2MEWA

Solution structure of nuse (s10) from thermotoga maritima
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S10
publication title Solution Structure of NusE from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Structural protein
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mewA00
5AJ3J 4YY3J 1HR0J 3J7AN 2UXDJ 2UUBJ 3D3BJ 4OX9J 4YHHJ 1FJGJ 4NXNJ 2UU9J 4LF5J 3R2DJ 1HNXJ 4X62J 1XMQJ 4LFAJ 4HHUA 4B3MJ 1N34J 4X64J 5IWAJ 1XNRJ 1N36J 2KL8A 1HNWJ 4LF7J 4JYAJ 4DR5J 1IBMJ 4B3TJ 3OTOJ 4DV5J 2KVQE 4DV6J 1N32J 4X66J 2E5LJ 4GKJJ 4NXMJ 3W1YC 2UXBJ 2MEWA 4JI3J 4DR7J 5FLXU 3R2CJ 4B3SJ 4DV7J 4PWWA 4JI1J 4KYZA 1HNZJ 4JI0J 2VQFJ 4DV2J 4DV4J 4DR4J 4DV0J 4DV3J 4JV5J 3IMQJ 4LFBJ 4GKKJ 4DV1J 1XNQJ 4LF9J 2MQ8A 4LF6J 1N33J 3T1HJ 3J81U 4B3RJ 4KY3A 4DR1J 4RJVA 3D3CJ 1IBLJ 4K0KJ 4LF8J 4LF4J 2UUAJ 3T1YJ 5BR8J 5IT9U 2UXCJ 4JI2J 4AQYJ 4JI6J 3J80U 2F4VJ 1XMOJ 4JI5J 1IBKJ 5LM7E 5LMUJ 4NEYA 2HHHJ 4DUYJ 5LMNJ 4LFCJ 2VQEJ 4DR6J 4JI8J 5A2QU 4X65J 1J5EJ 4DR2J 1I94J 4JI4J 4DUZJ 4V1Ak 2MTLA 4NEZA 4KHPJ 3JAMU 4DR3J 4JI7J 2UUCJ 2ZM6J
chains in the Genus database with same CATH superfamily
1TAQA 4O0NA 2VH7A 1C1CB 4YN3B 1YBTA 4MAKA 4WIIA 4ES1A 2OELA 4DI6A 5M2UA 2VA2A 1WG4A 2AD9A 1OS5A 2J0QD 3AT1B 4QIVA 4MTPA 1IBMJ 4NYOA 5KFFA 3VALA 3GU0A 2B9EA 1VBYA 4CT8A 2KZZA 4F25A 2FLLA 2B4VA 3D7SB 2ZNYA 2AYGA 2XWXA 4J5OA 1TFYA 2DXDA 2BDPA 4IH7A 1H0HB 4PUOB 3T1HJ 1UKUA 4RW4B 1HI8A 2ZVSA 3OHAA 1SC3B 4ETZA 1QSYA 3M6WA 4JV5F 3EUNA 5GAHU 4Y0FA 3OLAA 4OHVA 2XS2A 1FE4A 3GFHA 3UDEA 1JXEA 3QT5A 2H5IB 1FWLA 1BWVA 2YNIB 5F8IA 1NK7A 3BO2A 1GNKA 3EXCX 1NSQA 5J2PA 3KK3B 1RAJA 2IM1A 1YDLA 4DV1F 1T9XA 5B0BA 3CDBA 1N33F 4WPAA 3QJLA 1RBAA 1Q8KA 3HSGA 4FKXA 4X4VA 2N7YA 4G6VB 3LP0A 5C7PA 2GVZB 2CQIA 2OLWA 3MM6A 1HA1A 1EJ7L 1PYTA 3E51A 2E29A 3LP1B 2M2BA 2M0GB 3BQ2A 4EEYA 3OXLA 4ED2A 3MR5A 3NMRA 3QWUA 3W63A 3UN2A 4DLGA 1OO0B 5EDWA 3KLVA 3RW7A 2MKIA 4QQBA 3EZ5A 1RI7A 2OPSB 1X60A 4DSLA 1SBRA 3FC9A 5HJXA 1NZ8A 2ALZA 3AD8C 1ELOA 2QA2A 5J2QA 3DFEA 4X4OA 1T9VA 4LF5F 1A0OB 1KWMA 4Y2AA 3Q8UA 3DRSB 1T9YA 5DQGA 5CYJA 1VHFA 3MMCB 1RT2B 4I6WA 3N6NA 9RUBA 1V3RA 1Q5VA 5A0YA 1C2PA 2R7QA 4DUZJ 3OBIA 3DOLA 2KFYA 1REGX 5AJ3J 5CH7B 3UVJB 2ZFHA 1NDLA 3T5JA 1NSAA 1S97A 4ZCIA 2YX7A 5K8NA 3QRPA 1FHTA 3BDEA 4CO2A 1VQ4S 2KJWA 1TU0B 2RHQB 4IDKB 3A3NB 4PABA 2ATCB 2GNKA 2W25A 4LFCF 3R7BB 5FLXY 1S99A 2YQ1A 1YZ7A 2DR9A 2EFVA 2ZD1A 1FTCA 2L48A 1HHQA 4UUWA 4DS4A 2IRYA 1RTZA 1SQEA 1NUEA 2RUGA 3T19A 2EEYA 1ULRA 2RKIA 2PO4A 3NCPA 4KHMA 1RUSA 1X4EA 1Y3KA 3M8PA 4MH8A 1S1TB 2NXUA 2X51A 2RHSB 2VASA 3NBPB 4ZPTR 3DDKA 1HWIA 2KDOA 2B5JA 3LQVA 5KT5A 3T6JA 4OJ3A 1HBOA 3TAPA 3B8HA 2O67A 1HQUB 2EI5A 1FXDA 1VBXA 2HK3A 4MFBA 2ACMA 4OHWA 3DDIA 2YTCA 2RB7A 4USTA 5L1KA 3NS5A 1HBNB 5KFMA 3KWMA 2MB0B 2ILYA 5KFPA 2Y8YA 1N88A 4Z7CA 3CMQA 3C3LA 3K5LA 5KFWA 2BANB 3T1YF 1URNA 1W2BR 5T14A 1URRA 4F26A 3U1LA 2BJDA 5CAAA 3GG0A 5I4MA 2Y3YA 2MEWA 4ZKAA 4DSKA 1IJEB 3WBZA 3M4XA 3Q8YA 1HHSA 3MMBB 4EBEA 1PG5B 3BH6B 3MMAA 5KG7A 2RRBA 2MZQA 3V2UC 1VI7A 3VHQA 4ZCMA 3KK2B 4CWBA 2IAJB 1FFGB 5L1LA 1U1OA 3F0NA 3O5TB 1EIYB 2CPJA 5BR8J 3H4BA 1QSLA 1HIYA 4OV1A 1T05B 2VA3A 1FDAA 2E5JA 2VODA 2FVQA 3ISZA 3MUVP 4EYHB 5DZ7A 3JTPA 3VZIA 1H74A 2CWKA 3MEGB 5KFEA 5IV4A 2BOAA 1IQTA 3RB6A 5KFTA 4QU7A 3I31A 1D9AA 1XR7A 1HWUA 3NGUA 4ZVQB 1CPZA 3PVXA 3OVAA 1W2IA 4OYAA 5GAEU 1KONA 3KUHA 4Y28C 1XIQA 2CQCA 2WBMA 3A13A 4B3SJ 2QFJA 4URQU 1VRUB 3WHIA 4ZN1A 1JLBA 4F0MA 2QC3A 1HKAA 2XHCA 3OR1A 2CKWA 2GFFA 1UVLA 3MM7A 1MW7A 1VQLS 1VIOA 2DRDA 2LQ8A 1HNIA 4ILMA 5KOWA 2UU9F 1FDNA 3OXGA 3F56A 3KJVB 4C98A 2ZH1A 2H5JB 2ROEA 2F9JA 2HFUA 2HNDB 4RLEA 3OTOF 2GAGC 1P8GA 4A8XA 3GIRA 3GTYX 2CVEA 2PE8A 2YPZA 2BJ1A 2GHVC 5DM6Q 4JI8J 2VONA 4AFFA 1RWUA 4UY8T 4M5NA 4JI4J 4F36A 4ZITA 4KHPJ 1VQYA 4TY8A 3HLUA 1JLGB 2HGLA 4OQJA 1UEKA 4NCGA 3ITHB 3BREA 1WG5A 4PR6A 4KFBB 1RTJB 2QL5B 4NLVA 2IM3A 2CYYA 3A4TA 2YVSA 4J9NA 2HAFA 2DCUB 3MFHA 4WU3A 4ED4A 3UDVA 2HQ3A 4FZVA 1FERA 1BMQB 3VAJA 1J5EF 4DFKA 3R7NB 3NCRA 3BBBA 4RU9A 4EFAC 2GHPA 4YY3F 3BYPA 2X3DA 3M8ZA 3H5SA 5HJYA 3MFIA 2HMIB 3PHTA 5KFUA 4M5JA 3ZTOA 2QO3A 3PY8A 1WNEA 2VBXA 5K14A 2B6AB 4W92B 4KPYA 2DXFA 1L3UA 4NXMF 1VQ5S 4TQRA 2VHGA 3RBZA 3KHHA 4IR9A 4C4WA 1S6QB 1U26A 3EXYA 2DR7A 2B43A 4ES2A 4CO1A 2RRAA 4QR0A 2BRKA 3BQ0A 5I42A 2DNMA 3GCXP 1F0XA 4O3SA 5HMXA 1UEUA 3KYLA 2XYGB 1U2RA 1P9QC 3AFGA 2BJ7A 1Q86T 3IAM9 3QYYA 3GR0A 4J9SA 4N5SA 2ERRA 2K7KA 3I9ZA 4ECZA 3DN9A 1V3SA 2MKCA 2HHXA 4ZJQA 2LEPA 2FJEB 1QAYA 4LIRA 3HD2A 3IFEA 3OHBA 1CJUB 1RK8A 3HULA 3KLEB 4WP8A 1U25A 1R8HA 2YKOA 1LWEA 2RS8A 1DLOB 1VK3A 1RKIA 2G9OA 3SXLA 4M5IA 2ZWPA 3D28A 1IR1A 3TAQA 2PC6A 2EK6A 3DLEB 1QTMA 3K58A 3MWBA 4LRCA 2AHOB 4IFVB 4ZA1A 2DNRA 3MM5A 4HEA9 2XHWA 5CD4H 2F8EX 2HNYA 4ZLPA 2HIQA 2Z8QA 1YK9A 4MKBA 2OPQB 3P5BP 1WEZA 4ZVUB 1EKSA 2W2NP 2IPOB 3THVA 3TAMA 4XPCA 1NK0A 5CYMB 3LAMA 2NREA 1YZ6A 1RTIA 5KG6A 3M2UA 1LFPA 1UA1A 3SZ2A 1HR0F 3KLHA 3VGSA 3Q2TC 2LU1A 2OH2A 3NRBA 5HVFA 4CTAB 1RYSA 1T94A 3QAEA 2QG9B 2BX6A 2VFRA 2O66A 4C8LA 2C3YA 4ER8A 1FWKA 2PI4A 2IVMA 3VAKA 2IBOA 1KTQA 5HN0A 3ULHA 2R7SA 1C4CA 3JB9k 1H7WA 2MJNA 3FVYA 3KLGA 2ZJQQ 3QIDA 1S6OA 4NLPA 1PAEX 4OYBA 4OL8A 2UUCJ 2ASYA 4PKDB 2GHWA 3HHLD 1NK5A 3HVWA 3OPKA 4QYRA 3R9LA 3TYTA 3BGRA 3VVTA 4LF8F 3TZYA 2RDJA 1DFDA 3TEGA 1M5PC 2ROPA 1X31C 3KMQA 2BJ9A 1HBMB 2RILA 3N5BA 3VGVA 4LBHA 4O3QA 5AE3A 5HAOA 5IWAF 4L3KA 5E3AA 4A48A 1B0VA 4GVBB 5E41A 1MSWD 3R1HA 3H59A 2FVRA 2XY7A 5ETKA 2MQQA 2DRAA 2HFOA 3GYNA 4M5LA 2BW2A 2W7PA 2D74B 4CLKA 3GJRB 1RLDA 2FC8A 3G6ES 1CC7A 1T9UA 5F8LA 3ZC4A 2XZTB 1S6PB 4O44B 1UZDA 2OPPB 4JI2J 4PWUA 1LW0A 4NPOA 2F4VJ 1HQ2A 4ZP6A 3ENVA 2HBRB 5DJBA 5D6GA 1GT8A 3HPOA 3POTB 1SXLA 4K5RA 2VG6A 2DEJA 4LT6A 2XM3A 1M1GA 3KHGA 2CG8A 4IG3A 3QPIA 2VJUA 4NZ7A 4EBDA 2DRBA 2ZH9A 2HNZA 4J9LA 3OUYA 2QLJB 4HT5A 1KR4A 3MM9A 3S8SA 4NCAA 2J7UA 3OV7A 3HP6A 3HHLA 2JJ4D 4AQYF 5F8MA 4Y2KA 2JX2A 4EMDA 4ZHRA 1CSJA 5D78A 2QSFA 3BKTA 5EWFA 