2 4QX0A 3PUIA 3KGZA 1B35C 3PDQA 4B4QA 4AFCA 4DINB 5ACA2 1IPSA 1Y9GA 4LO7A 1C8M2 5JI7A 4AI1A 2ZEXA 4NRQA 1WBFA 3DKWA 1VLNA 2MEV2 3TWIA 3SQOA 4A7ZA 2JG8A 4BJ0A 1WCQA 1JYWA 2WZPP 1AXZA 4YVWB 4ZKTB 5JDBA 3AMMA 2OQ7A 3BALA 4BQYA 3NNLA 3QBQA 2QQPA 1ZZCA 3RZHA 2J1UA 4YG6A 4MGSA 1DZQA 4EZ4A 2HWE1 2NZ9A 4BQ4A 1R1A1 5IAVA 4YFZA 1APNA 1W9FA 2VCCA 3NV3A 3AMNA 5C9AC 1GICA 1GZCA 1F4AA 4LLFA 2DUOA 5LW9A 2ZGQA 1VJ2A 1ULEA 1RITA 1XNBA 2RE9A 2WO2A 2L9LA 2R073 1H8TA 1WLCA 2WKKA 3M8LA 2VW1A 1MZEA 2BNNA 1HB2A 4QPGC 1O59A 4MGIE 2GH8A 3VBUB 2BFUS 4Q4V3 2RR13 1X8EA 3PIGA
chains in the Genus database with same CATH topology
3VZNA 4GKXA 1DFQA 3ZN5A 1POV3 4N53B 3H3ZA 3PVEA 4B7KA 5FPXA 1KS4A 1KXGA 2B45X 5T5OA 2N7GA 2ZGLA 3RRDA 2GU9A 1B35A 4GA9A 1FOD1 1RUJ2 3IPVB 1YJKA 2IXLA 1TQ5A 3NV2A 3U07A 4FXGB 2VVEA 1XYNA 3UKNA 2C5DA 1FT9A 2JDZA 4LUMA 4D94A 1RUJ3 3OY8A 1AR62 4E4SA 3JQXA 3LCPA 2YGMA 1OMIA 1ZYBA 3KCCA 2E6VA 2PAMA 2R071 3OBRA 4LBOA 1W6PB 2V09A 5A33A 1PVXA 1AR63 2WNEA 3BIWE 3GBWA 5C9AA 2KM2A 4QPIB 4B4RA 4Q4V1 1AHSA 2RR11 4AFMA 4CDQC 1POV0 2B5HA 3POWA 3WNXA 2OZ6A 4JDMA 4YG0A 2VNGA 2DURA 1POV1 1PIV2 4QPGA 4QQ2A 2XH6A 3L2YA 3U0ZA 3H1MA 2XHKA 1GQHA 4JGYC 4ES9A 2EAAA 4IEUA 2DVAA 2E51A 4E4ZA 3UKTA 1M06G 1Q8SA 1HV1A 5T5JA 3KCXA 4M0NA 4Q0PA 3JB4C 5BNOB 1B09A 4AHXA 2HWB2 2X53S 4YRDA 5JOWA 4LA3A 4LEJA 1TMF2 1WBLA 1Y43B 5L7OB 3E5QA 5GJ6A 2TUNA 4FCAA 1MEC1 3R4DB 1RUI2 1NY71 4GWMA 3NVCA 3E6CC 4FTEA 3E97A 3IDCB 1DHKB 1W6QA 3AP5A 2JD4A 3O7OA 4TYSA 2AR6A 2A3YA 2EALA 1RUI3 1OI6A 5F6KA 4QT6A 4WV8A 3B9CA 4CDQA 1J3PA 3B69A 1W6NB 3V0AB 3KT1A 3WX5A 3H3UA 1KDKA 5D1IA 4I0WB 4FBFA 3UK9A 4K6BA 4PF5A 3M2MA 4EV0A 2PHRA 2JG9C 2A3XA 4JGYA 4U36A 2ZS6B 2WNVC 1H4HA 4AGGA 4IEZA 4XF0A 1FAYA 2XBO1 2PTMA 4HPKA 2ZHKA 1COV2 4G3YC 4KGQA 5CFDC 1WD4A 4LBQA 1D4M3 2DCJA 5DZEA 4PDWC 