2MEV3

Structural refinement and analysis of mengo virus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
231
structure length
231
Chain Sequence
SPIPVTIREHAGTWYSTLPDSTVPIYGKTPVAPANYMVGEYKDFLEIAQIPTFIGNKVPNAVPYIEASNTAVKTQPLAVYQVTLSCSCLANTFLAALSRNFAQYRGSLVYTFVFTGTAMMKGKFLIAYTPPGAGKPTSRDQAMQATYAIWDLGLNSSYSFTVPFISPTHFRMVGTDQANITNVDGWVTVWQLTPLTYPPGCPTSAKILTMVSAGKDFSLKMPISPAPWSPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENGO VIRUS COAT PROTEIN (SUBUNIT VP1)
publication title Structural refinement and analysis of Mengo virus.
pubmed doi rcsb
source organism Mengo virus
molecule tags Virus
total genus 33
structure length 231
sequence length 231
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mev300
1RUD3 1NY71 2ZZQA 1OOPC 4SBVA 4IV3A 3VBSA 1COV3 2WFF3 1PVC2 3VDDB 2R071 1VBB2 4WM7A 1FMD3 1CD3G 1R083 1AR83 1VRH1 3JBG1 2MEV2 3VBFA 4Q4Y3 5BNOA 1PIV3 1VBE3 2RM22 1RUH3 1QQP2 4CDWA 1K5MA 1NA1C 1RUC2 3VBUC 1ASJ2 1V9U2 4N43A 2RS53 4WM8B 3NAPB 1CJDA 3ZFEA 1C8M2 4YVSB 1RUJ2 4YVWA 4CDQC 1AYN2 4QPIB 2HWC3 4RHV3 1VBB1 5FMOL 1OOPB 2WS92 1NCRA 3ZFFC 4Y5Z0 1PO12 2MEV1 3VBHA 4GH4C 4QPGC 1RUI2 1POV3 3JB4C 1R093 1R081 1AR81 3VBOA 1BBT2 1AR92 1QQP1 1ZBE3 4Q4Y1 1VBC2 4FTBA 1X33A 1ZBA3 1RUC1 2BFUL 1ASJ1 1ND2C 1PIV1 4NWVA 2RMU3 3ZFGA 5DDJ3 1NA1B 3VBUB 5C4WC 1C8M1 3J8F2 1RUF2 2RS12 1MEC3 1AYN1 1VBD2 4Q4X3 1AR62 3TN93 1TMF2 1B35A 2RS51 1VBA2 2HWB2 1QJX3 2WS91 1RUE2 4RFT0 4CDQB 1PO11 4JGZC 1RVF3 1VB2A 3LOBA 4RHV1 3JD72 1RUI1 2WZR2 3ZFFB 1AL22 1NCQA 1RMU2 4GH4B 4QPGB 1BBT1 1AR91 1R1A2 2R042 4IV1C 4RQPA 4N53A 1R091 5D8AC 4JGYC 1AUYA 1NG0A 2R063 1ND2B 1ZBA1 5C9AC 2R072 2RS11 1TME3 2RMU1 1AR61 1TMF1 2HWD3 5C4WB 3JBG2 4Q4W3 3S6PA 3ZXAC 4AEDA 5A33B 1MEC1 4CEYA 3TN91 4RR3A 5ABJC 4JGZB 1RMU1 2BPA2 4CDUA 5GKAC 4CEWC 1M06G 1EV13 2X5IC 1RVF1 4GB33 1GFF2 5CFCC 1E57A 4QPIC 5BNPC 3IDEA 1IHMA 1RUG3 4GMP3 1RB8G 4IV1B 1QJU3 5D8AB 1RUD2 4JGYB 3VDDA 3DPRC 5C9AB 1COV2 1ND3C 1FMD2 1R082 1AR82 3VBRC 1SMVA 2HWD1 1QJY3 2PLV3 4Q4Y2 1PGW2 1PIV2 1VBE2 5ABJB 5AC93 4Q4V3 4CEWB 3FBMA 1PGL1 4WM8A 2X5IB 1HX6A 3NAPA 2ZTNA 5CFCB 1EV11 2RS52 4CDXB 1AR73 4YVSA 5BNPB 1RUD1 4RS5C 2HWF3 4QPIA 2TBVA 4GMP1 5L7OC 1COV1 1MQTC 1OOPA 2WFF1 1WCDJ 4RHV2 1QJU1 2FZ2A 1FMD1 3DPRB 1BEV3 1F2NA 1ND3B 1PO23 1PGW1 1RHI3 1HRV3 2WLPA 3JB8A 3VBRB 1VBE1 1R092 5BNNC 1HXS3 1F8VA 1HRI3 1RUH1 1ZBE2 2PLV1 1ZBA2 2RR13 4PDWC 1VB4A 1Z7S3 1NA1A 4Y4YA 2RMU2 3VBUA 5DDJ2 3CJIC 1FOD3 2WWSA 1MEC2 4Q4X2 5J98B 3TN92 5C8CC 4CDQA 1VBD3 2HWC1 1H8TC 5A32B 4RS5B 2IZWA 5L7OB 2HWF1 2GH8A 5K0UC 1D4M3 1MQTB 2BBVA 5CFDC 3ZFFA 1RVF2 4GH4A 4QPGA 1POV1 2XBO3 1EAH3 4LLFA 1AL23 1ZBE1 1PO21 5JZGC 1HRV1 5BNNB 2RS33 1ND2A 2HWE3 5DDJ1 4IV3C 3VBSC 4PDWB 2R062 5C4WA 4WM7C 4Q4X1 2HWD2 3VBFC 5A33A 3CJIB 4Q4W2 1VRH3 4BCUA 5BNOC 1QJX1 1FOD1 1AYM3 5C8CB 1VAKA 1H8TB 4JGZA 1FPN3 1A6CA 4CDWC 5ACA3 4CDXC 1K5MC 5K0UB 5CFDB 1PGL2 4N43C 1D4M1 1X36A 1EV12 4GB32 1POV0 4IV1A 2XBO1 3ZFEC 1EAH1 1RUG2 5JZGB 5D8AA 4YVWC 2WFF2 4JGYA 2R061 1QJU2 1PVC3 2RS31 1BMV2 5C9AA 1TME1 1NCRC 4IV3B 1VBB3 3VBSB 3VBHC 4Q4W1 2MEV3 4WM7B 5LK7B 3VBFB 2QQPA 3VBOC 3M8LA 5BNOB 1QJY2 1RUH2 4Z92B 2PLV2 2RM23 1QQP3 5ABJA 1AYM1 1RUC3 1ASJ3 3ZFGC 1V9U3 1DDLA 4GB31 4CEWA 5AC92 4Q4V2 4CDWB 1K5MB 1FPN1 2X5IA 5ACA1 1W39A 4N43B 5CFCA 4CDXA 1RUG1 5BNPA 1C8M3 1RUJ3 1B35C 3HAGA 1AYN3 2HWC2 1AR72 3ZFEB 1BMV1 4YVWB 2HWF2 1OHFA 2WS93 1AL0G 1PO13 3DPRA 4FTSA 5J96B 1PVC1 1NCRB 1ND3A 1NCQC 1RUI3 1BEV2 3VBHB 1QJY1 3VBRA 1PO22 1RHI2 2FZ1A 1BBT3 1AR93 1HRV2 4EJRA 1VBC3 4RQPC 3VBOB 4N53C 2GSYA 1HXS2 5AC91 4Q4V1 1HRI2 1C8NA 2RM21 2RR12 3ZFGB 1Z7S2 5FMOS 3J8F3 1V9U1 1RUF3 2RS13 1AR63 1AR71 1TMF3 1QJX2 1VBA3 4AEDC 1FOD2 2HWB3 1RUE3 5A32A 1B35B 4RS5A 4CEYC 4GMP0 2XPJA 1HQNA 1RUJ1 5L7OA 4RR3C 1MQTA 3JD73 2WZR3 1BEV1 2BFUS 4CDUC 5FOJB 1D4M2 1NOVA 1RMU3 4NWWA 1RHI1 2VQ0A 4FSJA 1NCQB 1R1A3 2R043 2XBO2 1HXS1 1EAH2 2BUKA 1HRI1 5BNNA 4RQPB 2RR11 4N53B 1VBC1 1Z7S1 2RS32 1TME2 4PDWA 2HWE2 2R073 3VDDC 1NY72 3JBG3 3CJIA 3J8F1 1QJZA 1RUF1 1VBD1 5C8CA 1VRH2 4AEDB 1H8TA 1VBA1 4CEYB 2HWB1 1AYM2 2ZAHA 1RUE1 4RR3B 5K0UA 5CFDA 4FTEA 1FPN2 2Y26A 5ACA2 4CDUB 3JD71 2WZR1 1AL21 4WM8C 3NAPC 1OPOA 4YVSC 1R1A1 2R041 5JZGA 2DF7A 2HWE1
chains in the Genus database with same CATH superfamily
1XB9A 1NY71 2D6LX 4E8CA 1UOJA 2QQNA 1SBEA 1OOPC 1YFWA 1K5JA 3RSJA 3VBSA 1CAWB 1W2UA 2VTXA 3I4IA 3N9OA 1CN1A 3VZNA 3WF2A 3WUDA 5JI9A 2E33A 2PHDA 3OGGA 2A3WA 4PBOA 2R071 4ATEA 4WM7A 2YMZA 1CD3G 1W9WA 1AR83 3ZPYA 4AVVA 3PJYA 4YG6A 1TQ5A 2MEV2 3VBFA 4IEZA 3OY8B 4AL9A 1NE4A 1W6NA 1YJLA 2V4VA 3H42B 1H4HA 1ULDA 3K3NA 4YYOA 4CXWA 4EYUA 1ONAA 5IVCA 1UO9A 1IKPA 5JIUA 2D6KA 3H3ZA 1XSRA 3AL6A 2WN2A 4CCOA 1SDDB 5I0DA 3LQCA 3I2IA 1W2OA 4XJ8A 4XZPA 5GZEA 4E4DX 4XTMA 3U10A 2BTVC 4RL7A 1KJLA 4CDWA 4Y1YA 4ARXA 1K5MA 2EXIA 3HMYA 3QH6A 1WLTA 3TAYA 5DUVA 1GQHA 3D82A 2JDKA 1OT5A 3IAPA 3FX3A 3MIFA 3TRSB 3WF0A 4PLMA 2XKPA 3O14A 3UL2A 1UYXA 4LBQD 1H9WA 3LA7A 3WG4A 4CP0A 5LATA 1CJDA 5GJ6A 1GP5A 2DU1A 4IW3A 4X6RB 3WF3A 1VMHA 3ZLIA 2VUCA 5DUXA 4YVWA 1MR5A 5JR7B 1AYN2 3B01A 4Q2FA 5LA1A 2VQAA 2VW1A 