4RNFA 4USMA 1RE1B 1RWWB 1Q1KA 5J1EB 3QSYB 4RZRA 3NGSA 4PAAA 2PDAA 2VDIA 3CMES 3C6TB 4RJVA 2COLA 5K5MA 2EKNA 2FLPA 4ZPVR 2DGUA 3ET6B 4HH1A 2YX1A 2MKKA 3RAXA 2MZJA 4DQRA 3HF5A 4DPWA 1IKVA 1T9TA 1FT8A 3VAFA 5CQGA 4I0WA 2AYMA 1OIAA 1UVNA 4TNOA 1Z2LA 1R8BA 2F8HA 3T1HF 4Q0BA 1DTTB 2CVIA 2VIHA 1SUQB 1VDHA 3QBCA 3GFXA 2XSJA 1OPIA 1UJ5A 4ANDA 4TU9A 1U47A 1QAIA 1XEZA 2SXLA 1RAHB 5F0UA 4YS2A 5D3GA 4NA1A 1FXLA 2BA9A 1X9WA 4B3MF 1LWCB 2F40A 3DLKB 4CIOA 1DRZA 4DQQA 2KU7A 2N82B 2V94A 5B0AA 1NH8A 1X5PA 2B51A 2W4CA 3C14B 4OJGA 3ISND 1RHJB 3J7YI 2RF2A 5C25A 2C2DA 2J9DA 3O44A 3PXGa 2CQHA 3Q89A 3KK1A 1GTEA 4I68A 3GFYA 1DY3A 4GRSA 2A10A 4QIWD 3OL7A 1HQEA 4V19J 4ZVSB 4GO7X 2VD3A 4X2BA 1HNVA 1U02A 2QT7A 4USWA 5DLGA 4C9DA 3HHLC 2DPIA 2BQ3A 1OQ3A 3Q8SB 2YWGA 2C1EB 4NEZA 1NK8A 4B17A 2GMJA 4I4BA 4URSA 4HHHA 4GVLA 2E1CA 4NLTA 1M5KC 2JH3A 3AY0A 3RB0A 4QCLA 1E6YB 1X0FA 3RBEA 4N47A 3G8TA 3ZFVA 1PJ7A 4KR0B 4RNHA 1R89A 2KG0A 3HT0A 1NSKL 5J2NA 2UXBJ 5C2CA 4ZVFA 1Y4ZB 5I3UB 3N6LA 1S1UB 2KYXA 3OTCA 2VQFJ 3MCOA 4WP9A 4DV0J 2K2PA 4EI2A 1VR6A 4DUZF 3J7ZT 1S59A 2DGWA 4DLEA 1IM6A 3FCWA 3T9NA 4RL1A 5AJ3F 2W2OP 4IH6A 4U96A 3CDEA 1FRKA 3GWCA 4ZPWR 1QE1A 4WJBA 1X7VA 3HHKA 2OSQA 1S10A 3EGWB 2P5VA 1F9HA 4EZ6A 5IT9U 2ZWOA 1GXTA 2BE7D 1H2UX 1FK9B 5D4LA 1HI1A 3RB3A 3MAHA 3CCMS 3C16A 1KFDA 2Z57B 1L3KA 4QPXA 3JAMU 1RT1B 4KKOB 4RBVA 1TTHB 4FYYB 1TK0A 1KD1T 1PILA 2FZKB 2ZZMA 4L74A 2BE2B 3W9JA 3KG0A 1RKJA 1BHNA 1K8AT 2DB1A 1P1LA 1ICEB 3R6LB 1DBDA 3UWTA 1HPZB 2UVRA 2NXCA 2DGQA 3NGDA 4RUCA 1PJ6A 1RB0A 1R8PA 3MCNA 3NY0A 5IZHA 2WTFA 4AYBD 4H4OA 1FRIA 4U6PA 2DIUA 2BW7A 4K8RA 2DHAA 1HMVB 3T3FA 1S79A 3LPYA 3TZZA 1R8CA 1X4DA 2GIFA 4FPRA 2BJ3A 3GSDA 5FDLB 3I0SA 2YKNB 3QFHA 1S7HA 4KV8B 1FRHA 5KOXA 1A6LA 4RW9A 1QY7A 2LXUA 5A2QU 3NWRA 1PSDA 3M05A 4P74A 2DD8S 5E3PA 1Q82T 3O6QA 4DWIA 1JLEB 3MURP 4E0DA 3I96A 1WTFA 1RT6A 1MLAA 2YNFA 1N48A 5G0RB 4PPZA 1HBUB 1N34J 4I7FB 4L3NA 3FBCA 4WE1A 5BR8F 1N36J 1B99A 3TNVA 3MECB 3CF5Q 4DDFA 3FKBA 3ISNC 4XK8C 2KKHA 3OXFA 3K5MA 4IOAQ 3ADAC 3VGUA 4WTYA 2QA4S 1GH8A 2R8KA 4G1QA 3CCQS 3Q23A 1S0OA 4BS2A 2C2ZB 3FQLA 2ZH6A 1WSRA 3TZXA 3J81U 4IG0A 2YWKA 2OHDA 1LW2A 1DARA 1H3DA 5EUHA 2AYEA 2X3GA 1G1XA 3IA0A 5KFLA 4CYUA 1WEYA 3DHWC 4DS5A 2BRLA 3EX7B 2VPZB 3KNAA 3HFVA 4R0EA 5KFJA 4FF4A 5E33A 1Y11A 3U1NA 3PACA 3D0HE 3IS9A 3AD9C 2ILZA 1SI9A 4NYZA 3QATA 1SJ1A 2WSFC 3LF0A 5B0GA 3PX6A 1O8BA 3N01A 4IH5A 1VJQA 3MEDA 3ENAA 3BDPA 2QRRA 3PRVA 5GMEA 2ZBCA 4N76A 2K06A 4JI8F 2H4YB 1WWHA 2IM0A 4DV4J 5IQ6A 2DVIA 4OZNA 3BJYA 3IR5B 4JI4F 2OSRA 4KHPF 3KLIA 2JEGA 1YJ9S 1YG0A 4TQSA 1NJYA 2WSCC 3OFHA 1SKRA 1AUDA 3EDRB 2J6TA 1WOOA 1D0EA 1R0BG 3BSNA 3L7PA 3BH7B 3FSIA 1NO8A 2PA8D 3VAGA 2JNJA 5E3RA 4LQ9A 1VJWA 5B08A 4O4GA 4ZVOB 3DC2A 2ZOMA 1FFSB 3LO3A 3MM6B 1YQHA 3GJQB 3CCRS 2VB6A 2ZNZA 3UD3P 2F3JA 2NQPA 3S1TA 4LSLB 4M95A 4H4MB 4Z7YA 3D5MA 2GIRA 2AGOA 1UJ4A 3EDQB 1TL5A 1ZM9A 4WFXA 3L7UA 1VLOA 1TL4A 3FNNA 3NG8A 3IWNC 1BD6A 2DHXA 1XNRJ 2XI2A 2I8EA 4WKYA 1B64A 4JI3J 3R27A 3L3CA 4JI1J 3PTWA 4KGVB 1JJHA 5L1JA 3FBFA 1R6VA 2CPYA 1HNZF 3DRPB 3GILA 4PEOA 2V4JB 1GEHA 4N41A 2XYPB 3DOLB 1JKHA 3TA2A 1AROP 3W7BA 3M6XA 2N3OA 2F1FA 4M5KA 3T9ZA 3OT9A 1MMDA 3FCHA 2XLKA 2KHCA 4NE9C 4PQUB 4M5MA 1VBKA 5F3ZA 1C4AA 3DRRA 3CT9A 4X62J 2W9AA 3KMSA 3PG9A 3E8OA 4XPEA 3KKFA 2M4MA 5HP1A 1Q16B 2HRTA 2HVHA 4K4UA 1SC6A 5ADZA 2FLNA 2AF6A 2OGUA 4X66J 2WRMA 4FYXB 5H1SV 1OY6A 1FRXA 2CADA 3N28A 3WC2A 3Q2SC 4BDPA 2CQ0A 2MZRA 3M8PB 4AUKA 3BKFA 2DYAA 1CQMA 3HVAA 2HKEA 3BR9A 1Q8BA 3DLLQ 1X4HA 2XNRA 4QWDA 2K7JA 2B5JB 4QU6A 1HBOB 2ZC3A 4RBTA 3N0VA 4B9NA 4ZVGA 3CIMA 4MFBB 3WIUA 3PYDA 1KLMB 1ZPVA 4LR7A 3AB2B 4JV2A 1NK6A 2EPIA 5B0DA 2Q66A 2IYGA 5J1PA 3UD4P 4P75A 2FY8A 4P2SA 4RNOA 3E01A 4ELVA 4TU7A 5E5NA 2C3MA 5ETSA 1KQGB 1L3TA 4LRBA 1SKWA 2CRLA 3AOCA 1JJ4A 3QSIA 1IJFB 3CDWA 3MMAB 2PD1A 4KSEB 2HWHA 2KI2A 1PYSB 4ZVTB 2C2MB 3D0IE 1VOMA 3UN5A 3RTVA 3M7VA 3IAS9 1U1NA 4ZN3A 3VQTA 4LIWA 3D1HA 1FF2A 1WF1A 2C2KB 1F5BA 1YX2A 5MAOA 4ECRA 2FDNA 1UVJA 2HQGA 3SFUA 4QYZJ 3EMTA 2AJ2A 2BMBA 2B3TB 2KFNA 3ZZPA 1NB2A 1TKDA 1SVDA 3V5RA 1S57A 5C5JA 2JHEA 4BBYA 2CJKA 2BOPA 2OMLA 2EBEA 1SQFA 3HZEA 3AJ2A 3QGPA 4DX6A 1CEZA 4Q7AA 2G0JA 1JLQA 1I5OB 3GV8B 4P72A 4ZVPB 3IG1B 4YR0A 4WIQA 3DYAB 4IUFA 3CCUS 1XMQJ 3D1QA 1WELA 2OEMA 2YWWA 1MROB 4FNIA 3ZTQA 1JLBB 4ES3A 3PEJA 3OR1B 3UQSA 1ZYQA 4JI2F 2YNHA 3MM7B 2F4VF 2LCWA 3FEZA 1XC9A 3T6BA 4DV3J 1I1GA 3SDEA 1VC5A 1N54B 1RTDA 2ZHOA 4NMLA 3J7YU 1NHKL 3W8PA 3OJSA 2Z56B 2Q1LA 5LSOA 5U47A 3OFEA 3W2WA 2J7KA 2XBPA 2EBGA 4UOGA 3VTIA 4LJMA 6FD1A 3N4WA 2UVVA 3ZXWA 4QYZK 2AYBA 1FA0A 4JUZA 3H7HB 1RCXB 2V4RA 4NRUA 2ABYA 5L9NA 2QA1A 4A8SA 3AA9A 2V50A 1CULB 3V4IA 2BACA 3DOMA 3KJNB 4NCGB 4V19X 3VZHA 5IC4B 3W8GA 3TRGA 2XZDB 2RRNA 1NCLA 1VQ6S 3H2LA 2GJ2A 1EKRA 2HHPA 4I56A 4Q2LA 4H54A 5ETNA 2LEBA 5KAKA 3F41A 3EPIA 1BQXA 2WSEC 1KVIA 5L8RC 3I5BA 4RR5A 4PCQA 1HW9A 2GGPA 4LF7J 4JYAJ 5F3TA 2ZE2A 1HW8A 3OW2R 1WC1A 2UP1A 4URGA 4GKJJ 2KTQA 2LA6A 3QGIA 3SEOA 1FNMA 4QW8A 5KG5A 4BHQA 1YSJA 4RUHA 1CJVA 3D6TB 5GAHI 1TKTB 1SL1A 4HI2A 2C28A 2CJ9A 5K14B 2YKMA 4ATNA 3CD0A 3P5TL 1K0TA 3PIPQ 5KT2A 4MKYA 2HGMA 3KOAA 1REVB 2V34A 2NUUG 2OPRA 3KDNA 3LTOA 3MR7A 4OZ5A 3JSMA 1ZBTA 1BE4A 2VU5A 1VQSA 2HHHJ 5CYQA 4YB1P 5I42B 2U1AA 3OSNA 2V2VA 1P6TA 4X65J 3TUZC 2QSWA 3MGJA 5L46A 1NM2A 2MTLA 3M1VA 3I0RA 3TVYA 3C66A 3MR6A 2P2CB 3CPWR 3R6GB 5ETQA 2FHKA 5D0HA 1RTHA 3I87A 4OYZA 4YQWA 3QLHA 4KPCA 2ZJPQ 1VFJA 2PMHA 2QIFA 2UXDF 3M9OB 3M8WA 3CE8A 3PFOA 4DR7J 2CNKB 3OLBA 3M6VA 2D7SA 4OYXA 1RT4A 1WI8A 3GPAA 4FS1A 1LWEB 2MKSA 1Y0HA 2XWYA 3AOAA 1U8WA 4ILLA 3CUNA 4ELUA 4HACA 4CLUA 2V6AA 3G6VA 4DBQA 1PIEA 3MTJA 4N56A 3TJAA 2UXBF 3BKUA 1UVKA 1SJ3P 2VQFF 2HNYB 5KFZA 4F4XA 4JP8A 4RWXA 4DV0F 4WXOA 3AQOA 4I69A 4QIFA 4BC7A 2NCKL 4HR2A 1OMSA 4HTIA 3L95X 4LFAJ 5JVGQ 4P9SA 3H98A 3HZGA 3TAMB 1YJUA 1YBAA 4D3GA 4YDDB 1RTIB 3M2UB 1RP5A 5C42B 2CG4A 3GONA 2AWZA 1AB8A 1Q81T 5AXNA 4LRAA 3KLHB 4J9UE 5KFVA 