4Y1ZA 1ULFA 3HIFA 3N35A 2GC1A 4UXAA 2K0GA 1AJOA 2XLFA 4M3CE 5E89A 1RUE3 1NCQB 4FPJA 2ZX4A 3ZFFB 1YCIA 2SBAA 3H9AA 4R9CA 2YZ4A 1S0GA 4KH9A 5DUXA 4BOWA 4XXPA 2CV6A 4M3CA 1X36A 3JQWA 1BVP1 2BVVA 2RS12 3QCWA 1UPSA 4TZDA 4RHV3 4YW1A 4MLOA 2P3KA 3VBHB 2R1BA 3PTYA 1FNYA 5H9SA 5A32B 1WW6A 4I3PA 2VY0A 3VUOA 2JG9A 2VW0A 2WNVA 1D4M1 4ATFA 2UURA 3RZZA 2PHXA 4GKYA 5J09A 4M00A 4M3CF 1RUE1 2R063 5CFDA 1IPJA 4NPRA 3WDWA 2WZR2 4PDWA 3HT2A 3QLQA 1MS1A 3KLSA 2Z42A 1GR3A 3ETQA 1QDOA 4LA2A 1J1LA 5FOJB 4Y1YA 1F2NA 2VGDA 3OGJA 4GULA 4AVSA 5IT6A 1JOJA 1H2MA 2Z69A 3V64A 4RHV1 1RMU3 1DGWA 4XF1A 3D6EA 2ZX2A 2JG8B 2ZKNA 1CAUA 4LBQD 5LRRA 2O1QA 5LK5A 3MLJA 4INDA 2R30A 3WCRA 3O14A 4RQPC 3OF1A 4OI0A 3VBSB 5JZGB 4LTAA 1RTVA 2ZX3A 1MS5A 1MS9A 2PLV2 2R061 3VZMA 2GNMA 1AVBA 4HKLA 1PO12 4H14A 1AX2A 3JBG2 2BWCA 1NE4A 3IWZA 4Y22A 2PAKA 3WHUA 5SV8A 1L3JA 4AF9A 4R9AA 1RUH3 2JEMA 2YV8A 1PO13 3PJQA 4E2GA 4EJRA 1SBFA 1GBGA 2RMU2 4FPLA 4MXVA 5HBAA 3RQ0A 1BJQA 2EA7A 1IGOA 1ZZBA 2E9QA 1ALYA 4IESA 3QOPA 3M3CA 1V00A 4Y20A 3ZSJA 1HXS3 5DG1A 2FMYA 1TE1B 4QGLA 1B35B 3MIFA 4Q4X3 3ZSMA 4FP2A 1BYHA 4QHBA 4OHXA 1X82A 1AR83 3J8F2 2OIIA 3M7AA 3CJIB 4YGCA 1X8MA 4ASMB 1LHOA 1CAWA 1LJ7A 4QX5A 1OLQA 1LOGA 2ZHNA 2PELA 4RQPA 4C91A 3BOWA 1ONAA 1OOPA 1VAMA 1TEIA 3J8F3 3MIBA 4LHNA 2WA3A 4U2AA 1LOAA 1RUOA 2DYCA 1LU2A 2XJRA 1HQNA 1RUH1 1RUF3 2IXHA 4XJ8A 1Z78A 4J1WA 3N7MA 1WMFA 3TNPB 1DYPA 3RI9A 4QPGB 2XLAA 4BH9A 3WG1A 3FLPA 2C1FA 1WA4A 1HDKA 4IV1C 4ISRA 3VHPA 1UAIA 4HLTA 2TBVA 4QD2A 3ZFEB 1R081 2B39A 4FO9A 4PCRA 4M0HA 1AR81 2WL1A 4E9KA 2VMGA 1WMDA 1G7YA 2HWC3 1AJKA 2K9ZA 4QU2A 1W6MB 2MHFA 4ZU7A 4L9BA 2BYVE 2ZGPA 4PIXA 4BMEA 3OD0A 4XEZA 1ZNPA 1YI9A 3MW2A 4D3WA 1G9FA 1ZRRA 2GMEA 4YGEA 2QFEA 1VBB2 3U4XA 1U5ZA 2CWMA 1A6CA 2VW2A 3I54A 1RUF1 3VN4A 2EAKA 1ZX5A 3B5LB 3MIDA 4IETA 1PK6C 