3PUSA 2HWC3 3IZOA 4J1WA 3V64A 5J1XA 1ENSA 1MZ6A 2TEPA 1NCRA 1C5IA 4O9EA 4Y5Z0 4AWDA 3ZYGA 5EV7A 1V6MA 4JRLA 3GBWA 4GH4C 3ACHA 1MVEA 1MS4A 4Y22A 4COYA 2JIJA 5JSPA 4QAWA 5GLWA 3NL1A 1POV3 4QHBA 4ZXKA 3B94A 4Q27A 3JB4C 4AFAA 5A1FA 3BOPA 2BEOA 4UFKA 3W5MA 2W9XA 4LQRA 1BBT2 1QQP1 4XCAA 3U37A 3FJSA 4YG0A 2DCTA 5DZFA 1CZSA 1ZBA3 2Y8KA 4ZS3A 1ACCA 2OQ7A 4WVVA 2JDZA 1SHWB 4GZ9A 2BVBA 4XF3A 5FZAA 3U4XA 2KR2A 5B4NA 3K3OA 5FXXA 3VBUB 2EAKA 3WCRA 1X8EA 3L2YA 4A6OA 3V0AB 1C8M1 3ZOIA 1RUF2 2VOWA 3FMGA 4Q4X3 2J1AA 4Y26A 4DOUA 1TMF2 2DV9A 5FJKA 3RZZA 1QXPA 4IETA 1VBA2 4Q26A 5C5TA 5IYYA 4Q0UA 2OXBA 2VC9A 2WBKA 1DQ1A 4P02B 4RFT0 4CDQB 4PQ9A 4JGZC 1YFXA 1XNCA 4UWDA 3WNMA 1QU0A 4AI2A 4RHV1 1OF3A 3WQ0A 5T5OA 4OQ8A 1AL22 4CP9B 1WD3A 3WUCA 2G9GA 3HQRA 1CESA 2BVVA 2OPKA 2XJSA 2EXHA 3RPQA 1S0GA 2ZX3A 3MF9A 4IV1C 5A6QA 2DU0A 2ZGRA 2WAOA 4N53A 5IK7A 1R091 2BP6A 2YZ4A 4C91A 5SV8A 1W0PA 2C9KA 1OLME 1LULA 3CEWA 1NE6A 4QQ2A 3WQ1A 2VZPA 3LIHA 4LO8A 1ND2B 2G4IA 4LTAA 5LY2A 4P9IA 3M2MA 1A78A 2XONA 1IPKA 3BGAA 1W04A 2V5YA 5HPOA 3T2OA 3JBG2 1UZZA 5ERLA 1Q8SA 2JG9A 2OUJA 4Q4W3 1ST8A 2ARBA 3CNAA 2WQ8A 3LFIA 3T4HB 4MXWA 4GWIA 1ZRFA 2JB8A 1MS9A 5I0RA 1LNSA 1WLDA 1YEWA 5A7SA 1JZ5A 2NN8A 2YBPA 3TN91 1OA4A 4KWUA 2QZ2A 2W1SA 4TTGA 3ZXDA 3O1PA 2RDQA 3R0RA 4HSLA 3H8UA 1DBNA 2A5ZA 1LR5A 2W87A 4CDUA 4XFHA 1X7NA 2ZA9A 5GKAC 4CEWC 1VMJA 3AXEA 5FZMA 2X5IC 3RWKX 4GB33 5FZKA 1G7YA 3B00A 5CFCC 3OD0A 5A3NA 1UZYA 1W8FA 2DFCA 5B2GB 1F5JA 2E6VA 5BNPC 3QOPA 4OUEA 4IGQA 2JG8B 2SBAA 4DXSA 3MF6A 1PNGA 3NNJA 1OA3A 4NR1A 4YRDA 3RRDA 4AG4A 3ZIXA 1UXXX 2CAUA 2X53S 5D8AB 3P3PA 4AHWA 1V6NA 5LEKA 1CAWA 3NNLA 4JGYB 1OVSA 2YU1A 3ROUA 3HJRA 4ZZ8A 1MACA 4CU7A 3NWKA 3PUHA 3URFA 5C9AB 1ND3C 2C5DA 3MEPA 2ZHNA 4Z82A 2FBEA 1G9CA 1RL3A 4M4PA 3OY8A 1Q8QA 5I93A 1BQPA 3AYDA 1AR82 3I2JA 5AFEA 1SMVA 3KGLA 3POJA 4YZ3A 5J09A 2HWD1 3NV4A 4ZXEA 4YZ1A 4XABA 3V56A 2K9ZA 1NLQA 2PLV3 2WA4A 3WDUA 4RGKA 4MGYE 3M3IA 2YC0A 2PAEA 3GNEA 4XUOA 1ZZ7A 1N1YA 2F4PA 3KV4A 3LCPA 4LEJA 5H9RA 4XBLA 2DVBA 4K40A 5F39A 1LEMA 1SBDA 3AMHA 2YC2A 4QU2A 2QBXA 4M00A 1RIRA 4AGGA 2DWRA 1BKZA 1UY3A 1GNHA 2AGSA 3AXDA 4D69A 1HX6A 4IE6A 2YXSA 2CGNA 4E8DA 5GZCA 2VOXA 2VO5A 3VB9A 2GC0A 2WYFA 5CAZA 3BOWA 5FK8A 3O1UA 4YGCA 4MGQA 5A3MA 3E6CC 4I2OA 4IEWA 2BBAA 2R7EB 4KGQA 5KC5A 4QXHA 3WY6A 5FOBB 1HLCA 2TBVA 4GMP1 5FY7A 4YW3A 4CU9A 4EN7B 1COV1 2WFF1 1KXGA 4YM3A 3S0MA 2BJSA 2BU9A 5F3CA 3ACGA 2JDNA 3CZJA 2MNGA 2W1UA 3PVEA 4LKSA 1YC61 5GZFA 3VD7A 1F35A 2QQMA 2VMGA 3M3CA 4AHZA 4Q0QA 1PGW1 5FYCA 5T3NA 1HRV3 3FN9A 2WLPA 5JCTA 1O3SA 3OD4A 3WDYA 2J1SA 3WNOA 2ZEXA 4FXKB 1LODA 2YY1A 3EB7A 1NUKA 1HRI3 4D7YA 1S0CA 1ZBA2 3B5LB 3BU7A 4HSJA 1C3HA 3M1HA 5KXCA 1H6YA 4KWLA 1Z7S3 2GDFA 3BVCA 3VBUA 4FPYA 2FCUA 2YPJA 3V0AA 2B8MA 3H3UA 5KXDA 1OUSA 2O1QA 2ZGPA 3DV8A 3LEMA 1APNA 4X8NA 5LY1A 4LA3A 3JUUA 3THPA 3ZSJA 4XAEA 5FUNA 2WWSA 4CU8A 5C3PA 3LWCA 4HZFA 4Q4X2 4XBQA 2K0GA 4BYYA 1DQ4A 3MIHA 4CDQA 1VBD3 3RZGA 5JI7A 3QCWA 3N3HA 4LT5A 5B4XA 3KMHA 3N9NA 1HJGA 2GH8A 5G04L 3VZKA 5FZ3A 2VQUA 1TG7A 4CP9A 4QT6A 5F32A 4OZXA 2D3PA 1LOFA 2WT2A 3AZYA 2A6ZA 4AFCA 2JE7A 4OULA 4B4PA 2FCTA 2GC1A 4QKFA 5JZGC 4OI2A 4YPJA 4AF9A 5IK8A 1LHUA 2RS33 2H0BA 1DQ6A 1SLLA 1ND2A 4FFFA 2P37A 2VAUA 3CJXA 5JWPA 4HG6B 5F3IA 1WBFA 4PDWB 3KCXA 4P00B 4AEMA 4GJYA 4HKWA 1XXNA 1CAXB 2VMFA 2YG0A 4LNVA 1WW4A 4DIQA 4DUXA 4Q4W2 1Q43A 4IE4A 5BNOC 2I74A 1QJX1 2QQOA 1FOD1 1XNKA 1AYM3 2GAUA 3VN4A 5TSWA 3WW1A 3SCHA 4FQZA 4XJAA 3PLQA 3PTRB 2PYTA 2P2KA 4CDXC 5K0UB 1AXKA 2WL1A 1YQ8A 3ALQA 4CZSA 5J36A 5FPXA 2D43A 2GN7A 3VDAA 4N43C 1D4M1 2PFWA 2BW8A 3B02A 1AF9A 3BTYA 1P8JA 1VE0A 3O1SA 1MVQA 4GB32 5ANQA 1BHGA 2ZGTA 2JG8A 1J83A 1VAVA 2VY0A 4AGRA 2W91A 1HB2A 2RJ2A 2XBO1 2WDBA 4FFGA 4PCRA 2UYBA 4XFGA 2PHLA 5D8AA 3SH4A 1LHVA 4JGYA 5FXZA 2R061 3LPGA 1G86A 4PQQA 1WA4A 1PVC3 5F1RA 4R9DA 4LULA 4PF5A 3ZDSA 5C9AA 1IOAA 1TE1B 2VG9A 2VVFA 3LF7A 1IG3A 3UETA 2B7YA 2DTYA 3DUIA 3KSCA 4ES9A 3KVBA 2IXIA 4EN6B 3KT4A 5FXWA 5C70A 3WINE 4QX5A 2AZ5A 5LBEA 3J7HA 5IHRA 2JX9A 3ZXKA 2PLV2 1E5SA 4UW6A 1W6OB 1QQP3 1FI2A 3AMQA 2ZGMA 4I0WB 5A3OA 2CSGA 2ZEZA 4PIYA 1S2EA 4MGTA 5BV6A 1DQ2A 1QNYA 1FNYA 3U4SA 1FPN1 1US2A 3NKTA 3KV6A 4JHZA 2JD9A 4FPCA 3K48A 3MPBA 2R32A 2RVAA 1RYYA 3VHOA 1RUG1 2YGMA 5FFOC 4TZDA 2VZRA 1C8M3 2VCMA 1WUVA 2WSVA 2OYZA 1YWKA 1D7PM 1B35C 1BYHA 3D0SA 4P08A 4XFBA 1C1FA 1DYPA 1V6IA 2VU9A 5DMYA 4DXZA 1A34A 3SH3A 1OHFA 3HBKA 3C7EA 1AL0G 1VR3A 2LROA 1WGPA 1JS9A 4B4QA 1O7FA 4FXGB 3RJ2X 1OXCA 5CKNA 4IERA 3ZVXA 5LBBA 4Y20B 4R9AA 3GF6A 4B7EA 2WSUA 4NIIA 2QDNA 3VBHB 3MICA 1I1EA 1GNYA 3I2HA 1REFA 1W9SA 3KGZA 4I3PA 4IEQA 4LHNA 4F8AA 5F5CA 1KEXA 1HRV2 3NW4A 2D6NA 4M3CE 3FHIB 3WG3A 1T6GC 3K4AA 3VBOB 4JV4A 4AOCA 1DGWX 3KQ4B 5IVVA 1GWKA 4A3XA 5HV0A 3NV1A 1HRI2 1KQRA 3FUOA 1GOFA 2R49A 1L7LA 4LITA 1N1SA 2BNNA 4JVAA 1HKDA 1Z7S2 4WZFA 4OQ9A 2AH2A 4YW4A 1JOJA 1V9U1 4W4ZA 1YI7A 1W2AX 1PMJX 2XKOA 4QGLA 3EO6A 4ISQA 4YWAA 5FYMA 2BV4A 4IE5A 3RZKA 2K46A 4CEYC 2PHTA 4GMP0 4S2FA 3H1MA 3PMEA 3T2TA 1PM7A 2IXLA 3NQHA 2IWGB 4L92A 1PZ7A 1LENA 2ZMLA 3JD73 5DUWA 2ZPXA 5F3EA 1HB3A 5H9PA 1BEV1 2BFUS 2WWUA 3D3AA 