4DL3A 1L3SA 2LXIA 4DV2J 1MN9A 2NYHA 3SMZA 2RAQA 4H4KA 1UW9A 5HMZA 3CDAA 1XNQJ 2OI2A 2CWXA 2DNHA 4DPYA 1B3TA 5J2MA 4YDXA 3SQOP 4BWMA 2CPIA 3THTA 3TZWA 3KLGB 1BGXT 2DJWA 3DNCA 2IIHA 2X7IA 3HT3A 1U1QA 1T8EA 3M30B 2HVIA 5HBMA 2W8LA 2I5JA 3OD2A 2E7WA 2G1DA 1FCAA 3C46A 4OYWA 2M3DA 1AW0A 2E9RX 2KJVA 2FZCB 1C0UA 3NAHA 3I4HX 4QWBA 2V67A 2VC1A 4OX6A 4XDDA 2I0XA 4X64J 3K5OA 1VQMS 1NMEB 2LDIA 4ZMMA 3ENWA 4FXVA 1SJ4P 1SKSA 1FTRA 2OO4A 1WTBA 4CM0A 3J7A1 1MMNA 2GQQA 3U7JA 4O23A 3UO0A 1LW0B 4DR1J 2U2FA 2CPEA 5HROA 2WONA 1N34F 4ZIWA 1UAWA 1CVJA 3GYXB 2VG6B 1N36F 3RG6A 4WU2A 1OYEA 4Q44A 5CZVA 4PXEA 2HHVA 4IG3B 4USKA 2HNZB 3ZZRA 3MM9B 4IO1A 1FNXH 1YHQS 1FE0A 3HHLB 2ZH7A 1PAUB 5GAEI 3CEDA 5CZXA 4TXSA 4DFPA 3ETOA 2PEHA 1JLAA 4CP5A 2MGZA 4DCOB 4QBUA 2YWFA 4LSNB 2HWTA 4J9VA 3CJ0A 4RU2A 3TWZA 4DQPA 2BQUA 4B9MA 2AX0A 3WC0A 2LLZA 1JJCB 5DG9A 2Q6BA 2RS2A 2V0NA 3CJKA 4EU0A 4WFYA 2UVWA 2HRYA 4TVAB 3DDNA 4WZMA 4K7QA 2B7BB 1R7IA 1E6VA 1OSCA 4DQSA 3K17A 1IKVB 5KFNA 1NSPA 4QWEA 2ASJA 1R31A 1WKKA 2ZZTA 1UJ6A 1TK5A 4DL5A 4ZDNA 4C0HA 3HHEA 4U7CA 3SV3A 4PG6A 2WVBA 1IBLF 3R5DA 3UR0A 4DV4F 1PYOB 4D3HA 2YWHA 2XSJB 1LXNA 4PUOA 4ALZA 3QZ7A 4CO5A 1X4CA 1IKYA 1EX8A 1S12A 4LRFA 4HYKA 1RAGB 2R9LA 2M5YA 1K44A 5JVHQ 4NLUA 1IQZA 1TV6B 1SL2A 4QW9A 2PA3A 2MKYA 3AHPA 1J2VA 3QJPA 4B3TJ 2AV5A 1NU4A 4DV6J 2N7CA 2XLJA 1FX4A 4CH1A 2RF2B 4MYTA 5C25B 2KVIA 1ITPA 2IFXA 4KH1B 3KK1B 2E5IA 3IR6B 1HQEB 3BGOP 1WHWA 1RSCA 2NZCA 1HNVB 2E9TA 5KFHA 5KFAA 3O8WA 3TA0A 3KTQA 2CFXA 1JMTA 4X4RA 4QOTA 1XNRF 1DQ9A 2CQ2A 1GMUA 2DEIA 4W98A 5GMDA 4JI3F 3IO1A 8AT1B 4DSIA 2RVJA 1BQMB 2HVZA 2IVYA 4A47A 3CD5A 4E2FB 1RHRB 1YKWA 4I6YA 1RU2A 1C1BA 2IRXA 5IXUA 2KFZA 4I2PB 3CC4S 3H5YA 2M8HA 3THPA 2C42A 4USJC 5DQHA 3FRZA 1S1XA 4FF3A 3A3PB 3V6DB 5J1NA 4CRJA 2JLGA 3DRSA 2GVDB 1G4CA 3O3LA 4KGZB 5DRKA 3BB5A 2P9CA 1F6TA 2IMWP 1NPRA 3D54A 4M8LA 4XO0A 3I32A 1QE1B 2PSZA 2D1CA 1WC3A 4LF6J 4C11A 4PYDA 2GS8A 2YKQA 2N3LA 1CBKA 2DISA 5JMNA 2IDEA 4X62F 3E2EA 2J5AA 1KHVA 3C16B 1OYDA 1S0NA 2LFVA 1ZM3A 5B0EA 3FZBA 4J9OA 2R7UA 3DXBA 3PO4A 4MMOA 4X66F 5SZTA 1H73A 1N56A 4IDKA 3D66A 1Q0NA 1SC1B 1VYAA 1RAEB 2HHSA 2V4QA 4UOCA 4DU7A 2KH9A 2XMVA 3T41A 4WK3A 2KN4A 1GX5A 1OJ4A 2HFVA 7FDRA 4R25A 1RBLA 3HJVA 3M2RA 1JNRB 4YHHJ 3K57A 4P7VA 1M1KT 1WJ9A 3BQ1A 1M5SA 3SI8A 3H0PA 1KFSA 5LOQA 1N5VA 2A6MA 4TKTA 5A2QY 1LV5A 4H4OB 3LA0A 5D8HB 5FLXU 3NS7B 1PO6A 1HQUA 1VGYA 4CDIA 2PFDA 3WZ0A 2AJ0A 4OI6A 1RU1A 4RW8A 4WXWA 3C15A 2OUGA 2KXHA 4C48A 3I0SB 1MU2A 4I64A 3M8RA 1Z4UA 1SH2A 1RT5A 4OZ1A 2XNQA 1WUUA 2AP6A 2Z2LA 2H3EB 4MIBA 3OL8A 5HK4A 4GO5X 1PBAA 3DRXA 1G6BA 3N9UC 1Z2ZA 1M90T 1RT6B 2JVRA 5EWEA 3P45B 5GMKa 3MMBA 2MQPA 1Q79A 1YJRA 3ILIA 2ZKTA 2J6SA 4RW6B 5D4NA 2WW4A 5F8HA 4CH7A 1SV5B 1GFWB 5BYSA 3G9CA 2PIIA 2IRUA 3VQSA 1VRTA 4WZQA 4XAKA 3EVOA 2XB2D 2VZ9A 3W5YA 2JEIA 1T05A 3DLGA 1ZPWX 1D3WA 4G1QB 2HLUA 4DV5J 4KO0A 2CPHA 3JTOA 4A4JA 1RACB 4IG0B 4C8ZA 2RSQA 1LW2B 2R2SA 2HVEA 1ZETA 1YJWS 3TARA 4GKKJ 1WORA 2KZMA 4CYUB 3A3OB 1F9FA 4I67A 1OQ6A 1WC0A 3TUJC 4YR3A 2KG1A 2RU9A 1UEVA 1XMQF 4KAIA 3O1LA 5EX3A 4LF4J 2VL1A 5KG2A 2WHOA 4ECUA 3HCXA 2WCXA 3ZZOA 5T41A 2OEJA 3GMGA 2FHOB 4RBUA 3DRYA 4WF9Q 4F2RA 4E8UA 3CC7S 1KVJA 5HMYA 1VRUA 5A6PA 5A8KA 2IJRA 2XCPA 3T5KA 4DV3F 3V6JA 2OKQA 3MEDB 3GIJA 5DDPC 3KJVA 1N4LA 4J9MA 3EGNA 2MHEA 1FNOA 3W61A 5IOLA 2EFQA 4F2SA 4U8VA 2NUHA 2BVZA 2YWEA 4XIUA 3KLIB 5EGYA 3EGZA 1SH3A 3L7OA 2ZDPA 5B0FA 4QWCA 4DV7J 1QSSA 2NYIA 2QLFB 4JV5J 4J9PA 1TMJA 4B02A 2R3VA 4J7CA 4JBCA 1RGVA 5ETMA 1JLGA 3AXMA 4C8YA 2Y1IA 1RWOB 5L38A 4O4GB 3ITHA 2QV6A 1Q53A 4KT0C 2W2MP 4ZOSA 4LF7F 4FKYA 4JYAF 2FY1A 2FJAB 1S1WA 4GKJF 3FQKA 5MLCV 3G8QA 1RQ0A 3JQKA 5KG0A 3HFZB 1JWWA 4CLLA 1G3OA 5KT3A 4Z2XA 5EWGA 2M8DB 4ZPAA 3TQ1A 2AEJA 1O0PA 2HMIA 3PR4A 3NGKA 2LKZA 3FEYB 3RZAA 4K4YA 2EWHA 2CUYA 3DXSX 4AE5A 1RT7A 3QAUA 4DR5J 4NLSA 1F2HA 4DG1B 2GO9A 3R2CJ 2HHHF 1KQFB 3VAHA 4X65F 1N52B 3RYLA 4QIEA 5KFOA 1S6QA 1NNDA 3ZZZA 2OD4A 4LF9J 2EFOA 3CJ8A 2CQ1A 4CI0B 4Y2CA 2DNLA 2ADCA 2GA7A 4K4WA 1RWKB 4C2MA 2XULA 2PI5A 3LOUA 4KGKA 1UFKA 3KUEA 1S1VB 5GADU 2FPHX 1TUVA 3EVMA 2W8KA 1TKZA 2JVOA 5KFYA 2WVFA 4DR7F 3QJJA 3CCSS 1XR5A 1R43A 2J76E 3DRRB 5DDOC 2XS5A 4LVNP 2IDLA 2A2CA 2Y1JA 5HSPA 5DQIA 4ZLLA 2QA4G 2R2UA 2DNGA 3QIPA 1U1PA 4USIA 5RUBA 4HHUA 2Z4PA 1CJUA 7AT1B 3KLEA 1HD1A 4ZCLA 3QRRA 3M8YA 4UOHA 1ZA2B 2Z30B 3RR7A 3MM8A 4L73A 5KG3A 3CDUA 3MPUB 4I1TA 3MPVA 4KB7A 1CG2A 2DXEA 4WTOB 2BYCA 2QZ8A 1NZAA 3C6UA 3W5ZA 4BLGA 2GJIA 3FCVA 4Q2MA 5ETOA 1LWFA 2AMCB 4LFAF 4CLPA 1A9NB 4F4YA 3VCDA 2C22A 2XZWA 3MAAB 5E3QA 2WOMB 2CDRB 3E01B 4NCBA 2MZ1A 3EVWA 3R97A 2GCFA 3GIMA 2GW8A 2Y8WA 2HFZA 3PW4A 3K2YA 3DI6B 4A8YA 5CYMA 2AEMA 1FESA 4RO0A 2C3OA 4V1Ak 1XNQF 2CZ4A 2VFVA 2CAJA 2CZVC 3LGMA 1FJGJ 1SB6A 1ACMB 4IRCA 2IVFB 2DGSA 4NLRA 5BJRA 2NXNA 3Q86A 2RJZA 4F67A 2YY3A 2B8QA 1NH7A 1C0TA 3IN5A 3D4JA 3A12A 4NYPA 4EBCA 5A6WA 2R7TA 5CABA 1TUWA 2WZ1A 2UUWA 1FFWB 3DLBA 4RWWA 4UW2A 1HHTP 1IUJA 5A8WA 3UW1A 4Y3CA 1CLFA 3W2VB 5C24A 2E7XA 2BKNA 4PG5A 4FF2A 1UVMA 5DG7A 4X64F 3MOZA 4USUA 3GG1A 5LJ3Y 1EETA 2ZHBA 1KSPA 3SCJE 1RADB 4LBIA 1JLQB 1MWQA 4FXWA 2V68A 2KT5A 4P10A 2B4PA 3K5NA 2H54B 3I6PA 2R2RA 2QFIA 1RA7A 2NPFA 1YJTA 4NI2A 4TYAA 4P2XA 4NOHA 4ECWA 2YNHB 1RWXB 2EC2A 3LWLA 2MZTA 4DR1F 2ZOFA 5IT4A 2VC0A 2RIJA 3BR8A 4HKQA 4O44A 1QM9A 2NXEA 1RTDB 2KT2A 4QPTA 3RAQA 3GV5B 3W2WB 3LUYA 3PW0A 1AA1B 3JQJA 2G4BA 5KFQA 4U7UD 2MLZA 4I6AA 3MUTP 3B54A 1U1RA 2MQ8A 4IQMA 3CCZA 3MAQA 1FJ7A 3LP2B 4RUAA 2XS7A 1IKWA 3AH6A 1NKBA 2BKPA 3KG4A 1BLUA 3ETMA 1KVKA 2CJQA 2VBYA 2J8SA 5A8RB 3V4IB 3BSOA 2UZAA 1VLYA 5F0WA 4IOBA 1ZH5A 3PHEA 3OVBA 1XMOJ 4DL2A 4DEZA 4UTGA 4PG4A 3UCZP 1SH0A 2L08A 3AODA 1RDRA 4N8NA 2YH1A 4LF2A 2FYXA 5J1EA 1R3NA 2FJVA 1H72C 2GGPB 3I5AA 2ZE2B 2HURA 5DG8A 2V8PA 3SQGB 4ID8A 4C0OC 3Q8QB 3I4PA 3PYEA 4KJIA 4UT4A 1CJVB 1T9WA 2MKHA 2BUNA 3RUBL 1OY8A 1D8YA 2EG2A 2YKMB 3UCUP 3GIIA 3BBFA 1KOHA 2VFTA 2JOQA 2LDYA 1WEXA 1WKJA 1EARA 