3OJBA 4QGMA 4JRAA 5E8AA 5BNQA 2OYZA 2R043 3AK0A 2IC1A 3QACA 4CDQB 4LHKA 1LOCA 3EJKA 3GBFA 3KM5A 4IV3B 2K2SA 4AW7A 5AC92 2XKOA 2DVGA 1MZ6A 1ZZ9A 4LBLA 4WBBA 3E5UA 2IXCA 3B3QE 5FO7B 4OHYA 3V56A 2CTVA 1GZ9A 2FQPA 4JGYB 2GNDA 1NCRC 4XE9A 3AZVA 1UKRA 5AC93 2HWC1 2VOWA 1EPWA 2Q1MA 1ZBE2 3TN93 1Q3EA 1VR3A 4C1WA 4HL0A 3U10A 1HRI2 1NXMA 3IIAA 3ELNA 3M70A 3CU7A 3DN7A 3M3EA 3M3OA 2VQAA 1YNAA 4HVRA 1BQPA 3JU9A 4YM0A 4K7JA 3MW3A 5T3NA 1SLTA 2ERFA 4NWWA 3LZZA 2R041 2VVFA 4UW4A 2HWF2 1RJ8A 3A4UA 1O4ZA 1NYWA 4W6YA 3G6JB 1PK6A 3M3QA 3H7JA 1NLRA 4O9GA 3I4IA 4LBMA 4P14A 4X6RB 3GF6A 4AQSA 1CPMA 2WA4A 4MVTA 4GH4C 5CA6A 5IK5A 3RS6A 1RHI2 4Z1VA 4AVAA 2ZAAA 4BHPA 2VUAA 3TN91 2JG9B 3S6PA 2WNVB 5F6LB 1NCRA 5C8CB 4YGDA 1VBE3 1EAH3 5EWSA 1BBT2 2WQZC 5J96B 1IS3A 1RHI3 2X5IC 2D5FA 3ILNA 5CFDB 5CFCC 1I5ZA 2CY6A 5BUVA 1OQDA 3ACLA 2IXKA 2XG3A 1PO22 1ZREA 4YZ2A 2GMPA 4HSLA 2JENA 1V6MA 1WLDA 3WQ7A 3WQ0A 4P9YA 4GB32 3AYCA 2A6WA 2YDEA 2WFF2 3T2TA 4J6GA 1SCRA 1UCXA 1JUIA 2DFCA 3RDIA 4W6XA 4KNCA 4XDQA 2YMZA 1IHMA 3GZAA 4GH4A 5C4WB 4XFAA 5GLTA 1F9KA 1EAH1 2JE9A 3H7YA 4QGNA 1HQWA 4XHBA 1ENQA 3HMYA 3W58A 3L9JT 2ZA9A 4JGZC 4K1ZA 5JOYA 1KJLA 1O7FA 3PVNA 5JAXA 1W6OA 3NL1A 4ZU4A 1IQAA 3WOGA 5T5PA 3GBGA 4MUVA 4QQOA 1GFF2 2AZ5A 2X5IA 4NR1A 3WINE 4AHZA 1AYN2 1EV12 5CFCA 2WT0A 1FNZA 4Q4Y2 1Y9QA 3CL1A 1QXRA 3NAPC 1Y7BA 4FOVA 3WLUA 1ASJ2 5T54A 5DDJ2 3CLPA 5I93A 1YWKA 4KGGA 2Z79A 4Y20B 3WW1A 3ZN6A 1YXWA 2YPJA 2G9FA 3VBOB 3R05A 1KFUL 1OA2A 4YM3A 2UY8A 5DDJ3 4Z07A 5LEKA 1ENSA 1VIWB 3VKNA 3WD5A 4XJAA 1VBA2 2D6KA 3D0SA 4CYDA 3NKTA 3AZXA 4K3UA 1VBD3 1CGPA 3EHKA 3C2UA 2VULA 4EWDA 1N3OA 2GMMA 3SH3A 1BK1A 1CAVB 4Q27A 1FPN3 1HIXA 3MFCA 4AVVA 1W0OA 1QJZA 3CO2A 3USUA 1VRH2 2VPVA 1RB8G 2ILMA 2A71A 1LENA 4IEPA 1Q8OA 1QJY2 2A73B 4P9IA 3FUQA 4JGZA 3U11A 3ZXAC 5FQ0A 1RUG2 2PHLA 3WCSA 