1S0JA 3NKGA 4QPYA 5FOJB 2QQLA 3BYWA 4CP1A 5J48A 4NWWA 3RYRA 4HK8A 1RHI1 4AHXA 1REEA 1V6KA 1YRZA 1NCQB 3KB5A 5EPAA 2R043 1OQEA 3HQXA 3RI9A 1REDA 4XC9A 2VUJA 1VMFA 2ZXQA 5GLTA 3SEEA 3HT2A 4D6RA 1FV2A 1MS1A 4RQPB 1C5HA 1UX7A 1VBC1 3IN9A 3OUHA 3PVNA 3SISA 2RS32 3AMNA 4CA9A 1DIWA 3LAGA 4HANA 1H8VA 1KFUL 4PDWA 2VR4A 2XJRA 4GQ7A 3CU7A 4B8EA 1LHOA 1O59A 3I2FA 1NY72 2Y6GA 5AFBA 2G9ZA 4MOAA 5FZEA 4UFHA 1CAXA 5GLUA 3JQXA 3FBYA 5J3UA 1U5XA 3FLTA 2VM9A 4JTOA 3MHZA 4XILA 4XDPA 3RQ0A 3UJQA 1IKQA 2C6SA 3U14A 2IFWA 4AAXA 3WT3A 2KXLA 1DF0A 1HIXA 4Y5TA 5CB7A 3POFA 2EIDA 2WRAA 4Q1PA 1HJFA 2OW4A 4LHKA 2HWB1 1AYM2 2LALA 1RUE1 2B39A 2A70A 2CL2A 2DVAA 2UY8A 4R4ZA 4RR3B 5K0UA 2IXJA 5EJ3A 3DKWA 2Y0IA 3N35A 2UURA 2AYHA 5JXIA 4RA0A 1GZTA 2ES3A 4NOTA 5EYXA 5FZBA 4QQHA 4AQ2A 3M70A 1OPOA 1VRBA 1WZXA 1FAYA 4P14A 2K2SA 2ARXA 4NJ4A 4MG2A 1TNFA 1O6UA 1X9PA 1OQ1A 1R1A1 2RJKA 3DL3A 3K2OA 2X29A 3WR0A 4BQ1A 2HWE1 3T2PA 1N3OA 2PA7A 2VTXJ 2ZZQA 4SBVA 4NHYA 4Q0VA 4TSVA 3IBMA 1J1TA 2ET7A 1COV3 2WFF3 1PVC2 1WW5A 3DCQA 4L2NA 4XFIA 1S0FA 4U2AA 3VDDB 2VQTA 3WW4A 3ZN5A 1UKGA 1QH6A 1R083 2E26A 2A6YA 2CDOA 4CXXA 5I0UA 1UOGA 4ASKA 3AKTA 4CXYA 5D21A 1SLAA 1FV3A 4BMBA 2Z69A 2GALA 1ODMA 2RDRA 1PIV3 1W6OA 3OG2A 1HN0A 4MHUA 4BE3A 1ZRIA 5IAVA 3KT7A 1RXFA 1XJAA 3HN1A 1OLRA 5FTTC 1QQP2 4CPBA 1OUXA 4XAAA 1NA1C 1OFSA 3AZVA 3USSA 1CX1A 1LESA 3S5AA 1EUTA 4QX0A 3S57A 2HYKA 1YUDA 3ABZA 5KBFA 3DECA 1KDKA 4QKNA 3RG0A 3TYJA 2VNRA 1C8M2 1X50A 2ILMA 4FFIA 4YW7A 1W05A 2WZ8A 4HMZA 2FDJA 2XDVA 2JIGA 4OYUA 1VBB1 4YFWA 5DAQA 5EWSA 4AFMA 4MX3A 3RZJA 5IJRA 3Q8BA 2YFUA 4Q0PA 4Y20A 2Q0AA 4Q1RA 3PDQA 1LGBA 2IXKA 3VBHA 2D3RA 2ZX4A 3ECQA 3B69A 3ZSLA 4BLJA 2D93A 4XVHA 1OH3A 2YFZA 2ZOEB 1S2BA 5FK7A 4EQVA 3VBOA 4FTBA 4Q4Y1 5DABA 4LBNA 5FKBA 4PIZA 1S2KA 3AJZA 1SFPA 3M3EA 4JHTA 2RMU3 4KQ7A 1S55A 1OKQA 1Y9GA 3C2UA 3WHUA 4JDOA 3MPPG 1DFQA 4Y1VA 2VULA 4XF1A 1HV0A 3MZHA 3HVDA 2FHRA 1OH4A 1URXA 4JX0A 1MEC3 2JEMA 3IM0A 4AW7A 5FCCA 3OGJA 2RS51 3LSEA 2E7QA 4OI0A 1QJX3 2WS91 2YYOA 1UQXA 1PO11 3MO4A 1G8WA 3CIHA 3I3QA 4UW4A 3T08A 5C71A 4O61A 4DUWA 1I5ZA 1YHFA 1VB2A 2VNVA 1IS4A 1QEXA 2VVDA 2ZABA 3OSDA 1WLCA 2P1BA 3HD8B 1OBNA 1RUI1 3GGLA 3JD72 2XQXA 3AKRA 4Q8LA 1NCQA 3ZFFB 3FWEA 2ZMKA 4QX7A 2WNUB 4QPGB 4META 4AZZA 4NPRA 2EICA 2AREA 2CY6A 2R042 4BJ0A 4NRPA 4RQPA 3LB9A 3O1TA 2LRPA 2EALA 4K21A 3AKSA 3SMHA 1T2XA 1YFYA 5EHDA 1JYVA 1N47A 2AENA 3IIIA 3O5SA 4OLLA 4F3JA 1AUYA 2ZJCA 2EF6A 2R063 1NLSA 1WW6A 1UZWA 2UY9A 3PNAA 1W8WA 4O65A 1UIJA 1JBCA 2WINB 5FBZA 1HQWA 2I07B 5C4WB 1UOBA 4KWKA 3AYCA 4LK7A 4OMDA 4YFZA 1JZ2A 3W21A 5BUVA 3ZXAC 5LA0A 2P3YA 3ES1A 1FATA 2H0VA 3UKVA 2VE1A 3AKQA 4QX2A 2VGDA 4KU7A 3RWNA 1UU6A 5A33B 1BJQA 4RR3A 5JOWA 3TEYA 1JHJA 3IT8A 3THTA 1IG0A 1QMJA 1W6PB 3POWA 4YZ4A 2BPA2 1D2QA 3E5XA 4S2DA 4K9SA 5ISLA 1W90A 3PTYA 4LJHA 1PZ8A 1RVF1 3LFMA 3DXUA 4ZONA 4FVVA 4I09A 5APAA 4QPIC 4CP2A 1UOFA 3WNKA 2ZHMA 1GMMA 5FP9A 1VLNA 5IVBA 1CONA 1RUG3 4Q0SA 3ZM8A 3PUAA 3GZAA 4MV2A 3TOJA 2B4KA 2BGCA 1O91A 5FLHA 1QJU3 4YM1A 5ANNA 4UW3A 2XLAA 4Q29A 3VDDA 2CV6A 4HVOA 3M3OA 3Q8EA 1COV2 3THCA 3H3LA 3B9CA 4LBKA 5T52A 1K12A 2EIEA 2BERA 4W6YA 5JOZA 1R082 2WYSA 3AVRA 4EE2A 4AAPA 3FLRA 2W52A 4OZOA 4BMEA 4QB2A 3LPFA 2JDHA 2W46A 2ZGKA 4I3GA 4LORA 1PGW2 4W65A 4A6SA 2D6MA 1JOPA 2X05A 2UU8A 5FAXA 1PIV2 5E6HA 4GAZA 2AACA 5JOYA 2VXJA 5ABJB 2XLFA 1Y4WA 2WNVC 3PHMA 4A41A 4GKXA 4IEUA 1XNBA 3FBMA 5DN2A 2VZOA 5F6LB 3H1YA 1DYKA 2AC1A 1PGL1 4FQ4A 4GKYA 3O0WA 1UW8A 3DXTA 3CDZB 1EV11 4XETA 2X10A 2VBDA 4CRQA 2OQ6A 1GV9A 2QFEA 4CDXB 2VZQA 5HCBA 3T0DA 2I45A 1RUD1 4NPLA 2ZX1A 4HKLA 3LE0A 4RS5C 2HWF3 5F6KA 2ET1A 5L7OC 2BZDA 2PELA 1MQTC 3SEPA 4BQ3A 1JUIA 1FMD1 4HLTA 5KHKA 3DPRB 1BVVA 1ZA7A 1BEV3 2OZ6A 4K6BA 2W5FA 3VZMA 1LGNA 4XYXA 3P6BA 5KXEA 1PO23 1RHI3 3BODA 1PMIA 5GZGA 4JC1A 3UGFA 2OIIA 3VBRB 3HEIA 4BQ2A 1ZNPA 5JSRA 3S7IA 1OQDA 2A7AA 4XJUA 5FZCA 2A75A 1QJFA 5BNNC 2WC2A 5DUUA 3VDBA 4IXLA 1RUH1 2R0FA 3Q8FA 4AQSA 1BXHA 1Y7BA 2R6QA 3EQEA 3T0AA 1QOSA 4QWNA 1XOYA 1W8NA 4LMFA 4Y4YA 4DRRA 1S0IA 3MV01 2RMU2 4AVBA 2J1TA 1L3JA 2CHHA 3AM2A 1I6XA 1NXD1 2XJUA 1MEC2 1KDMA 2ZKNA 5J98B 5C8CC 4P9YA 3H8OA 1H8TC 5A32B 3AP4A 4D7TA 4A45A 4XUQA 3E1F1 3A4UA 4DFSA 2BBVA 4BLIA 1WCSA 4EWAA 3ZFFA 5DAXA 4CVUA 4RFRB 1POQA 5GM0A 1AX0A 2WNUA 2JB4A 1H30A 4QPGA 1PK6B 4DRVA 4DQAA 1LKNA 1SLCA 5FLJA 3JCIA 3P1IA 4HL0A 5FO8B 5E89A 4AE2A 3HOBA 5DG2A 4FO9A 3ZYJB 2D98A 2ORXA 2C4XA 4H55A 3WDVA 4ZU7A 5FWEA 1CX4A 1OMIA 3RZMA 1LECA 5FZ1A 1SLIA 2HWE3 1RTVA 2VMDA 5DDJ1 2P5BA 4M0HA 3VBSC 2R062 5C4WA 3AYAA 2WKKA 2Q8DA 4WM7C 4D3WA 4I0AA 2JD4A 4ES8A 1ZYBA 3VBFC 1MS0A 5A33A 4GWJA 3CJIB 1CJPA 1J3PA 1GZ9A 3WW3A 3HT1A 4OHYA 3FZ3A 1Q8VA 3PU8A 4W50A 1W6PA 2Y6KA 4AI8A 4PI2A 4URAA 4QQOA 3R4UA 4ASMB 1G9BA 4BZ4A 4CSWA 3FL7A 4CCMA 4CDWC 2XWJB 1K5MC 2NPIA 4UT5A 5CFDB 3MIEA 5H9QA 3VKOA 2Y6HA 1HDKA 5GALA 4B4RA 4XF4A 2Z4FA 2XOMA 1QH7A 4CCLA 4FFHA 3VHRA 5FZGA 1LOEA 4LKFA 1EAH1 5DPNA 2PXJA 1RUG2 2HBTA 4YVWC 1ULGA 4TYSA 3VGIA 2GMPA 4HONA 3WZ1A 1UX6A 1QJU2 1AXYA 1V6LA 1GQGA 1O8PA 3POGA 1OF4A 1TME1 1NCRC 4IV3B 1VBB3 1GP4A 3PMSA 4C1XA 5JDBA 4CPBD 5HCHA 2FDGA 1XE0A 