3BPDA 4OHYA 2OPRB 3OL9A 4YUDA 2BXJA 4P6QA 4YB5A 1SIWB 4LVOP 1F3FA 1N5QA 2QTWA 2HGNA 3H4DA 3PX4A 1J5OA 4DN0A 1TELA 2J8AA 2A2DA 1H38A 2A3JA 2RD5C 4B3TF 1HYSA 4OLPA 4DV6F 3I0RB 4OHXA 2XMMA 5DDRC 2B9XA 4HT7A 2FHJD 2DR5A 2M88A 3DLKA 3R5GA 1UTAA 2RQMA 1NEEA 5CHCB 1IM4A 3CD6S 3QLHB 1RHMB 1XN9A 1FKAF 2DR6A 5IV3A 4DZ6A 1CC8A 2NXJA 2CNLB 3NS6A 2HQIA 2BJ8A 3M2VA 1RT4B 1NPPA 4KIAA 3FZ2A 4IR1A 2F7VA 2M70A 4YEAA 2LA4A 2NS1B 3AJDA 3GQCA 3MCSA 1H2VZ 2DGTA 2VKRA 3B4DA 4HACB 4CNZA 2DK2A 3VGTA 2DTJA 2CQDA 2RQKA 3OFFA 3F73A 2HPUA 3IRWP 2ZC4A 3FGVA 2R8GA 3IR7B 4ZPBA 3U27A 4CT9A 2CQ3A 4NA3A 4Y34A 3G8SA 3JYTB 3DMJA 4M94A 1HL6A 1N0VC 2W1BA 1F3VA 3Q8PB 3OFGA 2C2EA 4C7QA 4TYBA 4DPOA 2LYVA 5LM7E 2XQCA 3QGHA 4OI2A 2BV3A 4NLYA 4PWDA 3HX9A 3DGVA 2VF3A 2NSBA 3BBCA 4LF6F 4CQ1A 2FHJA 1CJTA 2W9CA 1O51A 3D3BJ 2ZBRA 3CJQA 1HWLA 4DL7A 2G2ZA 3W3SA 3W66A 1RAOA 2W4DA 2W7OA 1X5OA 2BKOA 2J0SD 1S72S 2EW9A 3CNQP 3DLJA 4CCHA 4MK7A 3PKYA 2DH8A 2CPXA 4DX5A 1TL1A 3FMWA 3CCES 2RMLA 2WVEA 3KLFA 1GQEA 4KKOA 1TUGB 1AZSA 2NPIA 4ED1A 2IC3A 4YHHF 2BE2A 3HVRA 5HBMB 4OMFG 3AOBA 2JFDA 3AXKA 3DOKA 1GAOA 2V2KA 5L1IA 5LL6d 1HPZA 4M1KA 3NL0A 1XBWA 1C0UB 4NEYA 3CSKA 1CJKA 1WHXA 2HBYB 3GSIA 1EHWA 2WVCA 3FSYA 4XTTA 2DHHA 4X4PA 1WI6A 1HMVA 4F4ZA 3NNHA 4UUXA 1HNXJ 3TX8A 4CLYA 4ICLB 1XMBA 5I3QA 5IWAJ 3EJMA 3T1AA 2FZGB 4Q43A 3L9ZA 5FDLA 5K20B 1NKCA 3C19A 3DU5A 2QJ3A 3JSRA 6AT1B 2FVSA 4BCAA 4K4TA 3ILJA 2EXUA 2PN6A 2MMYA 4DR4J 2JL9A 5HROB 2WONB 1WF0A 2R7VA 4U95A 1IBMF 2I2YA 2LQ5A 3G4SS 5H9EJ 1UFLA 1AFIA 5G0RA 2OEKA 3P4UB 1HBUA 4NMXA 4ENOA 3KHLA 3S01A 2OFHX 3JS9A 4OI0A 4DFMA 1HLWA 4I2QA 3SSQA 3VAIA 4DV5F 4K4XA 2LQJA 3KHRA 2PGCA 2CPZA 1F2GA 2D9PA 2OMOA 4ANEA 3MTKA 2G13A 3EZOA 1NJWA 4FN5A 2KM8B 2Q6CA 3ZTPA 3QT7A 1JLAB 2MGZB 4GKKF 2MPUA 1KS2A 3Q8RB 1EP4A 1FEEA 2UUBJ 4OZ2A 4CO4A 5HATA 3CJKB 1T0TV 4NZ6A 4CH0S 2HBZB 3W60A 1E6VB 1LFWA 3GZ7A 3T5HA 4NLOA 5AXKA 4FYVB 3IP0A 4ANCA 3TQEA 1U6FA 5EN1A 4J37A 1FX2A 3P8BB 4UOFA 3TA1A 1D09B 4DXLA 5HQMA 2L41A 1K9MT 4Q45A 5H9EK 1ZAVA 3H42A 2DY1A 2X1BA 5LJ5Y 3S7RA 2JFKA 2JWNA 1IKYB 4LR8A 3FJ2A 3A8KA 4DV7F 8ATCB 4ECYA 4KBIA 4ED0A 2LU2A 3H2VE 3MI7X 1VHIA 1EQ0A 3V81B 2B9WA 1UL3A 5M2RA 2DNZA 4IRDA 1YLXA 4RNNA 4B3MJ 1NBEB 3V4MA 3MCMA 2CQBA 3HI9A 1Y00A 2POKA 4OZLA 3KJQB 3EZUA 3K0JA 3PM9A 2XTJP 5G4DA 2FLOA 5KT6A 2R7WA 4NA2A 5D0RA 4LSLA 5L39A 3RBDA 4H4MA 1S49A 3SCKE 3R5CA 3LH2S 4LUBA 3W5XA 3VAMA 1RWVB 1TAUA 3IWXA 2E44A 4OYIA 4DSJA 2G2OA 3FDSA 1FO1A 3LANA 3PJXA 2H48B 4DR5F 1C1BB 2OAUA 2VPXB 4KTQA 4DQIA 5KFDA 3CJ4A 2HRUA 3J80Y 2VPYB 3UNGC 1H7XA 4DL6A 3HSJA 1S1XB 4LF9F 3CJ2A 3HMJG 4FBTA 3QO9A 5A76A 1T03A 1RAAB 3W62A 2ZZNA 3DRPA 3CIZA 2V4JA 3NKYA 2ZOGA 4DUTA 3MF5A 3ILLA 1HNWJ 2XSFA 1UETA 4C11B 1Q8LA 5HL7Q 3W1YC 1TK8A 1QLNA 1W25A 2QLWA 3P49B 4JI0J 2HQCA 2FHMA 2ZITA 4DOZA 4LFBJ 4R8UA 3OR2A 4PQUA 1M0SA 3DHXA 1B0TA 3PYFA 2VG7A 4WP3A 4OZ0A 5HMWA 4ED3A 3K8VA 2J9CA 1RHUB 1DHMA 1RHQB 5F9NA 3DM2A 3IGVA 3WIVA 2DNYA 5FIIA 3M2RB 5BXIA 4TY9A 1NXIA 2XEXA 3TW0A 4DR2J 2LECA 1EQMA 1R6YA 1U2CA 4RX6A 1G7CB 3R5JB 1TKXB 2YX4A 2XY5A 2CNOB 2AKWB 4B9VA 4Q8EA 3MPWA 5GAGI 3QGGA 2CJBA 4DU8A 2W9BA 3H8YA 1KLMA 4RW8B 1TL3B 1PC4A 3C15B 2GQCA 1OPZA 2ZH8A 4P7TA 1YVFA 4ZPCA 1MU2B 3JTNA 4AXJA 5IS2A 5M2PA 4Y2IA 2G0IA 2JC0A 1RT5B 4ECQA 4Y6IA 2BZ2A 2GQ2A 1S7IA 4L75A 4FXDA 4B3SF 1FJGF 2V8GA 2DO4A 1UCNA 3U02A 1X5SA 4ID5A 2UUAJ 3OTEA 2QE5A 2PMZD 5ETRA 2UXCJ 2GO8A 2HG4A 1QAJA 4C8MA 1WACA 5LMUJ 4DL0C 1RCOB 2L9NA 5HVGA 1GX6A 5HQ8A 1Y10A 5KFGA 3UNYA 1ZM4A 1VRTB 4X4TA 2IA6A 3IXQA 5IC6B 2O1PA 4MK9A 3DLGB 4X4UA 1XJWB 4KO0B 5KFBA 2EFGA 2B4UA 3BSCA 2DH7A 4CLSA 2ZDOA 3LWMA 3HM9A 2O01C 1RXOB 3QNWB 3Q0AA 4GC6A 4HHJA 5EX0A 2AGPA 1RZMA 2DH9A 3LPEA 2VUGA 4KYZA 4KQZA 5J2PB 3I9V9 2MSSA 4NWBA 3H5UA 1JLFA 2B0GA 2YNGA 2D3UA 1V9OA 2C2NA 3IG1A 3K7RA 3DYAA 4QJVA 2ZUAA 3LP0B 4Y65A 4M5HA 1KQKA 1MROA 4ZVRB 5A8KB 3A8EA 4A8MP 2VKZG 1FKPA 3IWLA 4F04B 3AQPA 1N0UA 2V63A 1MMLA 1RABB 3D68A 3HXMA 1SJQA 3PKMA 1GMVA 2KO1A 1MWZA 2QLBB 1FDDA 3FFIA 2C2OB 3BM7A 5J2QB 1U6BA 3BPSP 3ICLA 1RT3A 4C97A 2NR0A 1T3OA 4ZLNA 3M6UA 2GJFA 4TLRA 3SYZA 1HWKA 1XMOF 2R7RA 2D3O1 2IHR1 3CW2C 3NP5A 4ZLJA 4U7UK 1CULA 3BN4A 4USVA 3F44A 4NL5A 1S5ZA 2GAHC 5A0YB 3G71S 4FYDA 5ETTA 3PRBA 3FK4A 3ILOA 3W65A 1TP7A 2ZUGA 4ECTA 2OP5A 1NJXA 1WHYA 1S1WB 2LQ9A 2V9KA 3TUPA 4PXCA 2X1AA 4A46A 1YWXA 3HVTA 3UN3A 4HLBA 3C8YA 4JI5J 3CULA 4A8WA 3IC1A 1JX4A 3UR3C 1TKTA 2ZD1B 1U1MA 4EO8A 2VPWB 4C8KA 2O3DA 4DMZA 1RT7B 3MMJA 4WFAQ 2K8GA 2RKIB 5KG1A 2E7VA 2V8DA 2DO0A 1REVA 4RNMA 4OV6A 3ZZYA 4B9LA 4M5DA 2R8IA 3MPYA 5LXRA 2FQQB 5JUMA 1K1QA 5D4PA 3OL6A 2FVPA 4IO9Q 4NASA 1YTYA 4RUBA 2AJFE 1HNZJ 3VVUA 2VFSA 3X1LB 3PW7A 2HHQA 1FKOA 4QR2A 3M9NB 2QEXS 2XMKA 5HLFA 3GV7B 3HSDA 1N5YA 1TKZB 1IWAA 3G2XA 4K2XA 1FD8A 1U6ZA 4ERDA 1KDNA 4OLOA 4K0KJ 5K8MA 4WCEQ 1X8DA 2F8MA 4O3PA 1KN6A 1S9EA 4DL4A 3NNAA 1SL0A 5AT1B 1T11A 3QIPB 2YH0A 2WVDA 5DGAA 5CXTA 4JI7J 2HZCA 4B3OA 4NLGA 5D0EA 3MM8B 4KGXB 2K1RA 1S77D 1JXVA 1U7LA 4F3QA 1UWBA 1WOSA 5IM0A 1ZM2A 4ZP9A 3M8SA 3UI3A 2ZH5A 2UUCF 2DGOA 3C6UB 3D6MB 1QDUB 2CNNB 2DGVA 2FUG9 4ZJOA 2DHGA 1SC4B 4O3NA 4RPFA 2XMJA 5CD4A 1LWFB 1APSA 3RRKA 1TVRA 3ENQA 4IFYA 4A8QA 3H20A 4RW7A 4KHRA 2K3KA 5KFXA 1H6KX 5B7WA 4P2MA 5C42A 4ZCKA 2RQ4A 2HZAA 1TMMA 2YQ3A 4ILRA 1YJ7A 2DNNA 3CO0P 2CZ9A 3JSYA 1JLCA 5D15A 1C0TB 4P71A 2PEBA 4EGLA 1I3OB 1HNIB 5B0CA 1PC5A 2KRRA 1N6QA 1VC6A 3PYGA 2NZ4A 3MEEA 1X9SA 1PGZA 4YP3A 1U0HA 3G96A 5CCLA 4C3MA 5IQQA 4USHA 4WYWA 3M30A 5F8JA 5A8WB 2N4CA 4FS2A 2XMWA 5C24B 2MYFA 4PWWA 3DLHA 3EWGA 2E1PA 1EETB 3W9HA 4TY8B 2XO6A 4DJBA 3AB4B 4F3OA 3HKWA 2W2QP 1HNXF 4W90B 1ZAWA 2AEFA 1RWMB 2OTLS 4JV1A 2FC9A 5AXLA 1Q78A 1B0PA 4M5GA 4NI2B 2HS4A 9ATCB 2AX1A 2JLEA 2DHSA 1K47A 3KUGA 2BEFA 4CO3A 3ZZUA 4DR4F 1B70B 2CJYB 1NAQA 1GXUA 2V5HG 3AA8A 3CJTA 1F5CA 2DNPA 2ZH3A 2DNQA 2MQOA 2Z2YB 1DZ5A 1SJRA 1DTQA 3UD5A 3NNCA 2RE1A 4ZP7A 2M52A 2A1BA 1QJHA 4TN2A 2P6SA 5DS7A 3LGHA 1FDBA 4MK8A 1IKWB 2ATLA 1XERA 