1OD5A 3EQEA 3R4SA 5JLVA 2NN8A 1G9DA 2XLGA 1ND3C 2GZWA 4LO4B 1NG0A 4MYEA 1FATA 5IK7A 5JOZA 1SCSA 1X50A 3BCWA 3NAPA 2BW8A 1BEV2 2A6YA 1LHNA 3UJOA 2DVFA 3WG4A 1H9PA 1GANA 2QE3A 3PVOA 4XJZA 4DMIA 4FSJA 3FLRA 3OPZA 3RYPA 3URFA 3VBRC 3FBYA 1AR73 4N7IA 1VBD1 5KHHA 2ZOEB 5GALA 4ISQA 1V6NA 2A5ZA 4E2QA 1CR7A 1QQP1 4YZ1A 5T52A 4M01A 1D2SA 3VKLA 5IK8A 4AQ6A 1FPN1 2JECA 5K9YA 1S0BA 4CDXB 1LR5A 1C3HA 5J98B 3WVJA 4JDNA 4S2GA 4BA6A 1R1A2 1J3QA 4OHZA 5FDBA 4I02A 1FX5A 3ZXJA 3B00A 5BNNB 1DZRA 2ATFA 3DF0A 4C0HA 3A0KA 1W0PA 1LHVA 4BQ1A 5FMOL 3MPBA 1QJX2 2E7AA 2IXIA 4NWVA 5L73A 1JW6A 4Y5Z0 3MLLA 3ZX7A 1BCXA 1TME3 4RR3C 1AXKA 1ND3A 3V0BA 5ACA3 1YLLA 1C8M3 3VKFC 1ZVFA 2O8OA 1DYKA 1QJX3 1QJU2 1BKZA 1S0FA 4KG8A 2MEV3 1QY4A 1AR71 4IV1B 2CGNA 2XVKA 3H50A 3ATGA 5BV6A 1J1TA 3HR9A 4BWOA 1ZM1A 4CDWC 4WM7A 4YW5A 2Y0OA 3VBRA 4RFT0 1QJU3 1ZZ7A 5D8AC 3ZSEA 4COWA 3D0JA 4MH0E 2Y38A 2PHUA 4FTSA 4QM8A 1H2NA 3ZXDA 4KWJA 4RGAA 3K51A 4PIYA 2Q1ZB 4LE3A 1RIRA 1OPOA 5IUQA 4JCKA 3IM0A 2B46X 1H9WA 3PHMA 4HMZA 2BFUL 3VLBB 2P37A 3NSTA 2WSVA 2D93A 1NA1C 1TME1 3O5SA 2Q5TA 1CAXB 4MGKE 5ACA1 2Z2SB 2RJLA 1JN2P 1H0BA 4WVMA 1RJ7A 4KBBA 4QQLA 5JIUA 4RR3A 2CAVA 3I59A 5J37A 2FMDA 4XETA 4BMBA 1RVF2 1YFXA 4ES8A 4ASLA 2YY1A 4YZ4A 4Q4W2 1NCRB 1C5HA 3ZSLA 2XJTA 2ZACA 4N43B 4CDWA 1Y3TA 3KT7A 2D43A 2AYHA 3FFQA 1YIFA 2DCZA 3WXPA 3GHMA 5D8AA 4FP3A 1CJPA 1I6XA 4RD7A 4Y1VA 1DQ1A 4EN8B 1IOAA 1LHUA 1WCSA 2DTYA 3AJZA 3MEPA 4LLOA 4I30A 4XMAA 4H55A 4B29A 3FWEA 3AKTA 2CNAA 1AL22 2QVSB 1PIV3 5FLIA 1Q43A 1WCKA 4AXOA 1NA1A 5CBLA 1M4WA 2MPFA 2VMIA 1RUJ1 2QJVA 4EROA 2B7YA 1DU3D 4HKWA 2CGPA 2D97A 3T1MA 2ZX1A 2XBO2 2HWB3 3MGUA 4COUA 1AR61 3MZHA 1TMF3 1KQRA 1FMD2 2MNGA 4XOGA 1F31A 5FO8B 1NOVA 3APBA 3O12A 4BE3A 1QOTA 5BNPC 1NXD1 3AYEA 4AHWA 2NYYA 4BZ4A 4ZU5A 1PGSA 4KU7A 1S0CA 5EYYA 5GLZA 3FJSA 