3WCSA 4QPWA 1JZ6A 5JPMB 3UGGA 3K51A 2QQPA 2D44A 4LBMA 2PAMA 1W8UA 2RM23 3E6BA 3QBQA 3ZPOA 2P4EA 3KT1A 1YCIA 4DEVA 5ABJA 5FPZA 4YZ5A 1VAMA 3VD3A 1DLLA 2Y64A 4N90A 2B42B 4MGZE 3T1MA 4E2SA 3O1VA 2QUOA 1DDLA 4ZU5A 2ZX0A 5ACA1 5LRSA 2PN5A 2B45X 2ORZA 2ZKLA 4CDXA 1FNZA 4UF0B 4COZA 2Q1ZB 1GWMA 4MVTA 1RUJ3 2CGOA 4RYDA 3J7LA 2HWC2 3I2KA 4WVMB 4OI1A 5KHIA 4MO3M 4GIQA 3TWIA 1BCXA 3ZFEB 4QHOA 1BMV1 4K1YA 1DZQA 4N7UA 2HWF2 3HNYM 3QLQA 4NE9A 4RD7A 2WS93 2WABA 5C33A 3W5NA 4W6XA 3K46A 1PO13 2BOJA 2VL4A 3DPRA 4OVEA 4IE0A 4FTSA 5A7WB 1CPNA 5CA6A 1UY1A 4FPFA 4I0BA 1MZFA 1DU3D 3MIBA 1U5YA 4FPHA 1RUI3 4BOWA 4DNYA 1BEV2 3BPSA 3VBRA 4XACA 5FZLA 4B29A 5F37A 4KG0A 4X8PA 1PO22 5LB6A 1RHI2 2L9LA 4LBQB 4EJRA 5BNQA 2VBPA 1LB2A 5E8AA 5IT6A 4BB3A 3DKQA 1W3VA 1BLZA 4N53C 1H4GA 1YJKA 5FQ0B 5CNAA 2QQUA 4Q4V1 3A22A 2RDNA 1ZA4A 1PNFA 5LWBA 2W95A 4QKBA 1RGSA 2A71A 5C7GA 3THDA 3E6DA 1GICA 1H6XA 1Q8OA 3ZFGB 1KS5A 1GUIA 3J8F3 5FMOS 4FPEA 1JYNA 1D0GA 2JG9C 1IZ3A 5DAVA 1DGRN 4DXTA 1LOGA 1XBFA 1SFNA 2XUMA 1UU4A 1WLWA 2Q4SA 5A32A 2DFBA 2XPJA 1HQNA 2WO7A 5LBCA 3NNMA 1GZWB 3RVHA 2I2SA 3D8CA 4MSVA 4FPOB 2BGOA 3ZXGA 3M7AA 4AI0A 1PHMA 2WZR3 2IUWA 4CDUC 4FOWA 3HIFA 1NOVA 3WG2A 5C3OA 1LJ7A 1PK6A 1IS5A 5A6YA 1RINA 5A6XA 2HBUA 4YGDA 4AYUA 4NHLA 4OUSA 5JOXA 3WP6A 1HXS1 5JLVA 4UBGA 1UNBA 2OUHA 3NSTA 2QQWA 4QD2A 5FMCA 3UESA 1W8OA 2JKBA 2WO1A 5CZKA 1FYUA 2HWE2 3LEGA 2R073 4V1PA 3TNQA 2W94A 1VJ2A 3IDAA 1JH5A 4JKLA 3CJIA 1V6JA 4A44A 3I3EA 1QJZA 3ZXFA 1RUF1 4B1LA 1ZZBA 3J4UH 3UKNA 4RSUA 4LKEA 4AEDB 3GZEA 3LDKA 4Q8KA 3ENRA 5FY9A 1JODA 1VBA1 2PHFA 3WG1A 5FUPA 2X8KA 3RI8A 1Z0HA 5CFDA 3BTXA 4N7IA 1GNZA 1LEDA 3IIAA 3N7MA 4LOTA 4WV8A 4BDVB 2GZWA 1L7QA 3POSA 3O0XA 1AL21 3OTFA 2YU2A 1I9RA 3KZ4C 4PJYA 3CMGA 4BHPA 1H1AA 3FLPA 3CZUA 4CCJA 2AUYA 3GJBA 1JOBA 1MS3A 5LZ6A 4K20A 4KWJA 1RUD3 5FYSA 3ZYHA 3MFCA 4YLZA 3KV5A 3J7NA 1DQ0A 1WCUA 3ASIA 3Q8CA 4IV3A 5T54A 3RS6A 4ZKTB 1LTEA 3A7QA 3IB3A 4XFFA 4Y3OA 2NM1A 3EXUA 1VBB2 2Z5WA 1FMD3 3IWZA 2E51A 1UMHA 3ZR5A 2CWMA 3AJYA 3KV9A 4R52A 1V70A 3JBG1 3ON7A 5L36A 2OA2A 4UW5A 4TLFA 3T30A 4XDOA 3N4MA 2C9AA 1FXZA 4NO4A 2VNGA 1YLLA 5DZEA 2RM22 4W6WA 2D5HA 1RUH3 4AVCA 3H7JA 1ULCA 3VBUC 3ZXEA 3SCGA 5LRRA 5LA9A 1A8MA 2WN3A 3PL0A 4OUMA 5A1AA 4OHWA 4UF0A 2ZMNA 1QWRA 3H8RA 4WM8B 3PIGA 3NAPB 3CL1A 1QXRA 4MYEA 4WVMA 4NN0A 3ZFEA 1V00A 1MS8A 2QCSB 3A0KA 4YVSB 3WW2A 1NLRA 1RUJ2 3OBAA 4CDQC 3VUOA 1K42A 2Q5TA 1CAUB 3HBZA 4QPIB 4RHV3 4ZS2A 5FYYA 3MUY1 1BK1A 5FP3A 2BRTA 5FP4A 1KITA 1WMXA 2DCKA 5A7WA 1OOPB 4DXRA 2WS92 3AZZA 2VCBA 2XL9A 4GULA 1PO12 1ZRRA 1R1ZA 1F5FA 1JMUB 3A23A 4DS0A 4BISA 2IVIB 3N36A 1LOFC 3RFRA 3NJXA 2UYAA 1RUI2 4LBQA 1W8HA 2PHUA 1R093 2XVKA 1AR81 2ZS6B 5CKQA 5FQ0A 2ZGUA 3G6JB 1CIWA 3MGUA 1IPSA 3UK9A 5F7UA 4HK9A 1YQ6A 1E5HA 3I3BA 1CZTA 1QKQA 1RUC1 2BFUL 1ASJ1 1F9KA 1ND2C 2WLQA 4MUVA 4QDSA 3IAQA 3TEWA 2DCYA 3ZFGA 5FO7B 1UXZA 2EIGA 1F4HA 3GYDA 2ZEWA 1A8DA 2J22A 3N7KA 3MIDA 4OFGA 5DDJ3 4NIAA 1PX4A 2JE9A 4AI1A 1UZVA 4E4SA 4D94A 3J8F2 1STMA 1WWYA 2AEZA 1VBD2 3BIWE 1PVXA 5JIAA 2JJ6A 3TN93 4LA2A 5A7PA 1A3KA 1UYZA 2PHXA 2VMHA 1C4RA 1GZWA 1AHSA 3K77A 3KCCA 5IWFA 1HQLA 2QQIA 3AP5A 3MBWA 4CUAA 4V2VA 2DVFA 5L9BA 1RC6A 3SKJE 2B46X 3C7HA 1NT0A 2ADEA 3LOBA 1U12A 1GQPA 3ZMNA 2WZR2 3VDCA 2DCZA 5IVFA 3C7FA 4GH4B 2R0HA 1AR91 1H2NA 2JG8C 2XL7A 3AK0A 4FOYA 4MZUA 1UL9A 4IEYA 4QGNA 4FI9A 2R30A 4RN5A 3VHNA 2ZBJA 5D8AC 4LOSA 1I5PA 1UYYA 4JGYC 4IL7A 1VALA 3WNPA 4J25A 2A3YA 2ZCWA 4KG8A 4XHBA 1ZBA1 3POIA 5C9AC 4LKDA 1HN1A 5EP9A 1LCLA 4UXAA 2GC2A 2R072 1O4YA 2BWAA 2RS11 1TME3 1AR61 4NROA 4AI9A 3ATGA 1ZX5A 2HWD3 4XJWA 3TEXA 4OI4A 4EN9B 3OF1A 5DAPA 2ZZJA 3HWJA 2CNAA 4HN1A 2PTMA 3TEZA 3SNMA 4AEDA 4XUTA 3ETQA 2Q1FA 2XWBB 4E4HA 4TXWA 2EXJA 2V4AA 4LR4A 5T5LA 3S5QA 1E5RA 1ZRDA 1WD4A 2PQQA 4BM8A 1GSLA 1I3HA 4G4FA 4IGPA 4R9CA 4JGZB 1RMU1 5CG8A 3MI8A 4COWA 4QDQA 4QDRA 2ZGSA 2QJVA 4L9BA 3WF4A 1M06G 3E5QA 2BNOA 2R16A 1E57A 1QNWA 1JZ7A 3VV1A 2J42A 2VMIA 3EHKA 3LKJA 3NNGA 4QB1A 4HVQA 2ARCA 3EJKA 1E5IA 1IHMA 3B93A 4K8FA 4GMP3 3WX5A 4XZUG 1RB8G 1LOCA 4IV1B 2F17A 4HFSA 2FMYA 3D0JA 2UWBA 3X29B 1RUD2 3JZVA 2VZ3A 1W9YA 3OCPA 3PUIA 5A7NA 3GJAA 1V0AA 1IQDC 3OGRA 1LGCA 2PHRA 1LRHA 2JDUA 4FPKA 3SQOA 2VPVA 3NV3A 1FMD2 1MZ5A 1S0BA 4BXFA 1Q56A 2WT0A 1AXZA 2XJPA 2XHNA 1W2TA 3AP6A 2FD8A 1G9AA 3AMMA 4AFBA 5I91A 1NAEA 3CQOA 5A3UA 2JENA 2PHWA 3KWVA 4IGOA 1QXJA 4L97A 5HI0A 3MYXA 1K3IA 2YHJA 1XSQA 4Q4V3 3ZSEA 1ULOA 3DN7A 3B7MA 5FY1A 5I8YA 4WBBA 2R1DA 4CEWB 5LEJA 4QU1A 4WM8A 3R6SA 2X5IB 3CF6E 3NAPA 4NRMA 5FMBA 5FYZA 3E5UA 5CFCB 3O1OA 4YVSA 5BNPB 2DURA 3BN6A 4LE3A 1GZCA 5F2WA 5JMOA 1JTZX 3U11A 3AX4A 1CAUA 1LU1A 2EVXA 2OVUA 4LPLA 2YB7A 4QPIA 1LHNA 5FZ0A 3ILFA 1PM4A 1OOPA 1Q5OA 3C3VA 3RDIA 2J1EA 3WQ7A 2RG4A 3DEMA 2QZ3A 2GMEA 1DP0A 4RHV2 3U07A 1UY0A 1WCKA 5FPAA 2C1FA 2OKXA 1F2NA 3AP7A 4XMAA 4DY3A 1ND3B 3AKPA 1JYIA 4URTA 3CKHA 4ZPIA 4XCBA 1D0HA 1CAVB 1H2MA 1W9FA 2VVEA 1GANA 2CU5A 4KU8A 2RE9A 1VBE1 5FMDA 2X09A 5L73A 1UYPA 1R092 3MLJA 5FRAA 1HXS3 1QGLA 2W0XA 4DO0A 2J7MA 2PLV1 5KR7A 3VL9A 4IEPA 2BYVE 1XC6A 4PDWC 4Z07A 2VUAA 3ACLA 4BH9A 3N9QA 4HPKB 5FKCA 1QDCA 4H7LA 