3PFEA 3D67A 2DGXA 2G2YA 3BV8A 2ZHAA 2MDAA 2IY5B 3BGFA 4NX9A 3HFKA 4NLXA 2UUBF 3G82A 2UUTA 1VQKS 2VOPA 1UWAA 1LEOA 4LSNA 3FSXA 1MG7A 4B9SA 5LMNJ 4DR6J 4KGMA 4MIWA 4K4ZA 4C6AA 3TX0A 5B09A 4C8NA 3K59A 4P52A 4CLTA 2HFSA 4YOEA 3CJ3A 1PKUA 5K8OA 4NXNJ 2XMTA 3SFGA 1X0PA 3NAIA 2CXEA 3D0GE 2WB4A 4ZVEA 4KE5A 2R8HA 2VBWA 2UV8G 1X4GA 4EWTA 1NJZA 3K5PA 2E5LJ 4DZDA 2UV8A 4AT1B 3AJ1A 1J5OB 1FVQA 3B4MA 1MNEA 2AGQA 3M8QA 4GC7A 3V6KA 1UP1A 1K1SA 2M7SA 1HYSB 3MM5B 3UE2A 2F65A 3P6YC 1S9GA 1JXLA 2IA0A 1TV6A 2ADBA 2R7OA 1RLCL 1G2EA 4IRKA 2KB2A 1YJVA 3VR1A 2KYZA 3KXDA 3IRXA 2OFGX 1BQNA 3NEKA 2W7AA 1KTVA 4BWJA 3M2VB 5DM7Q 3R8YA 3C2PA 2AIRB 2UXDJ 3S6EA 5GAGU 2HW3A 1KEKA 1IWGA 2D3OR 2ZJRQ 1XK8A 1M1HA 4F3MA 3JQMA 1R27B 2AZ1A 3PJ9A 4MYUA 2VG5A 2E5GA 4IQXA 1BQMA 1AFJA 1LNQA 3HHNB 3OQ2A 3TR5A 1IKXA 3CVKA 1QVFR 4G1IA 1JIHA 1LWXA 2F5GA 4EYIB 3DMJB 5GADI 4I2PA 4AL7A 2Z2ZA 5JXSA 3VWSA 4FDFA 3IBWA 4U67Q 1IBCB 4MJKA 4PQAA 1V6HA 2IJFA 4PG7A 3BGRB 2E9ZA 2YBVA 3V6DA 2J9DE 4PWDB 1HNWF 2GVDA 2FB0A 2QL7B 1CJTB 2W9CB 2HFNA 2XYHB 4F50A 1WDTA 4WFZA 1U1LA 3MZIA 4ED5A 1Y5IB 1NKEA 1ROFA 4JI0F 4OI1A 1QVGR 1I94J 4LFBF 2B7CB 4XDCA 5EHHA 4DR3J 2H4WB 1WG1A 1U45A 2HQDA 2ZBIA 5F8GA 1SKUB 5E2QA 1U4BA 4Z37A 1TL1B 1JJ2R 1CS4A 2XMAA 2F63A 2Z0GA 3KLFB 1AZSB 2V8VA 2VBZA 4YB7A 1DURA 2IC3B 2LVWA 3OTBA 1FI4A 4DR2F 1J27A 2YQ0A 3SV4A 3DOKB 2EFPA 4AL6A 3H2UB 1WKLA 4G1PA 1VS3A 2J0WA 4QIGA 2HIYA 1SCJB 3PZPA 4B3RJ 3R5BA 3OUYB 4R5PA 3DGPA 1CJKB 3D6HB 3A8JA 4A8OA 1FJEB 4YFUA 3M32A 2AT1B 3KFWX 1RWNB 1W26A 4H4KC 1Q7LB 3PDNA 2BM0A 1R0AA 3H90A 4ZHRB 1TL7A 4ZK7M 3SCLE 2QN6B 2YKPA 4OJHA 2W24A 1RISA 1NHUA 2VFUA 2GZOA 2CPDA 5T7LA 1WC4A 3HD1A 3Q8VA 1IN0A 3J81j 4JOUA 1WC5A 4P2FA 4IKAA 2UUAF 3ZNJ1 2UXCF 1C1CA 1Z1ZA 2O5DA 5LMUF 4F0KA 3PR5B 2FJDB 2AU0A 2J6UA 4DFJA 2G1HA 4CLWA 4RW6A 1XQIA 3TJ9A 3EM1A 2Q43A 4I2QB 1SIZA 1M5VC 4UQTA 2ROGA 2Y9HA 1SV5A 5DZ6A 4L76A 4ZVHA 1TZ0A 4Q0BB 1M5OC 4K59A 3W64A 2APOA 3BS9A 2WW8A 4ED6A 3PNIA 2V8HA 2XGPA 1FRLA 2ASDA 4JI6J 3GLJA 4DPXA 2Q3PA 1U09A 1RJJA 3OSPA 1N5TA 4RW4A 1EP4B 1MN7A 3UFCX 1UFWA 5D3GB 2D3ZA 1JNZB 4N77A 1M5HA 2I9SA 2HSEB 2GMHA 2LP4A 1NK9A 2CDQA 3OVSA 2BM1A 1X4FA 1FD2A 4Q5VA 2QMWA 4OHZA 2YNIA 2HZVA 3KK3A 1Y3JA 5LSRA 3IM8A 1LK5A 3DU6A 1YRXA 4F4AA 1Q95G 4PZVA 2MZSA 2GVZA 3M9MB 2XLIA 4EZ9A 5F8NA 2BABA 1S4EA 3EE3A 2HAIA 4OI3A 3CXCR 5CCMA 1ZS6A 3LP1A 1U0SA 2HYIB 2KM8C 1VQPS 1FJCA 5HO4A 3ZTSA 1VQ7S 5IT0A 3GE9A 2OIHA 4JI1F 5KFKA 1IBLJ 2OPSA 1DAXA 1GTHA 2HS3A 5JJBA 1IVZA 1H2TZ 3QZ8A 4WKRA 4ECXA 1BY9A 3I5CA 5J2NB 1Q8IA 2XMUA 1IBKJ 5IT9Y 1T95A 4DUYJ 2HBQB 3MHYA 3GJTB 3UCGA 2ZH2A 3GJSB 2NSCA 2N4DA 2RQCA 2L3MA 2HWIA 4WWSA 4K5SA 2ZM6J 3MMCA 1RT2A 3H40A 4OX9J 1T7PA 3JAMY 3O2IA 4DN9A 1HWJA 3CJRA 5DO2A 3FEXB 2MSTA 2GIQA 2MJUA 1S9FA 1U24A 4G3IA 5IFMA 1FRJA 4BC9A 2XI3A 1ZA1B 5F9LA 3CO9A 3G87A 3LAKA 3PEHA 4RKUC 4YB6A 3UVJA 3RR8A 4JI5F 2CQGA 3X3UA 3PIOQ 3NWGA 3RGIA 5ETPA 1R0CB 3I55S 2RDDA 1JK9B 4K50A 2H9ZA 2QMUB 3TANA 3BO3A 2J0XA 1EAYC 2ZKUA 3A1YG 3DKDA 2RNEA 1DQ8A 1IR2A 2ZBQA 2UVUA 3KJFB 1IXKA 1KKHA 3MD3A 1YITS 1V5VA 5GVQA 1KP6A 5E7OB 1PCAA 3ZO7A 3RW6A 4DG1A 2HHUA 1HFEL 3QO9B 1T03B 1LOUA 2VQEJ 4X84A 4ZS6A 1S1TA 3CGIA 4EUVA 1VCTA 2V2ZA 4CO0A 2W01A 3K8WA 3TOQA 3NBPA 4DX7A 2R4FA 2CQ4A 3J7AN 1UPMB 3IBCB 4YMEA 2E66A 3QMQA 7FD1A 4QWAA 4LREA 4K0KF 4WFBQ 1QUVA 1S1VA 2GC8A 3RBXA 4R8UB 3OR2B 1HBNA 4PYAA 3BF4A 3TI0A 3MR3A 1N32J 2VG7B 2KXFA 2DPJA 4RW9B 2BANA 1JB0C 3K89A 5K9FA 4LMZA 1GXLA 4J9RA 1HD0A 3BGLA 4JI7F 3NMAA 4O0IA 1NLKL 3DM2B 3Q24A 3HK2A 3N5FA 3P3DA 2KXNB 2YNFB 2FJWA 5K8PA 2QMXA 3D3CJ 3DCAA 1D9DA 3CTRA 5DDQC 5KT4A 3J81Y 3MXHP 2D41A 3KG1A 3GB0A 2F4FA 4WE1B 2YXLA 3KK2A 4WK1A 5KFIA 3B78A 2Y0BB 4CM2A 3PW2A 2IAJA 3VV2B 2A6OA 4FBUA 1EB0A 2AJ1A 1S0VA 1VBZA 3T5LA 2QGFB 3PRDA 3WQPA 1QD1A 2W9BB 4OZJA 2GV1A 4OYPA 4A8FA 2WAQD 1PJ5A 1P27B 3R2DJ 1YRTA 1RAFB 1O5JA 4DHVA 1R8AA 4HI1A 2P6TA 3I82A 1PBUA 3MEGA 3MAAA 2WOMA 4HTJA 2Z2MA 3MOJB 3GIKA 2B8PA 3VF0B 1AT1B 5SUHA 3RAMA 4MT1A 2DIVA 2MXYA 3DI6A 5HQLA 4C0BA 2XG8A 3Q83A 6FDRA 4FPIA 4ID5B 2E1AA 2PFFB 3IS9B 2RH3A 4DF8A 1F5AA 4JV0A 2K3IA 1QTNB 1W7WA 1T3NA 2X1FA 4C3LA 5KFCA 2L9DA 1DQAA 1GK8A 2DR8A 3GFZA 3WX8A 1H98A 2IYIA 4PG8A 4EO6A 4PXBA 4EK2A 4U8YA 1B4SA 1WC6A 2MHNA 1AXQA 2HNDA 2PMWA 4LQ3A 1FEHA 3HKZD 5D4OA 3W2VA 2JC1A 1LK7A 1AYEA 2AQ4A 4DX8H 1NDPA 2H5EA 2DKOB 4ED8A 4FNHA 4NRTA 3US5A 4LF1A 4B9UA 2HQFA 2XC9A 4HVZA 3HDSA 1VQNS 1JLFB 2B9YA 2YNGB 1NDCA 3FBBA 4UZCA 2OD6A 3BZQA 3NOCA 2L9WA 1EZZB 5BYRA 4NLWA 4KFBA 1RTJA 3ZZTA 4CLZA 4DV1J 5KFRA 1N33J 4ZPDA 1FKPB 3RRGA 1UPPA 4E98A 5LXYA 3V6HA 4F8RA 1Q7YT 2YPYA 3BEGB 4J90A 1WF2A 2MLXA 1VQ8S 2X1GA 3FFIB 4ZP8A 4ZJLA 3IBFB 3PW5A 5FD1A 2MQLA 1L5UA 5KFSA 3MPDA 3H25A 1GMWD 1RT3B 2B6AA 3LP2A 3WX4A 2ZEJA 1Y9OA 1F60B 4K4SA 4F7VA 3TUIC 2DNKA 2EC0A 1S48A 4LF5J 2H1YA 1BXNA 2RU3A 3SCIE 5A8RA 1KNZA 2HLTA 4PRFA 2C3PA 2VICA 4UY85 4F0HA 3QQCD 1JKHB 1DJ0A 2LMIA 3D2WA 3CC2S 3FMBA 5LMNF 4DR6F 1S6UA 3HVTB 4DSFA 2CA9A 5I3PA 4OJ1A 1U48A 4C3KA 4FF1A 3D6FB 2AJ4A 3SQGA 2WK4A 4NXNF 1LKZA 4C8OA 2BBEA 5HP1B 1ZTTA 1N5SA 1UMJA 2BR0A 4QR1A 4CLFA 2QX0A 5HI7A 2G0CA 2E5LF 4CNYA 2OTJS 1B7YB 1K73T 1X4AA 5E0OA 4LFCJ 4HDGA 5D0GA 3I56S 2ZBPA 4U9RA 1U2FA 4DPUA 4M5DB 1NDKA 1DLOA 1XWLA 4UZBA 4HL9A 2HHTA 5ETVA 1YBUA 2JSXA 2QL9B 3MD1A 4R0JA 1GMWA 1WSVA 3DLEA 2FIUA 3BN7A 1FKOB 1X5TA 2A0FB 1SQGA 4IFVA 3CCVS 5HLFB 2HEKA 5D77A 4DSEA 2FJXA 1N5YB 2I38A 2I6WA 2ZVIA 2B56A 1Y5NB 1LQ9A 5THWA 1KQSR 5CA5A 1RHKB 2OPQA 3IGNA 1KBRA 3CCJS 3PCOB 1S9EB 4N8OA 2W4PA 1L3VA 1XTZA 4DV2F 4ECVA 2FTRA 3PO5A 1OWXA 3BGUA 3T1YJ 1OY9A 2RUSA 4UQGA 1V5IB 3JXOA 4IOCQ 2QYCA 4B3OB 4CTAA 1BC6A 5DLFA 3CB4A 2K1RB 2CPFA 2D69A 1Y5LB 2MY8A 5BYQA 2B4OA 1UWBB 3WDOA 5IM0B 1F1BB 2CQPA 1VQOS 1U8SA 2ALYB 4L6V3 2J9EA 4B9TA 2Z58B 4WFNQ 3CCWA 3JYTA 1P1TA 4OX7A 2IM2A 1VIXA 3RRHA 2R7XA 3SSSA 3HHDA 3PX0A 4Q8FA 1TVRB 2H65B 4J9QA 5KG4A 4IFYB 1HARA 1B7FA 4RW7B 3EGVA 2BQRA 1ZZNA 1I94F 1RAIB 3Q22A 2BJEA 4DR3F 3MEKA 