2ZPXA 1PIV1 1IZ3A 3DUIA 2HEYF 1ULGA 2PAEA 5EXOA 5E88A 4YLZA 1UPIA 3LWCA 4AQTA 2A6ZA 2RHPA 2V5YA 3LA7A 5J3UA 5F9TA 1J58A 1AR92 3SISA 2NLRA 5JR7B 4COZA 4HFSA 4YYOA 2VMHA 3AKQA 4L92A 1BMV2 2HWB1 1QXPA 1TMF1 1COV3 1UU4A 3ZIWA 2Q30A 3WDUA 1H8VA 1UU5A 4Q0UA 2AGSA 3BPZA 1A8DA 1RUI1 3MICA 4XFBA 5CAZA 3DV8A 3OCPA 3KCYA 1WLWA 3ROUA 3DPRA 2WS92 1QDCA 3VBFC 4JVAA 3CNAA 2R0FA 2D5HA 1GZWA 3AP6A 3M1HA 4FVVA 1D4VB 4Z82A 2BVBA 3IN9A 1J3RA 5BNPA 3EO6A 1RUC2 4LBNA 3JCIA 4L99A 2WNUB 3RYRA 2WS93 1JYCA 3ZMNA 2R16A 4CEYC 5GZCA 4YVSC 1URXA 4A2UA 4DY3A 3O0WA 2RS13 1S0IA 1O5LA 1G6NA 4IL7A 1LODA 1MS8A 4Q8LA 2QZ3A 4Y26A 4CDUC 1JH5A 1I1EA 4EN7B 5K0UC 4XJ9A 1COV1 3PMEA 3FC0A 5A3LA 1BXHA 4RSUA 4DOUA 5FREA 4LR4A 4XTMA 3KGLA 2DU1A 4XTPA 5HCAA 1MVEA 4BLIA 1AYM2 4KQ7A 2WZR3 4FT8A 4NHKA 1DQ2A 3WUCA 2Y0IA 1O4TA 1R092 2I74A 1QHDA 3H0OA 4H7LA 4WM8C 4YZ5A 1HQLA 3VL8A 5CVRA 4YNIA 4BLJA 3G7DA 4XIOA 3VBFA 1XXNA 3SH5A 3GALA 4AHYA 1RUD2 2CGOA 3V65A 2RS11 3V0BB 1S0EA 1Q56A 1PMIA 3E6BA 2ZGSA 3AZYA 4YVSA 4CEYA 4KU8A 1OOPC 4R52A 1EP0A 3B94A 3THTA 3AYAA 4MXWA 3CF6E 3ZXKA 4HK8A 4TSVA 2ZABA 1OLRA 3VBRB 3RI8A 4CDUA 1N47A 1JHNA 3RG0A 2P34A 1CX4A 4L97A 2XKPA 4Z2WA 3KSCA 5K0UA 1H8TB 3GZUC 2PLV3 3J4UH 5LK7B 1N1SA 3SXWA 2WZR1 3JBG3 5HCBA 3WDTA 4F83A 1QOSA 1QNYA 4OUSA 5TSWA 2DV9A 3AXDA 1ZA4A 3MDPA 1RMU1 3IDEA 5EFUA 3N4MA 2CL2A 3D4KA 5BXXA 1S0DA 2RMU3 1H1MA 2VOXA 3D82A 4WM8A 5I0TA 3ALQA 1HRV2 1XQNA 1SBEA 1EY2A 3BTAA 4AFBA 4IEXA 4WVMB 3PVBB 3ME2A 4URTA 1ZBA2 4JTOA 4RL7A 1QOOA 4Q1PA 4X8PA 1Q5OA 2Q8OA 1U5YA 3OY8B 1LTEA 2ENRA 3ILRA 1YFUA 2DWRA 4MV2A 1MQTC 3B9IA 3LSDA 3FUOA 5E16A 1V70A 1WW5A 4NHLA 5KHJA 4AEDC 2PLV1 4GMP3 5A33B 4D7YA 2DTWA 4JTNA 5C9AB 3SLIA 2WT1A 1PO11 1RINA 4UW5A 1KRIA 3AYDA 2SLIA 4XQ4A 1YHFA 4HK9A 4KL1A 2JJ6A 4P9JA 5KC5A 3OBTA 1GYKA 1HXS1 4TWTA 2RMU1 1VB2A 