2XH6A 5DDJ2 2W2IA 1C57A 2ZGOA 1IS6A 2VTFA 3OUJA 3WDTA 3OPZA 1FOD3 4CYDA 4L8QA 4AFDA 3RYKA 4S2HA 5FREA 3MW4A 3TN92 3MLLA 1JW6A 1O8SA 4QXKA 4Y5SA 2QTWB 4HBNA 1EP0A 3ZMOA 2IZWA 2EA7A 2XJTA 1AJKA 5K0UC 1AX1A 1D4M3 5H9SA 1N3PA 5GZDA 3ST7A 1XYPA 1NYWA 1W99A 3LSDA 2RV9A 4GH4A 3H7YA 4EN0A 2JDAA 2V72A 3W9AA 3OUIA 1MZEA 2J1RA 2XBO3 2XJVA 3QACA 4QXCA 1AL23 3LEKA 2VZUA 2KD7A 1ZBE1 4FCAA 4H14A 5FO9B 2V5DA 4DY5A 2DBIA 4XHXA 4SLIA 4RGAA 1HRV1 3OGSA 3AYEA 1ZM1A 3R4DB 5G05L 3VZJA 4WVWA 2D6OX 3USUB 4NIDA 1KD7A 5BPXA 2DCJA 3OBZA 4IDZA 1H1IA 2AR6A 1UMIA 4AGVA 5F5IA 1LAJA 1OLMA 2E7AA 3POEA 4XE9A 5CVRA 1U5ZA 3I2DA 2ERFA 2VW0A 4L11A 3JQWA 4IQPA 5FYIA 2WA3A 5HCFA 2Q8EA 1YQCA 2HWD2 4BIOA 4BCUA 5FYTA 3ME2A 1Y3TA 3I2OA 3FHAA 3I7DA 2HJIA 2Q30A 5JMCA 3M3QA 2A1XA 3UNPA 1AVBA 3ELNA 4JGZA 2XQRA 2DUQA 1FPN3 4P5YA 1O3RA 2A6XA 4ATFA 1YQ2A 2WWJA 2HEWF 2VOVA 1SCSA 4M0NA 3NO8A 4D6QA 1JZ4A 1J59A 1YYNA 2BGPA 2W39A 4R4XA 1X36A 5AVAA 3VHPA 1X8MA 3H1WA 3O7OA 2G9FA 5F2SA 1M4WA 1S0DA 4QX1A 3FE5A 1POV0 4IV1A 2GNMA 4MH0E 5KHHA 2F6BA 5I0SA 1O3QA 2B5HA 5JZGB 3BB6A 1Q8PA 4DINB 2CYFA 2WFF2 2CDPA 3AMPA 4KL1A 3VD4A 1O4ZA 2IFRA 4IUGA 4PLOA 2RS31 3TNPB 1BMV2 4R8HA 2P6HA 4M3CF 2E9QA 1IPJA 1MS5A 4W8JA 4XUNA 5DG1A 3GDBA 2JKXA 3VBHC 2P34A 1UU5A 1XE8A 2ADDA 5FZ9A 3PVBB 1OPMA 1SEFA 5K7PA 4IEXA 5LASA 3BTZA 4KGGA 4A4AA 1ENQA 3ZYFA 4JRAA 2A73B 3VBOC 1JU4A 4BPZA 3M8LA 5BNOB 4GA9A 5A1LA 5CISA 3N9LA 2VZVA 3LDRA 1LOBA 2HEYF 4MADA 1AYM1 3WDXA 1RUC3 1ASJ3 1V9U3 1W6QB 2IXCA 2WO2A 3A21A 4IEVA 3UJOA 4CEWA 3EBRA 4Q4V2 3GHMA 4UOJA 4G9SB 3PU3A 2X5IA 2ZHKA 5CFCA 4N43B 1OKOA 2YUEA 3SLIA 1CQ9A 4O9GA 5BNPA 4V2WA 3WEZA 4COUA 3HAGA 2Q8CA 4OMCA 4HETA 4QM9A 5EFUA 4B3NA 3B3QE 3AZWA 2C24A 2JECA 2P3JA 3Q8AA 1SBFA 4LE4A 4BA6A 2P17A 1OD5A 4OHVA 4DZGA 1PVC1 2WQZC 1ND3A 4GXLA 1YIFA 2WT1A 1NCQC 2VBBA 4PHZA 5CG9A 2JXAA 1H1MA 1CAVA 1WA6X 1QJY1 4L99A 2DYCA 1SZBA 3FC0A 5FZIA 1KRIA 2FZ1A 1AR93 2E63A 3WLUA 1VBC3 4RQPC 5A7OA 2HLEA 3RJRA 4EWDA 3NMBA 4ZHNA 3ES4A 1CWPA 4XIOA 1HXS2 1DZRA 1H0BA 1UCXA 3I2GA 5FXVA 5AC91 1WMEA 5FDBA 2VZTA 3VKFC 2W47A 4HPKA 1CR7A 4M3CB 3T2QA 5FYVA 5FP7A 4YG3A 3VKLA 4AQ6A 2IXHA 4C0BA 4Z2AA 1BK0A 2DTWA 4YSFA 3ILNA 3WP5A 2BQPA 2E7TA 1VP6A 4UBHA 4TWTA 1NKGA 4MGSA 5EIYB 1KGYA 2RS13 3O1RA 2OPWA 3I49A 1AR63 1AR71 4TLGA 1OC1A 1QJX2 1W0OA 3BTAA 1AZDA 1FOD2 2HWB3 4BK4A 4BQXA 3KHCA 1RUE3 1KJRA 1B35B 2RDSA 2GH2A 3FUQA 5K9YA 2XVLA 4ZZ5A 2WO3A 2BWCA 2QE3A 2OS2A 2XVGA 4RR3C 4BQ5A 4XQWA 3OGVA 5IVJA 1UZ0A 3HNBM 1QOOA 1UD1A 5A6ZA 2QDRA 1RUOA 1D4M2 2A3XA 4MLOA 1RMU3 4YNIA 2HKXA 4NHMA 2VQ0A 3RYPA 1ULEA 2YV8A 1R1A3 2AEYA 3IMMA 4YGBA 1MPXA 5FPVA 3SITA 4XEZA 5J7MA 3B9IA 2XBO2 1W8TA 2BUKA 1UF2C 2LM3A 3A0NA 1B09A 3AL5A 4D8MA 3USUA 3I3DA 4K3UA 3BCWA 3JU9A 2RR11 1BZWA 4UAPA 5GLVA 3GBGA 4NRQA 1D2SA 1JUHA 1O5LA 4XUPA 1R64A 2Y6FA 2D97A 3VDDC 3L9JT 5LW9A 4NIGA 3K4ZA 1W28A 1D4VB 1J58A 1GKBA 5CIRA 2GNDA 1YO8A 2NYYA 5F5QA 4KBBA 4AVTA 3D6EA 1Y9QA 1O5UA 5EYYA 1ENRA 4XFAA 2JWPA 5A80A 4WZCA 2WZPP 1W06A 4JDMA 1SDWA 3ZKUA 3N9MA 2V09A 5KWRA 1J3QA 4CEYB 1ZRCA 5KHJA 3JXSA 1W6MB 4GJZA 4CE8A 1U5IA 5K4LA 4N9IA 5E88A 1FPN2 4B7KA 1H2KA 2Y26A 2VCCA 3U1XA 4LXLA 1PX3A 3JD71 3VZOA 2VJXA 3VD5A 1JYTA 3VZLA 2MPFA 5EZWA 4FAGA 4PT6A 3BIEA 2NMNA 2Q1MA 3VLBB 2R041 1XU1A 5JZGA 1OVPA 1WCQA 4KMQA 4YZ2A 2MHFA 2DF7A 4LBLA 5DQ0A 3H50A 2G1MA 5D1IA 1ZZ8A 4IESA 2WQ4A 3DYPA 4YM2A 5LK5A 5JVVA 5JAXA 2QQKA 2XGXA 2JDYA 3GCXA 2VZSA 2DVDA 4PIXA 3QH7A 4QX3A 4A2UA 3C8XA 5D2AA 2JE8A 3GHNA 2QQJA 1DZTA 2Y33A 3LIGA 1US3A 2NZ9A 4XOGA 4BQWA 1CPMA 2VXRA 5HXMA 1CZVA 3KLSA 2ZX2A 1OFNA 1VRH1 3AZXA 4LIUA 5FZFA 2EXKA 4Q4Y3 1GYKA 1C1LA 5BNOA 3LEIA 4LLOA 4BQYA 1JU3A 2RJLA 4IE7A 3INAA 1JXNA 1VBE3 5CEHA 2XMLA 5FP8A 1V6OA 1XQNA 3IKWA 2Z79A 1WMDA 4NAOA 1UPIA 1W6QA 4A42A 4O7XA 2W3JA 5JXGA 4FP3A 1RUC2 5FZ6A 4YW6A 1ASJ2 1V9U2 2H6CA 4N43A 3V0BB 5EJ1B 5FZ4A 2HEVF 3CLPA 1Y43B 2LW8A 3WP3A 1KFXL 3RZHA 3MIGA 1UWWA 2RS53 3ZDVA 4AEKA 1XYOA 3OEBA 2CGPA 4TN7A 4C0HA 1W3XA 1DGLA 1X82A 5L19A 4X6QB 3LZZA 3N7LA 3UV9A 4CCDA 2KM2A 1SQ4A 2D3SA 2WNEA 2O0OA 4CCNA 4EN8B 4UFMA 4AI3A 3WDWA 3D4KA 1SPPB 2NLRA 5FMOL 4JTNA 5FPUA 4CTEA 2DUPA 3ZFFC 3OB8A 2MEV1 2WNUC 3OPTA 2SLIA 4QPGC 5HV4A 1JYWA 4K8RB 1XNAA 5BYNA 2LUWA 3ACFA 4P9JA 1R081 3I97A 4LO7A 3NJVA 2ZAAA 3O0VA 2ZEYA 1ZBE3 1AR92 2GNBA 1S4CA 1VBC2 4JQTA 2VH9A 1X33A 1XU2A 4M3CA 4Y24A 2Y0OA 1PIV1 2QVSB 3P5BA 3KF3A 3GALA 4NWVA 4UFJA 3HQUA 3MV11 4LBJA 1ZZCA 1NA1B 3NVCA 3OBRA 4AQTA 5T5JA 4DUVA 5C4WC 5JUVA 2YROA 3OOXA 5LA2A 3VL8A 2EIBA 5FZ7A 4Z1VA 3ACIA 3V65A 1NX9A 3MW2A 2ZACA 3U75A 2RS12 1AYN1 4NIHA 3U0ZA 1AR62 4C90A 4K1ZA 1RXGA 1B35A 1OD3A 5FWJA 3NNFA 3NJYA 2HWB2 1RUE2 1N3QA 1QIQA 1F15A 2J1UA 2WZEA 4N8MA 2XR4A 5GLZA 1RVF3 1WW7A 4AR2A 2LS6A 2W1WA 2WFPA 4I01A 5FZDA 2J1VA 2UWCA 1N1TA 4Q5OA 1RMU2 2YDEA 5FPLA 2Y38A 1BBT1 5K8SA 4AK3A 3H9AA 3ORJA 1R1A2 2C0ZA 1JHNA 3LD8A 4GWNA 4MGIE 3I3MA 3ZXLA 5EXOA 3C7OA 1EPZA 1UKRA 4HXCA 5I8SA 4KBZA 4XXPA 1HB4A 2A6VA 5A3TA 5AVPA 1NG0A 1TEIA 5L9RA 1WKYA 1ZZ6A 1TZOA 4QQPA 4CUBA 2E32A 4EV0A 4KNCA 1O3TA 2RMU1 4LHSA 4MHRA 4XF0A 4XMIA 1TVGA 5FPBA 2QQVA 1TMF1 4XQDA 3ZSMA 4UFLA 