1HBMA 2V69A 2VOOA 3G6XA 1YI2S 3UPFA 3PV8A 1ZAXA 1WOPA 1KHWA 5E3CA 2Y1RI 3PJWA 1K0VA 1UW4A 4GVBA 2XY6A 2LXFA 2E1RA 1D9FA 2EVZA 1WDDA 1JLCB 4F4WA 4LSZB 3TO8A 5LT5A 4W4MA 1CQNA 1VC0A 1N6QB 3MEEB 1RYRA 1S6PA 3GCWP 1U0HB 2OPPA 3SDEB 1YRUA 2DBBA 1VQ9S 2RT3A 2UU9J 4B3RF 3D9BA 3POTA 3CJ5A 1S0MA 4X4SA 2GX8A 4MKAA 4HDHA 3OTOJ 3N79A 3CWJA 1KC8T 2V2QA 3QT8A 3TVZA 3NCQA 4O4RA 4Y00A 3CCTA 2NLWA 1NK4A 2EFNA 1O6XA 2P8IA 3G6YA 3RB4A 3DOMB 1T02A 3U1MA 5HVHA 2MQNA 3R1LA 2QYGA 4J9KA 1TQLA 5LSLA 3L4BC 2F9DA 2FD2A 3NGTA 4ICLA 1SPBP 3G86A 1YGYA 3LGNA 4P73A 1LXJA 4UF4A 2MY7A 4IYQA 1X4BA 4Y2MA 3C6TA 1Y7PA 1RWPB 1I6JA 3GR1A 4AD6A 2HK2A 4NLDA 3EPGA 1J5EJ 4TU8A 1DTQB 1YJNS 2VJVA 3ET6A 2CJXB 5AE2A 4DCJB 4HH0A 3EICA 3MDFA 4YY3J 1VMBA 2R2TA 1X9MA 4ELTA 2P9EA 2JZ5A 4NZ0A 2VDHA 2OJ3A 3NLCA 3N6MA 1XR6A 4MKVA 4JI6F 3JSMB 3JSBA 1DTTA 4NXMJ 3W9IA 1SUQA 4X4NA 3G82B 5CYQB 3IMQJ 4LRDA 3FUYA 4MIAA 2M9KA 2CIMA 3TP2A 3M1VB 4TLQA 1P9YA 4J91A 2J7WA 2LQBA 1NRKA 3CJSA 1LWCA 4K2JA 3HO1A 1SJFA 4WYLA 1RTHB 4DPTA 1Q4RA 3IM9A 1FVSA 3MR2A 3FRYA 1VISA 2YKAA 2AJQA 3C14A 3CD7A 2MLYA 2VV5A 2JEJA 3EYZA 2R42A 3UDLA 4OFZA 4OYMA 3SSRA 4F4KA 1OSDA 4S0MA 4LR9A 2BE9B 1NHVA 3B82A 1QAXA 3QFWA 3OTDA 1I51B 5KT7A 4ETXA 3M8QB 4O3OA 1D8ZA 5AE1A 2KL8A 5FJ4A 1RBOB 2HVDA 4ITSA 1IBKF 1E6YA 2CJAA 4YR2A 3OJUA 4DUYF 1KRPA 1S9GB 3B6BA 4CZCA 4WBFA 3V81A 1FXRA 2DITA 3TJ8A 2DCLA 4KRWA 3CMAS 4FYWB 1VK8A 3P96A 2ZM6F 1UA0A 1FWPA 3ZZ0A 2MQMA 4OX9F 3SIPB 3GP9A 5I3UA 2EK1A 1S1UA 1QUPA 3HSZA 3IRXB 4OI4A 2Q79A 2Y0SD 3R5AA 4OIXA 3AD7C 1BQNB 4OYOA 1S4FA 1U1KA 3FBEA 4X4QA 1NPKA 1FRMA 4N7TA 4M63A 1TFWA 1NB7A 4PPDA 2WB1D 4OX8A 4AXIA 1NJIT 2ZH4A 2I1RA 2XCAA 1V3ZA 1A7GE 3BYRA 5C2GA 2HS0A 3BSAA 2H51B 2R8JA 1KOOA 1MWYA 4B08A 1HR0J 2JLFA 1IR0A 2VG5B 5J2MB 4JB8B 1FK9A 3H5XA 3ELHA 4ECSA 2KT3A 4K4VA 2QLXA 1IKXB 1U49A 2PT0A 2AW0A 4FVCA 1D1UA 1RT1A 3TVKA 2MKJA 3NOGA 2D9OA 3D1OA 2KVQE 4FVMA 2RDIA 1VRQC 4KC5A 2E1MC 2DNOA 2I5JB 3LW5C 4ED7A 2P9GA 2JDJA 2VQEF 2AZ3A 4NLQA 2DY9A 1YIJS 1Q5YA 2IMOA 2HHWA 2E5HA 3HJFA 2A18A 3R3TA 3AAWB 3RJMB 4KH0B 5H9FJ 3NGRA 4KY3A 5KTQA 2FVCA 2KRBA 4LF8J 3R7SB 4AL5A 2KHDA 2JRSA 2W2PP 3TEHB 3BO4A 3J7Z5 3J80U 1ZZFA 3GYGA 1N32F 1UZHA 1F9EB 4ZIVA 1WHVA 4FP9A 4GMKA 5DETA 3A8IA 1HI0P 2FGOA 2C3UA 3KNGA 3E3XA 3L09A 3UDCA 3LALA 2YKNA 1N8RT 1TR0A 4DF4A 4KV8A 1CS4B 1ZOTA 1RA6A 2DT9A 4O3RA 4PXDA 1ZTWA 1AUSL 4F02A 1BUXA 3MUMP 1JLEA 2WBRA 3NXZA 1BWEA 2GMLA 4QZVB 4A8KA 3ONQA 2XGQA 4R5PB 2ACYA 3KDOA 4I7FA 3DGPB 2C2RA 3RU0A 3ZNUA 1JQGA 3MECA 1TKXA 3CCLS 3QRQA 2IJNA 3SBMA 2ASLA 5ETLA 3M32B 4L72B 2JEFA 2EG1A 3QWPA 1R0AB 1TL7B 2IBKA 2LEAA 5DGBA 4G65A 1TL3A 1WD6A 5H9FK 4AQYJ 2XO7A 4OZ3A 4LBPA 8RUCA 2V9WA 5F41A 5HANA 5AXMA 3QT6A 2FGCA 5L9XA 2Y1LB 3ZTRA 5T7LB 1S76D 1KLNA 2EKYA 5ITHA 2FJBB 4LF4F 4DCPB 1UVIA
chains in the Genus database with same CATH topology
5AJ3J 4YY3J 1HR0J 3J7AN 2UXDJ 2UUBJ 3D3BJ 4OX9J 4YHHJ 1FJGJ 4NXNJ 2UU9J 4LF5J 3R2DJ 1HNXJ 4X62J 1XMQJ 4LFAJ 4HHUA 4B3MJ 1N34J 4X64J 5IWAJ 1XNRJ 1N36J 2KL8A 1HNWJ 4LF7J 4JYAJ 4DR5J 1IBMJ 4B3TJ 3OTOJ 4DV5J 2KVQE 4DV6J 1N32J 4X66J 2E5LJ 4GKJJ 4NXMJ 3W1YC 2UXBJ 2MEWA 4JI3J 4DR7J 5FLXU 3R2CJ 4B3SJ 4DV7J 4PWWA 4JI1J 4KYZA 1HNZJ 4JI0J 2VQFJ 4DV2J 4DV4J 4DR4J 4DV0J 4DV3J 4JV5J 3IMQJ 4LFBJ 4GKKJ 4DV1J 1XNQJ 4LF9J 2MQ8A 4LF6J 1N33J 3T1HJ 3J81U 4B3RJ 4KY3A 4DR1J 4RJVA 3D3CJ 1IBLJ 4K0KJ 4LF8J 4LF4J 2UUAJ 3T1YJ 5BR8J 5IT9U 2UXCJ 4JI2J 4AQYJ 4JI6J 3J80U 2F4VJ 1XMOJ 4JI5J 1IBKJ 5LM7E 5LMUJ 4NEYA 2HHHJ 4DUYJ 5LMNJ 4LFCJ 2VQEJ 4DR6J 4JI8J 5A2QU 4X65J 1J5EJ 4DR2J 1I94J 4JI4J 4DUZJ 4V1Ak 2MTLA 4NEZA 4KHPJ 3JAMU 4DR3J 4JI7J 2UUCJ 2ZM6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 J;  4YY3 J;  1HR0 J;  3J7A N;  2UXD J;  2UUB J;  3D3B J;  4OX9 J;  4YHH J;  1FJG J;  4NXN J;  2UU9 J;  4LF5 J;  3R2D J;  1HNX J;  4X62 J;  1XMQ J;  4LFA J;  4HHU A;  4B3M J;  1N34 J;  4X64 J;  5IWA J;  1XNR J;  1N36 J;  2KL8 A;  1HNW J;  4LF7 J;  4JYA J;  4DR5 J;  1IBM J;  4B3T J;  3OTO J;  4DV5 J;  2KVQ E;  4DV6 J;  1N32 J;  4X66 J;  2E5L J;  4GKJ J;  4NXM J;  3W1Y C;  2UXB J;  2MEW A;  4JI3 J;  4DR7 J;  5FLX U;  3R2C J;  4B3S J;  4DV7 J;  4PWW A;  4JI1 J;  4KYZ A;  1HNZ J;  4JI0 J;  2VQF J;  4DV2 J;  4DV4 J;  4DR4 J;  4DV0 J;  4DV3 J;  4JV5 J;  3IMQ J;  4LFB J;  4GKK J;  4DV1 J;  1XNQ J;  4LF9 J;  2MQ8 A;  4LF6 J;  1N33 J;  3T1H J;  3J81 U;  4B3R J;  4KY3 A;  4DR1 J;  4RJV A;  3D3C J;  1IBL J;  4K0K J;  4LF8 J;  4LF4 J;  2UUA J;  3T1Y J;  5BR8 J;  5IT9 U;  2UXC J;  4JI2 J;  4AQY J;  4JI6 J;  3J80 U;  2F4V J;  1XMO J;  4JI5 J;  1IBK J;  5LM7 E;  5LMU J;  4NEY A;  2HHH J;  4DUY J;  5LMN J;  4LFC J;  2VQE J;  4DR6 J;  4JI8 J;  5A2Q U;  4X65 J;  1J5E J;  4DR2 J;  1I94 J;  4JI4 J;  4DUZ J;  4V1A k;  2MTL A;  4NEZ A;  4KHP J;  3JAM U;  4DR3 J;  4JI7 J;  2UUC J;  2ZM6 J; 
#chains in the Genus database with same CATH topology
 1TAQ A;  4O0N A;  2VH7 A;  1C1C B;  4YN3 B;  1YBT A;  4MAK A;  4WII A;  4ES1 A;  2OEL A;  4DI6 A;  5M2U A;  2VA2 A;  1WG4 A;  2AD9 A;  1OS5 A;  2J0Q D;  3AT1 B;  4QIV A;  4MTP A;  1IBM J;  4NYO A;  5KFF A;  3VAL A;  3GU0 A;  2B9E A;  1VBY A;  4CT8 A;  2KZZ A;  4F25 A;  2FLL A;  2B4V A;  3D7S B;  2ZNY A;  2AYG A;  2XWX A;  4J5O A;  1TFY A;  2DXD A;  2BDP A;  4IH7 A;  1H0H B;  4PUO B;  3T1H J;  1UKU A;  4RW4 B;  1HI8 A;  2ZVS A;  3OHA A;  1SC3 B;  4ETZ A;  1QSY A;  3M6W A;  4JV5 F;  3EUN A;  5GAH U;  4Y0F A;  3OLA A;  4OHV A;  2XS2 A;  1FE4 A;  3GFH A;  3UDE A;  1JXE A;  3QT5 A;  2H5I B;  1FWL A;  1BWV A;  2YNI B;  5F8I A;  1NK7 A;  3BO2 A;  1GNK A;  3EXC X;  1NSQ A;  5J2P A;  3KK3 B;  1RAJ A;  2IM1 A;  1YDL A;  4DV1 F;  1T9X A;  5B0B A;  3CDB A;  1N33 F;  4WPA A;  3QJL A;  1RBA A;  1Q8K A;  3HSG A;  4FKX A;  4X4V A;  2N7Y A;  4G6V B;  3LP0 A;  5C7P A;  2GVZ B;  2CQI A;  2OLW A;  3MM6 A;  1HA1 A;  1EJ7 L;  1PYT A;  3E51 A;  2E29 A;  3LP1 B;  2M2B A;  2M0G B;  3BQ2 A;  4EEY A;  3OXL A;  4ED2 