4Q4X1 4YG3A 4MSVA 4PBPA 1VAVA 4AG4A 2Q0AA 5H9QA 1NA1B 2PHDA 3AFGA 5I0RA 3W59A 1AX0A 4FPOB 3NV1A 2ZMNA 4YVWC 2VNOA 2AENA 4Q0SA 1MZ5A 4LO8A 2EXKA 1DGRA 3P3NA 5H9PA 3J8F1 2QUOA 4FQ4A 4GMP0 4YARA 3UJQA 2RM22 1LOBA 1UU6A 2G9GA 4GMP1 3VZOA 2D98A 1W6QB 1HW5A 4XFFA 2P17A 3RWNA 4ATEA 1MQTA 1REEA 3MIEA 4R4ZA 1VBB3 2RM23 4AEDA 5B2GB 1DGRN 3IKWA 1PGW2 4UW6A 4R8HA 5I8SA 5E1RA 3VHOA 5KHIA 2HEVF 3VBUC 1DQ6A 3WQ1A 1XRUA 1QH7A 2C9AA 2WQ4A 2BTVC 1XYPA 2KXLA 4EN9B 4N53C 5FOBB 3MF6A 3WW2A 2OPKA 1GSLA 3MLKA 5H9RA 4N7UA 2IFWA 4NN0A 3GHNA 3VDDC 1O91A 3R4UA 1IPKA 4HPKB 3IBMA 4AYUA 1PNFA 2GC2A 2C0ZA 5FRAA 1OQEA 2D6LX 5K8SA 4LBQB 2B42B 2YGLA 1ZZ6A 1O3TA 5CB7A 4YVWA 2HWD2 5AFBA 1ZBE3 1V6LA 1SBDA 3LOBA 3NW4A 3UL2A 3W9AA 2JE7A 1HRI3 2NQYA 2QZ2A 3HD8B 1VBB1 1PHMA 1BZWA 2QCSB 2ZGTA 3FBMA 1U0AA 4QPIC 4M3CB 1JTZX 1O4YA 4PLNA 1GZWB 1WW4A 2ZHLA 1AL0G 1I9RA 4AGRA 4A7YA 5GLVA 4HSJA 2HWF3 3AMPA 3WUDA 3VBUA 2A7AA 1OHFA 2W39A 3D8CA 5AC91 2LUWA 4K21A 4AEMA 1IKQA 3QH7A 2A3WA 4N53A 3SMHA 1RL3A 4EWAA 4I0AA 1DQ5A 5BNOC 4UW3A 2UYBA 3VDDA 5JSPA 1WMEA 3IPVA 5F1RA 4XILA 3JB8A 1ZBE1 2GSYA 1AUYA 1PGL2 2DUQA 3I8TA 3LKJA 2BEOA 3TYJA 5L7OC 4D7TA 4F8AA 1LKNA 4PDWB 1QGLA 4DQAA 4XHXA 4CRQA 4X6QB 1BBT3 1G86A 2PHWA 4A3XA 4F7ZA 4EWEA 4UBHA 1LEDA 4XXAA 1TNFA 4Q0QA 3FZ3A 2X29A 3RSJA 1OA3A 1OSGA 4P9GA 1W6PA 2X8KA 2WFPA 3TB0A 1PVC2 4DFSA 1PO23 5IK4A 4QPIA 1Z7S2 2YC0A 3ENRA 3VBFB 1CQ9A 1CAUB 1HLCA 2XVLA 4JRLA 4DRVA 4OLLA 1DG6A 3KMHA 4GB33 2WFF3 1QF3A 2GC0A 5I0UA 4R4XA 1D2QA 3AJYA 1VBE1 3CJXA 3MPPG 4YVSB 3EXUA 1RHI1 1YFWA 1S0JA 2XJSA 1GKBA 4P9LA 2RS52 1WUVA 2WLPA 2XB6C 3ZSKA 3ZO0B 1N3PA 2UWBA 3JZVA 2WC2A 3ZXLA 5BNOA 1UW8A 1VALA 4FTBA 4GQ7A 2D3PA 1GQGA 2HYKA 2IXJA 2RS32 4HETA 4Y22B 5C6CA 1BBT1 1KJRA 4OUMA 2UYAA 2RJKA 1DGWX 2D6NA 5L7OA 3LSEA 4R9DA 3WDYA 1RC6A 1NCQC 4NVPA 1REFA 1XU1A