1UY4A 5A3WA 1LU2A 1VPHA 4P9WA 3WXPA 4A7YA 3S6PA 1F31A 2CTVA 4JAAA 5C8WA 3NJZA 3SKVA 1MEC1 4FT8A 1O4TA 2PAKA 1F4AA 2Y60A 3S7EA 4CEYA 2YBKA 4FOQA 1PGSA 1VIWB 1W6MA 1EPWA 2GP3A 4NVPA 4OCTA 5ABJC 3HPNA 3H0OA 5HBAA 4RGGA 3F95A 2XB6C 4D7SA 1DCSA 4HN0A 3WNXA 3ZN4A 1NQJA 1GWLA 4FPJA 4H2AA 1EV13 4P5HA 4QM8A 3VKNA 1GFF2 2BDRA 4AXOA 1BVP1 2VW2A 5FZOB 4QMAA 2DVGA 3IDEA 4Y1XA 4DMIA 3RNSA 5JXHA 2ETEA 1GOHA 1YXWA 3WHTA 2WJSA 4LO5B 1QF3A 4DB5A 1JI6A 4UFIA 4E4ZA 4CU6A 4YW1A 5HCAA 4S2GA 1ZZ9A 3BUCA 4H3WA 4E9KA 1OSGA 3QD6A 3ZR6A 1GBGA 3AFGA 1PMHX 3DPRC 2OT7A 4QXBA 1SCRA 3ZSKA 4AHYA 4XJ9A 3GBFA 2A6WA 1NZIA 4BU2A 1N1VA 4XFCA 4QB6A 4NHXA 3OJBA 3VBRC 3ZXJA 2JDPA 1FT9A 1QJY3 1AX2A 3ZYBA 2ATFA 2WIIB 4Q4Y2 5T55A 3WQBA 2VOTA 4ET7A 4NMIA 4FPLA 2R1BA 4CUGA 4BQ4A 2E53A 1VBE2 2ZHLA 3SH5A 3I59B 2GNTA 5C5UA 5FYHA 3UT0A 1YIPA 5EQUA 5AC93 1XNDA 3V0BA 2F4LA 4LIVA 1JN2P 4YW5A 3GXUA 1ENXA 3T3YA 1W9TA 4LHLA 5CKMA 4PI0A 3AP9A 3ZYRA 4E27A 3F2ZA 5C6CA 4JDNA 1XNTA 2V73A 2ZTNA 3WD5A 4YW2A 4N9HA 3UGHA 2RS52 1UY2A 1AR73 4E2GA 5IW0A 1XYNA 3D5OA 3K75B 4XTPA 1OI6A 3DF0A 3IDBB 4C8DA 5FUIA 2FDHA 2VCAA 2GN3A 1SPPA 3UKTA 3ZX7A 1WCDJ 2B9VA 3EYPA 4ORFA 1QJU1 1CVNA 2XHKA 2ARAA 2FZ2A 2D6PA 5FV3A 1OLQA 3PIJA 1PK6C 3GZUC 2FCVA 1XRUA 1G6NA 2NMOA 5A3LA 5IK4A 3GZTB 3RGBA 1L7RA 3ZIWA 2OZJA 2PQSA 3AB0A 4UI9L 5FZHA 3JB8A 3CO2A 5BXXA 1YQ5A 3NV2A 1SLBA 3T0BA 1YI9A 3Q9OA 4H7MA 1F8VA 4PF1A 3T1LA 3KD4A 3P3NA 3W58A 1ZBE2 3I54A 2RR13 2NQYA 3R05A 1VB4A 1NA1A 3T09A 4L0PA 4MXVA 4INDA 4XF9A 4QGMA 5FZ8A 1C28A 3MFAA 2VECA 2WNVB 1Z78A 4A7ZA 4B1MA 1RUNA 3CJIC 1HB1A 5F8PA 3ETPA 1DYOA 2HYXA 1QJEA 2CWSA 3PVOA 1W03A 5C3RA 3RMXA 5IK5A 2HWC1 2YC4A 2EAAA 2W1QA 4GD4A 4U36A 1PZ9A 4G3YC 4RS5B 5LBFA 1GU3A 4WVZA 5L7OB 2HWF1 4CUCA 2FDIA 1MQTB 5F9TA 5CFDC 3KS7A 1J3RA 4LO6B 3TB0A 4GALA 2OX0A 1RVF2 2DDUA 5F5AA 5JSOA 5FYBA 4FOVA 2W68A 5CADA 2VZ1A 1POV1 1EAH3 1RJ7A 3MDPA 3APBA 4LLFA 5CU1A 4HOOA 1UMZA 3GM8A 2DUOA 3OYWB 1NZCA 1PO21 3OEAA 4ZU4A 2VNOA 4Y1ZA 3WNLA 3CHXA 3WF1A 3ITQA 3AC0A 4ISRA 4XW3A 5BNNB 1JYCA 2Y6JA 1TNRA 3SC7X 2IC1A 3H8XA 4JKKA 5E16A 5EJZB 2IVJA 4IV3C 1CGPA 4LBOA 4XURA 1T6BX 3KF5A 2TNFA 2E31A 3N9PA 5C3QA 3DYMA 5IFPA 3KM5A 4Q4X1 3LDBA 2KA3A 3J7MA 2YGLA 3RZLA 2GU9A 1ZREA 4EROA 4CCCA 4Y33A 3LGRA 1VRH3 1FX5A 4FBFA 3S30A 4YARA 5FIXA 1G9FA 2NP0A 1X9TA 2VMEA 3IPVB 5C8CB 4K7JA 2TUNA 3WV6A 4LK6A 2W92A 2XG3A 1VAKA 4ITCA 4D6SA 1H8TB 4DEQA 4ARYA 3G7DA 3GCWA 4EZHA 1A6CA 2P3IA 5ACA3 3O1MA 1EUUA 5KHGA 1YFUA 1PGL2 1XE7A 4EZ4A 2VUDA 2FDFA 4XQ4A 2XLGA 5FZOA 1EV12 1RITA 5FY4A 3HR9A 5T5PA 4I02A 4QX8A 4ZY9A 2JICA 3ZN6B 4OHXA 2GP5A 3C7GA 4ONUA 4LUKA 4XJZA 4OHZA 3ZFEC 2WAAA 3WNNA 5A3PA 5CYYA 5C3SA 4JKMA 4A7KA 3PUQA 4P9GA 2ZGQA 3N7JA 5A7QA 1H9PA 5FJHA 2C26A 3KQRA 3EMRA 4I30A 4XBNA 2Y6LA 2Z2SB 3AVSA 4XPVA 3L2HA 5IAXA 1DQ5A 1NQDA 1QDOA 3BPZA 3I8TA 1IGOA 3KHBA 3VBSB 4AEJA 4AVSA 1GLHA 4Z8BA 2GC3A 5IUQA 4Q4W1 1OA2A 2XUEA 4UYBA 2B9UA 2MEV3 5CBLA 2ENRA 4WM7B 2N7GA 3PURA 3SHRA 5FBJA 5FR3A 4LUMA 3MUZ1 4HKOA 4R9BA 5LK7B 4GWMA 3VBFB 2H6BA 1W6NB 5DZGA 1QJY2 1YNAA 1RUH2 2Z42A 5I0TA 4Z92B 2ZGNA 4PLNA 3I59A 2BNMA 1QOTA 1GR3A 2XXZA 4DPNA 3IDCB 4A3ZA 4F83A 4JQRA 3ZFGC 5KXBA 1Y9MA 4GB31 5AC92 4CDWB 1EYBA 1K5MB 3M4FA 4QHZA 3ZO0B 1W39A 1HW5A 2WUHA 5F3GA 4BWOA 1U0AA 1W2NA 2XJQA 5KC6A 4KH9A 1ZVFA 1AYN3 1AR72 1H2LA 2HH9A 1ULFA 4AVAA 1DHKB 4HVRA 5JPNB 4BXSV 4YVWB 2ID4A 4XDQA 3ZKYA 3LOIA 3ZYIB 3VD9A 1UPSA 5J96B 3J26N 4MGKE 5I8TA 1NCRB 2VOKA 1WMFA 2QNKA 4KI5M 2WR9A 3VKMA 2WNOA 5IVEA 1UAIA 4Y22B 1ODNA 3T4VA 5DAWA 1Q3EA 3POBA 1AJOA 3HN3A 4COVA 1BBT3 1CIYA 3IMNA 4YGEA 5IATA 3ILRA 2GSYA 1EY2A 2PMWB 1SLTA 3ZYPA 3KVAA 3NRUA 3POYA 4JCKA 1C8NA 4QQLA 5FY5A 2RM21 4M01A 2JDMA 2DBNA 2RR12 4ASLA 2YBSA 2WNVA 4D0QA 2D40A 4NAMA 1DLCA 3BI3A 2D7FA 1RUF3 2UWAA 4Y1UA 3RMYA 5BY5A 1TMF3 3E97A 4FPGA 3MLKA 3KCYA 5E1RA 1IS3A 1W8ZA 1VBA3 1IQAA 4AEDC 3DYOA 3WSOA 4CCKA 4YM0A 4BK5A 4RS5A 1J1LA 1WBLA 2FDKA 1RUJ1 4NHKA 5L7OA 4J1XA 1DGRA 1MQTA 3BALA 5FLIA 4NUBA 4BIFA 2G19A 5FY8A 1SACA 1QY4A 4FAHA 4NPMA 5FY0A 4C1WA 2YPDA 4EWEA 2O8QA 4FSJA 2O14A 5JR2A 1J84A 1DGWA 1G9DA 5A70A 5LCWL 3OYWA 3K4DA 1EAH2 1GOGA 2VMCA 1S1AA 3PJQA 2FMDA 1NXMA 2CAVA 1HRI1 5BNNA 2O8OA 3DGTA 2FQPA 4LO4B 5IVYA 1ALYA 1KS4A 2VD7A 1JYXA 4P9XA 4N53B 1LOAA 1Z7S1 5SV5A 2D5FA 1TME2 5J37A 3AFKA 3W20A 3W59A 1XPWA 2Q8OA 3BU0A 1ULPA 5T50A 3SCFA 3U78A 1JZ3A 1JZ8A 3JBG3 4IEOA 3UYJA 3FFZA 4PBPA 1DG6A 3FFQA 3LA2A 4XXAA 1W0NA 2P3KA 3WP4A 3J9SA 3J8F1 5FYUA 2JG9B 4HT1T 2ZGLA 1VBD1 4Z2WA 4QKDA 2Y34A 3IPVA 5HXVA 4MXWB 3TBDA 5C8CA 1VRH2 3R4SA 1S0EA 4Y4RA 3LA3A 1H8TA 2W08A 1OURA 4J6GA 1UN1A 4P9LA 4XIKA 5L9VA 1UIKA 1SG3A 2RHPA 2ZAHA 4JZRA 4F7ZA 4FTEA 3MW3A 2LTNA 1LHWA 3O12A 2QKDA 3OPWA 4M4RA 2BOIA 5ACA2 4CDUB 5JXJA 5M0TA 3SXWA 4FP2A 2WZR1 1HV1A 1RJ8A 3FHQA 3ZN6A 4WM8C 2P6CA 1K45A 3NAPC 3WOGA 1QHDA 4E2QA 1SFYA 4CCEA 5IFTA 5DXDA 2GMMA 4YVSC 1GP6A 3CBNA 3BKZA 3WVJA 3HNMA 3OBTA
chains in the Genus database with same CATH topology