A;  3MR5 A;  3NMR A;  3QWU A;  3W63 A;  3UN2 A;  4DLG A;  1OO0 B;  5EDW A;  3KLV A;  3RW7 A;  2MKI A;  4QQB A;  3EZ5 A;  1RI7 A;  2OPS B;  1X60 A;  4DSL A;  1SBR A;  3FC9 A;  5HJX A;  1NZ8 A;  2ALZ A;  3AD8 C;  1ELO A;  2QA2 A;  5J2Q A;  3DFE A;  4X4O A;  1T9V A;  4LF5 F;  1A0O B;  1KWM A;  4Y2A A;  3Q8U A;  3DRS B;  1T9Y A;  5DQG A;  5CYJ A;  1VHF A;  3MMC B;  1RT2 B;  4I6W A;  3N6N A;  9RUB A;  1V3R A;  1Q5V A;  5A0Y A;  1C2P A;  2R7Q A;  4DUZ J;  3OBI A;  3DOL A;  2KFY A;  1REG X;  5AJ3 J;  5CH7 B;  3UVJ B;  2ZFH A;  1NDL A;  3T5J A;  1NSA A;  1S97 A;  4ZCI A;  2YX7 A;  5K8N A;  3QRP A;  1FHT A;  3BDE A;  4CO2 A;  1VQ4 S;  2KJW A;  1TU0 B;  2RHQ B;  4IDK B;  3A3N B;  4PAB A;  2ATC B;  2GNK A;  2W25 A;  4LFC F;  3R7B B;  5FLX Y;  1S99 A;  2YQ1 A;  1YZ7 A;  2DR9 A;  2EFV A;  2ZD1 A;  1FTC A;  2L48 A;  1HHQ A;  4UUW A;  4DS4 A;  2IRY A;  1RTZ A;  1SQE A;  1NUE A;  2RUG A;  3T19 A;  2EEY A;  1ULR A;  2RKI A;  2PO4 A;  3NCP A;  4KHM A;  1RUS A;  1X4E A;  1Y3K A;  3M8P A;  4MH8 A;  1S1T B;  2NXU A;  2X51 A;  2RHS B;  2VAS A;  3NBP B;  4ZPT R;  3DDK A;  1HWI A;  2KDO A;  2B5J A;  3LQV A;  5KT5 A;  3T6J A;  4OJ3 A;  1HBO A;  3TAP A;  3B8H A;  2O67 A;  1HQU B;  2EI5 A;  1FXD A;  1VBX A;  2HK3 A;  4MFB A;  2ACM A;  4OHW A;  3DDI A;  2YTC A;  2RB7 A;  4UST A;  5L1K A;  3NS5 A;  1HBN B;  5KFM A;  3KWM A;  2MB0 B;  2ILY A;  5KFP A;  2Y8Y A;  1N88 A;  4Z7C A;  3CMQ A;  3C3L A;  3K5L A;  5KFW A;  2BAN B;  3T1Y F;  1URN A;  1W2B R;  5T14 A;  1URR A;  4F26 A;  3U1L A;  2BJD A;  5CAA A;  3GG0 A;  5I4M A;  2Y3Y A;  2MEW A;  4ZKA A;  4DSK A;  1IJE B;  3WBZ A;  3M4X A;  3Q8Y A;  1HHS A;  3MMB B;  4EBE A;  1PG5 B;  3BH6 B;  3MMA A;  5KG7 A;  2RRB A;  2MZQ A;  3V2U C;  1VI7 A;  3VHQ A;  4ZCM A;  3KK2 B;  4CWB A;  2IAJ B;  1FFG B;  5L1L A;  1U1O A;  3F0N A;  3O5T B;  1EIY B;  2CPJ A;  5BR8 J;  3H4B A;  1QSL A;  1HIY A;  4OV1 A;  1T05 B;  2VA3 A;  1FDA A;  2E5J A;  2VOD A;  2FVQ A;  3ISZ A;  3MUV P;  4EYH B;  5DZ7 A;  3JTP A;  3VZI A;  1H74 A;  2CWK A;  3MEG B;  5KFE A;  5IV4 A;  2BOA A;  1IQT A;  3RB6 A;  5KFT A;  4QU7 A;  3I31 A;  1D9A A;  1XR7 A;  1HWU A;  3NGU A;  4ZVQ B;  1CPZ A;  3PVX A;  3OVA A;  1W2I A;  4OYA A;  5GAE U;  1KON A;  3KUH A;  4Y28 C;  1XIQ A;  2CQC A;  2WBM A;  3A13 A;  4B3S J;  2QFJ A;  4URQ U;  1VRU B;  3WHI A;  4ZN1 A;  1JLB A;  4F0M A;  2QC3 A;  1HKA A;  2XHC A;  3OR1 A;  2CKW A;  2GFF A;  1UVL A;  3MM7 A;  1MW7 A;  1VQL S;  1VIO A;  2DRD A;  2LQ8 A;  1HNI A;  4ILM A;  5KOW A;  2UU9 F;  1FDN A;  3OXG A;  3F56 A;  3KJV B;  4C98 A;  2ZH1 A;  2H5J B;  2ROE A;  2F9J A;  2HFU A;  2HND B;  4RLE A;  3OTO F;  2GAG C;  1P8G A;  4A8X A;  3GIR A;  3GTY X;  2CVE A;  2PE8 A;  2YPZ A;  2BJ1 A;  2GHV C;  5DM6 Q;  4JI8 J;  2VON A;  4AFF A;  1RWU A;  4UY8 T;  4M5N A;  4JI4 J;  4F36 A;  4ZIT A;  4KHP J;  1VQY A;  4TY8 A;  3HLU A;  1JLG B;  2HGL A;  4OQJ A;  1UEK A;  4NCG A;  3ITH B;  3BRE A;  1WG5 A;  4PR6 A;  4KFB B;  1RTJ B;  2QL5 B;  4NLV A;  2IM3 A;  2CYY A;  3A4T A;  2YVS A;  4J9N A;  2HAF A;  2DCU B;  3MFH A;  4WU3 A;  4ED4 A;  3UDV A;  2HQ3 A;  4FZV A;  1FER A;  1BMQ B;  3VAJ A;  1J5E F;  4DFK A;  3R7N B;  3NCR A;  3BBB A;  4RU9 A;  4EFA C;  2GHP A;  4YY3 F;  3BYP A;  2X3D A;  3M8Z A;  3H5S A;  5HJY A;  3MFI A;  2HMI B;  3PHT A;  5KFU A;  4M5J A;  3ZTO A;  2QO3 A;  3PY8 A;  1WNE A;  2VBX A;  5K14 A;  2B6A B;  4W92 B;  4KPY A;  2DXF A;  1L3U A;  4NXM F;  1VQ5 S;  4TQR A;  2VHG A;  3RBZ A;  3KHH A;  4IR9 A;  4C4W A;  1S6Q B;  1U26 A;  3EXY A;  2DR7 A;  2B43 A;  4ES2 A;  4CO1 A;  2RRA A;  4QR0 A;  2BRK A;  3BQ0 A;  5I42 A;  2DNM A;  3GCX P;  1F0X A;  4O3S A;  5HMX A;  1UEU A;  3KYL A;  2XYG B;  1U2R A;  1P9Q C;  3AFG A;  2BJ7 A;  1Q86 T;  3IAM 9;  3QYY A;  3GR0 A;  4J9S A;  4N5S A;  2ERR A;  2K7K A;  3I9Z A;  4ECZ A;  3DN9 A;  1V3S A;  2MKC A;  2HHX A;  4ZJQ A;  2LEP A;  2FJE B;  1QAY A;  4LIR A;  3HD2 A;  3IFE A;  3OHB A;  1CJU B;  1RK8 A;  3HUL A;  3KLE B;  4WP8 A;  1U25 A;  1R8H A;  2YKO A;  1LWE A;  2RS8 A;  1DLO B;  1VK3 A;  1RKI A;  2G9O A;  3SXL A;  4M5I A;  2ZWP A;  3D28 A;  1IR1 A;  3TAQ A;  2PC6 A;  2EK6 A;  3DLE B;  1QTM A;  3K58 A;  3MWB A;  4LRC A;  2AHO B;  4IFV B;  4ZA1 A;  2DNR A;  3MM5 A;  4HEA 9;  2XHW A;  5CD4 H;  2F8E X;  2HNY A;  4ZLP A;  2HIQ A;  2Z8Q A;  1YK9 A;  4MKB A;  2OPQ B;  3P5B P;  1WEZ A;  4ZVU B;  1EKS A;  2W2N P;  2IPO B;  3THV A;  3TAM A;  4XPC A;  1NK0 A;  5CYM B;  3LAM A;  2NRE A;  1YZ6 A;  1RTI A;  5KG6 A;  3M2U A;  1LFP A;  1UA1 A;  3SZ2 A;  1HR0 F;  3KLH A;  3VGS A;  3Q2T C;  2LU1 A;  2OH2 A;  3NRB A;  5HVF A;  4CTA B;  1RYS A;  1T94 A;  3QAE A;  2QG9 B;  2BX6 A;  2VFR A;  2O66 A;  4C8L A;  2C3Y A;  4ER8 A;  1FWK A;  2PI4 A;  2IVM A;  3VAK A;  2IBO A;  1KTQ A;  5HN0 A;  3ULH A;  2R7S A;  1C4C A;  3JB9 k;  1H7W A;  2MJN A;  3FVY A;  3KLG A;  2ZJQ Q;  3QID A;  1S6O A;  4NLP A;  1PAE X;  4OYB A;  4OL8 A;  2UUC J;  2ASY A;  4PKD B;  2GHW A;  3HHL D;  1NK5 A;  3HVW A;  3OPK A;  4QYR A;  3R9L A;  3TYT A;  3BGR A;  3VVT A;  4LF8 F;  3TZY A;  2RDJ A;  1DFD A;  3TEG A;  1M5P C;  2ROP A;  1X31 C;  3KMQ A;  2BJ9 A;  1HBM B;  2RIL A;  3N5B A;  3VGV A;  4LBH A;  4O3Q A;  5AE3 A;  5HAO A;  5IWA F;  4L3K A;  5E3A A;  4A48 A;  1B0V A;  4GVB B;  5E41 A;  1MSW D;  3R1H A;  3H59 A;  2FVR A;  2XY7 A;  5ETK A;  2MQQ A;  2DRA A;  2HFO A;  3GYN A;  4M5L A;  2BW2 A;  2W7P A;  2D74 B;  4CLK A;  3GJR B;  1RLD A;  2FC8 A;  3G6E S;  1CC7 A;  1T9U A;  5F8L A;  3ZC4 A;  2XZT B;  1S6P B;  4O44 B;  1UZD A;  2OPP B;  4JI2 J;  4PWU A;  1LW0 A;  4NPO A;  2F4V J;  1HQ2 A;  4ZP6 A;  3ENV A;  2HBR B;  5DJB A;  5D6G A;  1GT8 A;  3HPO A;  3POT B;  1SXL A;  4K5R A;  2VG6 A;  2DEJ A;  4LT6 A;  2XM3 A;  1M1G A;  3KHG A;  2CG8 A;  4IG3 A;  3QPI A;  2VJU A;  4NZ7 A;  4EBD A;  2DRB A;  2ZH9 A;  2HNZ A;  4J9L A;  3OUY A;  2QLJ B;  4HT5 