1NY71 2D6LX 1SBEA 1OOPC 1YFWA 3RSJA 3VBSA 1CAWB 1W2UA 3I4IA 3VZNA 3WUDA 1CN1A 5JI9A 4ATEA 2PHDA 3OGGA 2A3WA 4PBOA 2R071 4WM7A 2YMZA 1CD3G 3ZPYA 1AR83 4AVVA 3PJYA 4YG6A 1TQ5A 2MEV2 3VBFA 4IEZA 3OY8B 5JSOA 1NE4A 1W6NA 1YJLA 1H4HA 1ULDA 4YYOA 5JIUA 1ONAA 1IKPA 2D6KA 3H3ZA 5GZEA 4XZPA 4XJ8A 4E4DX 4XTMA 3U10A 2BTVC 4RL7A 1KJLA 4CDWA 4Y1YA 1K5MA 2EXIA 3HMYA 3QH6A 1WLTA 3TAYA 5DUVA 1GQHA 3D82A 3MIFA 3FX3A 3TRSB 4PLMA 2XKPA 3O14A 3UL2A 4LBQD 1H9WA 3LA7A 3WG4A 4CP0A 1CJDA 5GJ6A 2DU1A 4X6RB 5DUXA 4YVWA 1MR5A 5JR7B 1AYN2 3B01A 4Q2FA 2VQAA 2VW1A 2HWC3 4J1WA 3V64A 1ENSA 1MZ6A 2TEPA 1NCRA 1C5IA 4O9EA 4Y5Z0 4AWDA 3ZYGA 5EV7A 1V6MA 4JRLA 3GBWA 4GH4C 1MVEA 1MS4A 4Y22A 4COYA 5JSPA 5GLWA 3NL1A 1POV3 4QHBA 4ZXKA 3B94A 4Q27A 3JB4C 4AFAA 3BOPA 2BEOA 1BBT2 1QQP1 3FJSA 4YG0A 2DCTA 5DZFA 1ZBA3 4WVVA 2JDZA 2BVBA 4XF3A 3U4XA 3VBUB 2EAKA 3WCRA 1X8EA 3L2YA 3V0AB 1C8M1 1RUF2 2VOWA 3FMGA 4Q4X3 4Y26A 4DOUA 1TMF2 2DV9A 3RZZA 1QXPA 4IETA 1VBA2 4Q26A 4Q0UA 4RFT0 1DQ1A 4CDQB 4PQ9A 4JGZC 1YFXA 1XNCA 1QU0A 4AI2A 4RHV1 3WQ0A 5T5OA 1AL22 1WD3A 3WUCA 2G9GA 1CESA 2BVVA 2OPKA 2XJSA 2EXHA 3RPQA 1S0GA 2ZX3A 3MF9A 4IV1C 2DU0A 2ZGRA 4N53A 5IK7A 1R091 2YZ4A 4C91A 5SV8A 1W0PA 4QQ2A 1LULA 3CEWA 1NE6A 3WQ1A 4LO8A 1ND2B 2G4IA 4LTAA 4P9IA 3M2MA 1A78A 1IPKA 2V5YA 3JBG2 1UZZA 1Q8SA 2JG9A 2OUJA 4Q4W3 2ARBA 3CNAA 4MXWA 1ZRFA 1MS9A 5I0RA 1WLDA 2NN8A 3TN91 1OA4A 2QZ2A 3ZXDA 3R0RA 4HSLA 3H8UA 1DBNA 2A5ZA 1LR5A 4CDUA 4XFHA 1X7NA 2ZA9A 5GKAC 4CEWC 3AXEA 2X5IC 4GB33 1G7YA 3B00A 5CFCC 3OD0A 5B2GB 1UZYA 2DFCA 1F5JA 2E6VA 5BNPC 3QOPA 2JG8B 2SBAA 3MF6A 1PNGA 1OA3A 4NR1A 4YRDA 3RRDA 4AG4A 3ZIXA 2CAUA 2X53S 5D8AB 4AHWA 3P3PA 5LEKA 1V6NA 1CAWA 4JGYB 3ROUA 1MACA 3NWKA 3URFA 5C9AB 1ND3C 2C5DA 3MEPA 2ZHNA 4Z82A 2FBEA 1G9CA 1RL3A 3OY8A 1Q8QA 5I93A 1BQPA 3AYDA 1AR82 5AFEA 5J09A 1SMVA 3KGLA 4YZ3A 2HWD1 3NV4A 4YZ1A 3V56A 2K9ZA 2PLV3 3WDUA 2WA4A 4MGYE 3M3IA 2YC0A 2PAEA 3GNEA 1ZZ7A 1N1YA 2F4PA 3LCPA 4LEJA 5H9RA 4XBLA 2DVBA 4K40A 1LEMA 1SBDA 3AMHA 4QU2A 4M00A 4AGGA 1RIRA 2DWRA 1BKZA 2AGSA 1GNHA 3AXDA 4D69A 1HX6A 2YXSA 2CGNA 5GZCA 2VOXA 2GC0A 5CAZA 3BOWA 4I2OA 4YGCA 5A3MA 3E6CC 4IEWA 5KC5A 4KGQA 3WY6A 5FOBB 1HLCA 2TBVA 4GMP1 4YW3A 4EN7B 1COV1 2WFF1 1KXGA 4YM3A 3S0MA 5GZFA 2MNGA 3PVEA 2VMGA 3M3CA 4AHZA 4Q0QA 1PGW1 5T3NA 1HRV3 2WLPA 5JCTA 1O3SA 3OD4A 3WDYA 4FXKB 1LODA 2YY1A 1HRI3 4D7YA 1S0CA 1ZBA2 3B5LB 3BU7A 4HSJA 1C3HA 3M1HA 5KXCA 4KWLA 1Z7S3 2GDFA 3VBUA 4FPYA 2YPJA 3V0AA 2B8MA 3H3UA 5KXDA 2O1QA 2ZGPA 3DV8A 1APNA 4X8NA 4LA3A 3JUUA 3THPA 3ZSJA 2WWSA 3LWCA 4HZFA 4Q4X2 4XBQA 2K0GA 4BYYA 1DQ4A 3MIHA 4CDQA 1VBD3 5JI7A 3QCWA 3N3HA 4LT5A 3KMHA 2GH8A 3VZKA 4QT6A 4OZXA 2D3PA 1LOFA 2WT2A 3AZYA 2A6ZA 4AFCA 2JE7A 4OULA 4B4PA 2GC1A 5JZGC 4OI2A 4AF9A 5IK8A 1LHUA 2RS33 2H0BA 1DQ6A 1SLLA 1ND2A 2P37A 3CJXA 5JWPA 1WBFA 4PDWB 3KCXA 4AEMA 4HKWA 1XXNA 1CAXB 4LNVA 1WW4A 4Q4W2 1Q43A 5BNOC 2I74A 1QJX1 1FOD1 1XNKA 1AYM3 2GAUA 3VN4A 5TSWA 3WW1A 3SCHA 4FQZA 4XJAA 3PLQA 2PYTA 2P2KA 4CDXC 5K0UB 1AXKA 2WL1A 3ALQA 4CZSA 5J36A 5FPXA 2D43A 2GN7A 4N43C 1D4M1 2PFWA 2BW8A 3B02A 1AF9A 1MVQA 4GB32 2ZGTA 2JG8A 1VAVA 2VY0A 4AGRA 2XBO1 4PCRA 2UYBA 4XFGA 2PHLA 5D8AA 3SH4A 1LHVA 4JGYA 2R061 1G86A 1WA4A 1PVC3 5F1RA 4R9DA 4LULA 4PF5A 3ZDSA 5C9AA 1IOAA 1TE1B 2VG9A 2VVFA 2B7YA 2DTYA 3DUIA 3KSCA 4ES9A 2IXIA 4EN6B 3KT4A 3WINE 4QX5A 2AZ5A 2JX9A 3ZXKA 2PLV2 4UW6A 1W6OB 1QQP3 1FI2A 3AMQA 2ZGMA 4I0WB 4PIYA 5BV6A 1DQ2A 1QNYA 1FNYA 1FPN1 3NKTA 4FPCA 3K48A 3MPBA 2R32A 4TZDA 3VHOA 1RUG1 2YGMA 5FFOC 1C8M3 2WSVA 1WUVA 2OYZA 1YWKA 1B35C 1BYHA 3D0SA 4XFBA 1C1FA 1DYPA 1V6IA 2VU9A 4DXZA 3SH3A 1OHFA 1AL0G 1VR3A 4B4QA 1WGPA 1O7FA 4FXGB 3RJ2X 4IERA 3ZVXA 4Y20B 4R9AA 3GF6A 4B7EA 2WSUA 3VBHB 2QDNA 1I1EA 3MICA 4LHNA 1REFA 3KGZA 4I3PA 4IEQA 4F8AA 1HRV2 3NW4A 2D6NA 4M3CE 3FHIB 3WG3A 1T6GC 3VBOB 4JV4A 1DGWX 4A3XA 3NV1A 1HRI2 1KQRA 3FUOA 2R49A 1N1SA 2BNNA 4JVAA 1HKDA 1Z7S2 4WZFA 2AH2A 4YW4A 1JOJA 1V9U1 1YI7A 2XKOA 3EO6A 4ISQA 4CEYC 2PHTA 4GMP0 4S2FA 3H1MA 3PMEA 3T2TA 1PM7A 2IXLA 2IWGB 4L92A 1PZ7A 1LENA 2ZMLA 3JD73 5DUWA 2ZPXA 5H9PA 5JVVA 4BIFA 1BEV1 2BFUS 4QPYA 5FOJB 1S0JA 3NKGA 4CP1A 5J48A 4NWWA 3RYRA 4HK8A 1RHI1 4AHXA 1REEA 1V6KA 1YRZA 1NCQB 3KB5A 2R043 1OQEA 3HQXA 3RI9A 1REDA 2VUJA 5GLTA 3HT2A 1FV2A 1MS1A 4RQPB 1C5HA 1VBC1 3IN9A 3PVNA 3SISA 2RS32 3AMNA 1DIWA 3LAGA 4HANA 1H8VA 1KFUL 4PDWA 2XJRA 4GQ7A 4QGLA 3CU7A 4B8EA 1LHOA 1NY72 5AFBA 1CAXA 5GLUA 3JQXA 3FBYA 5J3UA 1U5XA 3FLTA 4JTOA 4XILA 3RQ0A 3UJQA 1IKQA 2IFWA 3WT3A 2KXLA 1DF0A 1HIXA 5CB7A 4Q1PA 2OW4A 4LHKA 2HWB1 1AYM2 2LALA 1RUE1 2B39A 2A70A 2CL2A 2DVAA 2UY8A 4R4ZA 4RR3B 5K0UA 2IXJA 5EJ3A 3DKWA 2Y0IA 3N35A 2UURA 2AYHA 4RA0A 2ES3A 4NOTA 5EYXA 4QQHA 4AQ2A 3M70A 1OPOA 1FAYA 4P14A 2K2SA 2ARXA 1TNFA 2RJKA 1OQ1A 1R1A1 3DL3A 2X29A 3WR0A 4BQ1A 2HWE1 1N3OA 2PA7A 2ZZQA 4SBVA 4Q0VA 4TSVA 3IBMA 1J1TA 2ET7A 1COV3 2WFF3 1PVC2 1WW5A 4XFIA 4L2NA 1S0FA 4U2AA 3VDDB 3WW4A 3ZN5A 1UKGA 1QH6A 1R083 2A6YA 5I0UA 3AKTA 1SLAA 1FV3A 4BMBA 2Z69A 2GALA 1PIV3 1W6OA 4BE3A 3KT7A 3HN1A 1OLRA 5FTTC 1QQP2 1NA1C 1OFSA 3AZVA 3USSA 1LESA 2HYKA 1YUDA 5KBFA 1KDKA 3RG0A 3TYJA 2VNRA 1C8M2 1X50A 2ILMA 4HMZA 4AFMA 1VBB1 4YFWA 5EWSA 4MX3A 4Q0PA 4Y20A 2Q0AA 4Q1RA 1LGBA 2IXKA 3VBHA 2D3RA 2ZX4A 3ECQA 3B69A 3ZSLA 4BLJA 2D93A 2ZOEB 1S2BA 3VBOA 4FTBA 4Q4Y1 4LBNA 4PIZA 1S2KA 3AJZA 3M3EA 2RMU3 4KQ7A 1S55A 1OKQA 3C2UA 3WHUA 4JDOA 3MPPG 1DFQA 4Y1VA 2VULA 4XF1A 1HV0A 3MZHA 2FHRA 1URXA 1MEC3 2JEMA 3IM0A 4AW7A 5FCCA 3OGJA 2RS51 3LSEA 2E7QA 4OI0A 1QJX3 2WS91 2YYOA 1PO11 4UW4A 1G8WA 1I5ZA 1YHFA 1VB2A 2ZABA 1IS4A 2VVDA 1WLCA 3HD8B 3JD72 1RUI1 4XMAA 3ZFFB 4Q8LA 3AKRA 1NCQA 3FWEA 2ZMKA 2WNUB 4QPGB 4META 4NPRA 2AREA 2CY6A 2R042 4RQPA 3LB9A 2EALA 4K21A 3AKSA 3SMHA 1YFYA 1N47A 2AENA 3O5SA 4OLLA 4F3JA 1AUYA 2ZJCA 2EF6A 2R063 1NLSA 1WW6A 2UY9A 3PNAA 1UIJA 1JBCA 2WINB 5FBZA 1HQWA 2I07B 5C4WB 4KWKA 3AYCA 4YFZA 5BUVA 3ZXAC 3ES1A 1FATA 2H0VA 3UKVA 3AKQA 5A33B 2VGDA 4KU7A 3RWNA 1UU6A 1BJQA 4RR3A 5JOWA 3IT8A 3THTA 1QMJA 1W6PB 3POWA 4YZ4A 2BPA2 1D2QA 3E5XA 4S2DA 4K9SA 3PTYA 1PZ8A 1RVF1 4FVVA 4I09A 4QPIC 4CP2A 2ZHMA 1VLNA 1CONA 1RUG3 4Q0SA 3GZAA 4MV2A 3TOJA 2BGCA 1O91A 5FLHA 1QJU3 4YM1A 4UW3A 2XLAA 4Q29A 3VDDA 2CV6A 4HVOA 3M3OA 1COV2 3B9CA 4LBKA 5T52A 4W6YA 5JOZA 1R082 3FLRA 2W52A 4BMEA 4I3GA 2ZGKA 1PGW2 4W65A 2D6MA 2UU8A 5FAXA 1PIV2 5JOYA 5ABJB 2XLFA 2WNVC 3PHMA 4GKXA 4IEUA 1XNBA 3FBMA 1PGL1 5F6LB 3H1YA 1DYKA 4FQ4A 4GKYA 3O0WA 1UW8A 1EV11 4XETA 4CRQA 2QFEA 1GV9A 4CDXB 5HCBA 2I45A 1RUD1 2ZX1A 4HKLA 4RS5C 5F6KA 2HWF3 2ET1A 5L7OC 2PELA 1MQTC 1JUIA 1FMD1 4HLTA 5KHKA 3DPRB 1BVVA 1BEV3 2OZ6A 4K6BA 3VZMA 1LGNA 4XYXA 5KXEA 1PO23 1RHI3 3BODA 1PMIA 5GZGA 4JC1A 2OIIA 3VBRB 1ZNPA 5JSRA 3S7IA 1OQDA 2A7AA 4XJUA 2A75A 5BNNC 2WC2A 5DUUA 4IXLA 1RUH1 2R0FA 4AQSA 1BXHA 1Y7BA 2R6QA 3EQEA 1QOSA 4Y4YA 4DRRA 1S0IA 2RMU2 4AVBA 1L3JA 3AM2A 1I6XA 1NXD1 2XJUA 1MEC2 1KDMA 2ZKNA 5J98B 5C8CC 4P9YA 1H8TC 5A32B 3AP4A 4D7TA 4DFSA 3A4UA 2BBVA 4BLIA 1WCSA 4EWAA 3ZFFA 5GM0A 1AX0A 2WNUA 1H30A 4QPGA 1PK6B 4DRVA 4DQAA 1LKNA 1SLCA 5FLJA 3JCIA 4HL0A 5FO8B 5E89A 4AE2A 5DG2A 4FO9A 3ZYJB 2D98A 4H55A 3WDVA 4ZU7A 1CX4A 1OMIA 1LECA 1SLIA 2HWE3 1RTVA 5DDJ1 4M0HA 3VBSC 2R062 5C4WA 3AYAA 2WKKA 4WM7C 4D3WA 4I0AA 2JD4A 4ES8A 1ZYBA 3VBFC 1MS0A 5A33A 3CJIB 1CJPA 1J3PA 1GZ9A 3WW3A 3HT1A 4OHYA 3FZ3A 1Q8VA 1W6PA 4AI8A 4QQOA 3R4UA 4ASMB 1G9BA 4BZ4A 4CDWC 2XWJB 1K5MC 2NPIA 5CFDB 3MIEA 5H9QA 3VKOA 1HDKA 5GALA 4B4RA 4XF4A 1QH7A 3VHRA 1LOEA 1EAH1 1RUG2 4YVWC 1ULGA 4TYSA 3VGIA 2GMPA 3WZ1A 1UX6A 1QJU2 1AXYA 1V6LA 1GQGA 1TME1 1NCRC 4IV3B 1VBB3 3PMSA 4C1XA 5JDBA 3WCSA 5JPMB 3K51A 2QQPA 2D44A 4LBMA 2PAMA 2RM23 3QBQA 3E6BA 3KT1A 1YCIA 5ABJA 5FPZA 4YZ5A 1VAMA 1DLLA 4N90A 2B42B 4MGZE 3T1MA 4E2SA 1DDLA 2QUOA 4ZU5A 2ZX0A 5ACA1 5LRSA 2PN5A 2B45X 2ZKLA 4CDXA 1FNZA 4COZA 2Q1ZB 4MVTA 1RUJ3 2CGOA 2HWC2 4WVMB 4OI1A 5KHIA 3TWIA 4GIQA 3ZFEB 1BCXA 1BMV1 4K1YA 1DZQA 4N7UA 2HWF2 3QLQA 4RD7A 2WS93 5C33A 4W6XA 1PO13 4OVEA 3DPRA 4FTSA 1CPNA 5CA6A 4FPFA 4I0BA 1MZFA 1DU3D 3MIBA 1U5YA 4FPHA 1RUI3 4BOWA 4DNYA 1BEV2 3VBRA 4B29A 4KG0A 4X8PA 1PO22 1RHI2 4LBQB 4EJRA 5BNQA 1LB2A 5E8AA 5IT6A 4N53C 5FQ0B 1H4GA 1YJKA 5CNAA 4Q4V1 1ZA4A 1PNFA 1RGSA 2A71A 3E6DA 1GICA 1Q8OA 3ZFGB 1KS5A 5FMOS 3J8F3 4FPEA 1D0GA 2JG9C 1IZ3A 1DGRN 1LOGA 1SFNA 2XUMA 1UU4A 1WLWA 2Q4SA 5A32A 2DFBA 2XPJA 1HQNA 1GZWB 2I2SA 3D8CA 4MSVA 4FPOB 3ZXGA 3M7AA 4AI0A 1PHMA 2WZR3 4CDUC 4FOWA 3HIFA 1NOVA 3WG2A 1LJ7A 1PK6A 1IS5A 1RINA 4YGDA 4AYUA 4NHLA 4OUSA 5JOXA 3WP6A 1HXS1 5JLVA 4UBGA 2OUHA 3NSTA 4QD2A 2JKBA 1FYUA 2HWE2 2R073 4V1PA 3TNQA 1VJ2A 1JH5A 3CJIA 1V6JA 1QJZA 3ZXFA 1RUF1 1ZZBA 3J4UH 3UKNA 4RSUA 4AEDB 4Q8KA 3ENRA 1VBA1 3WG1A 2PHFA 2X8KA 3RI8A 1Z0HA 5CFDA 4N7IA 1GNZA 1LEDA 3IIAA 3N7MA 4WV8A 2GZWA 3POSA 3O0XA 1AL21 3OTFA 1I9RA 3KZ4C 4PJYA 4BHPA 1H1AA 3FLPA 2AUYA 1MS3A 4K20A 4KWJA 1RUD3 3MFCA 4YLZA 1DQ0A 3ASIA 4IV3A 3RS6A 4ZKTB 5T54A 1LTEA 4XFFA 2NM1A 3EXUA 1VBB2 2Z5WA 1FMD3 3IWZA 2E51A 2CWMA 3AJYA 4R52A 1V70A 3JBG1 5L36A 2OA2A 4UW5A 4TLFA 3N4MA 2C9AA 1FXZA 4NO4A 2VNGA 1YLLA 5DZEA 2RM22 4W6WA 2D5HA 1RUH3 4AVCA 3H7JA 1ULCA 3VBUC 3ZXEA 3SCGA 5LRRA 1A8MA 4OUMA 4OHWA 2ZMNA 1QWRA 4WM8B 3NAPB 3CL1A 1QXRA 4MYEA 4WVMA 4NN0A 3ZFEA 1V00A 1MS8A 2QCSB 3A0KA 4YVSB 3WW2A 1NLRA 1RUJ2 4CDQC 3VUOA 2Q5TA 1CAUB 3HBZA 4QPIB 4RHV3 1BK1A 1KITA 2DCKA 1OOPB 2WS92 3AZZA 2XL9A 4GULA 1PO12 1ZRRA 1R1ZA 1F5FA 4DS0A 3N36A 1LOFC 2UYAA 1RUI2 4LBQA 2PHUA 1R093 2XVKA 1AR81 2ZS6B 5FQ0A 2ZGUA 3G6JB 1CIWA 3MGUA 3UK9A 4HK9A 1QKQA 1RUC1 2BFUL 1ASJ1 1F9KA 1ND2C 2WLQA 4MUVA 2DCYA 3ZFGA 5FO7B 2EIGA 3GYDA 1A8DA 5DDJ3 3N7KA 3MIDA 4OFGA 2JE9A 4AI1A 4E4SA 4D94A 3J8F2 1VBD2 3BIWE 1PVXA 5JIAA 2JJ6A 3TN93 4LA2A 2VMHA 1A3KA 2PHXA 3KCCA 1C4RA 1GZWA 1AHSA 1HQLA 3AP5A 2DVFA 1RC6A 2B46X 3LOBA 1U12A 3ZMNA 2WZR2 2DCZA 4GH4B 2R0HA 1AR91 1H2NA 2JG8C 2XL7A 3AK0A 4FOYA 4MZUA 1UL9A 4IEYA 4QGNA 2R30A 3VHNA 2ZBJA 5D8AC 4JGYC 4IL7A 1VALA 4KG8A 2A3YA 2ZCWA 4XHBA 1ZBA1 5C9AC 1LCLA 4UXAA 2GC2A 2R072 1O4YA 2BWAA 2RS11 1TME3 1AR61 3ATGA 1ZX5A 2HWD3 4XJWA 4OI4A 4EN9B 3OF1A 2ZZJA 3HWJA 2CNAA 4HN1A 2PTMA 3SNMA 4AEDA 3ETQA 2XWBB 2EXJA 4LR4A 5T5LA 1ZRDA 1WD4A 2PQQA 4BM8A 1GSLA 1I3HA 4G4FA 4R9CA 4JGZB 1RMU1 5CG8A 3MI8A 4COWA 2ZGSA 2QJVA 4L9BA 1M06G 3E5QA 2BNOA 2R16A 1E57A 1QNWA 3VV1A 3EHKA 2VMIA 3LKJA 4HVQA 3EJKA 1IHMA 3B93A 4K8FA 4GMP3 3WX5A 1RB8G 1LOCA 4IV1B 4HFSA 2FMYA 3D0JA 2UWBA 3X29B 1RUD2 3JZVA 3OCPA 1LGCA 2PHRA 1LRHA 4FPKA