A;  1KR4 A;  3MM9 A;  3S8S A;  4NCA A;  2J7U A;  3OV7 A;  3HP6 A;  3HHL A;  2JJ4 D;  4AQY F;  5F8M A;  4Y2K A;  2JX2 A;  4EMD A;  4ZHR A;  1CSJ A;  5D78 A;  2QSF A;  3BKT A;  5EWF A;  4RNF A;  4USM A;  1RE1 B;  1RWW B;  1Q1K A;  5J1E B;  3QSY B;  4RZR A;  3NGS A;  4PAA A;  2PDA A;  2VDI A;  3CME S;  3C6T B;  4RJV A;  2COL A;  5K5M A;  2EKN A;  2FLP A;  4ZPV R;  2DGU A;  3ET6 B;  4HH1 A;  2YX1 A;  2MKK A;  3RAX A;  2MZJ A;  4DQR A;  3HF5 A;  4DPW A;  1IKV A;  1T9T A;  1FT8 A;  3VAF A;  5CQG A;  4I0W A;  2AYM A;  1OIA A;  1UVN A;  4TNO A;  1Z2L A;  1R8B A;  2F8H A;  3T1H F;  4Q0B A;  1DTT B;  2CVI A;  2VIH A;  1SUQ B;  1VDH A;  3QBC A;  3GFX A;  2XSJ A;  1OPI A;  1UJ5 A;  4AND A;  4TU9 A;  1U47 A;  1QAI A;  1XEZ A;  2SXL A;  1RAH B;  5F0U A;  4YS2 A;  5D3G A;  4NA1 A;  1FXL A;  2BA9 A;  1X9W A;  4B3M F;  1LWC B;  2F40 A;  3DLK B;  4CIO A;  1DRZ A;  4DQQ A;  2KU7 A;  2N82 B;  2V94 A;  5B0A A;  1NH8 A;  1X5P A;  2B51 A;  2W4C A;  3C14 B;  4OJG A;  3ISN D;  1RHJ B;  3J7Y I;  2RF2 A;  5C25 A;  2C2D A;  2J9D A;  3O44 A;  3PXG a;  2CQH A;  3Q89 A;  3KK1 A;  1GTE A;  4I68 A;  3GFY A;  1DY3 A;  4GRS A;  2A10 A;  4QIW D;  3OL7 A;  1HQE A;  4V19 J;  4ZVS B;  4GO7 X;  2VD3 A;  4X2B A;  1HNV A;  1U02 A;  2QT7 A;  4USW A;  5DLG A;  4C9D A;  3HHL C;  2DPI A;  2BQ3 A;  1OQ3 A;  3Q8S B;  2YWG A;  2C1E B;  4NEZ A;  1NK8 A;  4B17 A;  2GMJ A;  4I4B A;  4URS A;  4HHH A;  4GVL A;  2E1C A;  4NLT A;  1M5K C;  2JH3 A;  3AY0 A;  3RB0 A;  4QCL A;  1E6Y B;  1X0F A;  3RBE A;  4N47 A;  3G8T A;  3ZFV A;  1PJ7 A;  4KR0 B;  4RNH A;  1R89 A;  2KG0 A;  3HT0 A;  1NSK L;  5J2N A;  2UXB J;  5C2C A;  4ZVF A;  1Y4Z B;  5I3U B;  3N6L A;  1S1U B;  2KYX A;  3OTC A;  2VQF J;  3MCO A;  4WP9 A;  4DV0 J;  2K2P A;  4EI2 A;  1VR6 A;  4DUZ F;  3J7Z T;  1S59 A;  2DGW A;  4DLE A;  1IM6 A;  3FCW A;  3T9N A;  4RL1 A;  5AJ3 F;  2W2O P;  4IH6 A;  4U96 A;  3CDE A;  1FRK A;  3GWC A;  4ZPW R;  1QE1 A;  4WJB A;  1X7V A;  3HHK A;  2OSQ A;  1S10 A;  3EGW B;  2P5V A;  1F9H A;  4EZ6 A;  5IT9 U;  2ZWO A;  1GXT A;  2BE7 D;  1H2U X;  1FK9 B;  5D4L A;  1HI1 A;  3RB3 A;  3MAH A;  3CCM S;  3C16 A;  1KFD A;  2Z57 B;  1L3K A;  4QPX A;  3JAM U;  1RT1 B;  4KKO B;  4RBV A;  1TTH B;  4FYY B;  1TK0 A;  1KD1 T;  1PIL A;  2FZK B;  2ZZM A;  4L74 A;  2BE2 B;  3W9J A;  3KG0 A;  1RKJ A;  1BHN A;  1K8A T;  2DB1 A;  1P1L A;  1ICE B;  3R6L B;  1DBD A;  3UWT A;  1HPZ B;  2UVR A;  2NXC A;  2DGQ A;  3NGD A;  4RUC A;  1PJ6 A;  1RB0 A;  1R8P A;  3MCN A;  3NY0 A;  5IZH A;  2WTF A;  4AYB D;  4H4O A;  1FRI A;  4U6P A;  2DIU A;  2BW7 A;  4K8R A;  2DHA A;  1HMV B;  3T3F A;  1S79 A;  3LPY A;  3TZZ A;  1R8C A;  1X4D A;  2GIF A;  4FPR A;  2BJ3 A;  3GSD A;  5FDL B;  3I0S A;  2YKN B;  3QFH A;  1S7H A;  4KV8 B;  1FRH A;  5KOX A;  1A6L A;  4RW9 A;  1QY7 A;  2LXU A;  5A2Q U;  3NWR A;  1PSD A;  3M05 A;  4P74 A;  2DD8 S;  5E3P A;  1Q82 T;  3O6Q A;  4DWI A;  1JLE B;  3MUR P;  4E0D A;  3I96 A;  1WTF A;  1RT6 A;  1MLA A;  2YNF A;  1N48 A;  5G0R B;  4PPZ A;  1HBU B;  1N34 J;  4I7F B;  4L3N A;  3FBC A;  4WE1 A;  5BR8 F;  1N36 J;  1B99 A;  3TNV A;  3MEC B;  3CF5 Q;  4DDF A;  3FKB A;  3ISN C;  4XK8 C;  2KKH A;  3OXF A;  3K5M A;  4IOA Q;  3ADA C;  3VGU A;  4WTY A;  2QA4 S;  1GH8 A;  2R8K A;  4G1Q A;  3CCQ S;  3Q23 A;  1S0O A;  4BS2 A;  2C2Z B;  3FQL A;  2ZH6 A;  1WSR A;  3TZX A;  3J81 U;  4IG0 A;  2YWK A;  2OHD A;  1LW2 A;  1DAR A;  1H3D A;  5EUH A;  2AYE A;  2X3G A;  1G1X A;  3IA0 A;  5KFL A;  4CYU A;  1WEY A;  3DHW C;  4DS5 A;  2BRL A;  3EX7 B;  2VPZ B;  3KNA A;  3HFV A;  4R0E A;  5KFJ A;  4FF4 A;  5E33 A;  1Y11 A;  3U1N A;  3PAC A;  3D0H E;  3IS9 A;  3AD9 C;  2ILZ A;  1SI9 A;  4NYZ A;  3QAT A;  1SJ1 A;  2WSF C;  3LF0 A;  5B0G A;  3PX6 A;  1O8B A;  3N01 A;  4IH5 A;  1VJQ A;  3MED A;  3ENA A;  3BDP A;  2QRR A;  3PRV A;  5GME A;  2ZBC A;  4N76 A;  2K06 A;  4JI8 F;  2H4Y B;  1WWH A;  2IM0 A;  4DV4 J;  5IQ6 A;  2DVI A;  4OZN A;  3BJY A;  3IR5 B;  4JI4 F;  2OSR A;  4KHP F;  3KLI A;  2JEG A;  1YJ9 S;  1YG0 A;  4TQS A;  1NJY A;  2WSC C;  3OFH A;  1SKR A;  1AUD A;  3EDR B;  2J6T A;  1WOO A;  1D0E A;  1R0B G;  3BSN A;  3L7P A;  3BH7 B;  3FSI A;  1NO8 A;  2PA8 D;  3VAG A;  2JNJ A;  5E3R A;  4LQ9 A;  1VJW A;  5B08 A;  4O4G A;  4ZVO B;  3DC2 A;  2ZOM A;  1FFS B;  3LO3 A;  3MM6 B;  1YQH A;  3GJQ B;  3CCR S;  2VB6 A;  2ZNZ A;  3UD3 P;  2F3J A;  2NQP A;  3S1T A;  4LSL B;  4M95 A;  4H4M B;  4Z7Y A;  3D5M A;  2GIR A;  2AGO A;  1UJ4 A;  3EDQ B;  1TL5 A;  1ZM9 A;  4WFX A;  3L7U A;  1VLO A;  1TL4 A;  3FNN A;  3NG8 A;  3IWN C;  1BD6 A;  2DHX A;  1XNR J;  2XI2 A;  2I8E A;  4WKY A;  1B64 A;  4JI3 J;  3R27 A;  3L3C A;  4JI1 J;  3PTW A;  4KGV B;  1JJH A;  5L1J A;  3FBF A;  1R6V A;  2CPY A;  1HNZ F;  3DRP B;  3GIL A;  4PEO A;  2V4J B;  1GEH A;  4N41 A;  2XYP B;  3DOL B;  1JKH A;  3TA2 A;  1ARO P;  3W7B A;  3M6X A;  2N3O A;  2F1F A;  4M5K A;  3T9Z A;  3OT9 A;  1MMD A;  3FCH A;  2XLK A;  2KHC A;  4NE9 C;  4PQU B;  4M5M A;  1VBK A;  5F3Z A;  1C4A A;  3DRR A;  3CT9 A;  4X62 J;  2W9A A;  3KMS A;  3PG9 A;  3E8O A;  4XPE A;  3KKF A;  2M4M A;  5HP1 A;  1Q16 B;  2HRT A;  2HVH A;  4K4U A;  1SC6 A;  5ADZ A;  2FLN A;  2AF6 A;  2OGU A;  4X66 J;  2WRM A;  4FYX B;  5H1S V;  1OY6 A;  1FRX A;  2CAD A;  3N28 A;  3WC2 A;  3Q2S C;  4BDP A;  2CQ0 A;  2MZR A;  3M8P B;  4AUK A;  3BKF A;  2DYA A;  1CQM A;  3HVA A;  2HKE A;  3BR9 A;  1Q8B A;  3DLL Q;  1X4H A;  2XNR A;  4QWD A;  2K7J A;  2B5J B;  4QU6 A;  1HBO B;  2ZC3 A;  4RBT A;  3N0V A;  4B9N A;  4ZVG A;  3CIM A;  4MFB B;  3WIU A;  3PYD A;  1KLM B;  1ZPV A;  4LR7 A;  3AB2 B;  4JV2 A;  1NK6 A;  2EPI A;  5B0D A;  2Q66 A;  2IYG A;  5J1P A;  3UD4 P;  4P75 A;  2FY8 A;  4P2S A;  4RNO A;  3E01 A;  4ELV A;  4TU7 A;  5E5N A;  2C3M A;  5ETS A;  1KQG B;  1L3T A;  4LRB A;  1SKW A;  2CRL A;  3AOC A;  1JJ4 A;  3QSI A;  1IJF B;  3CDW A;  3MMA B;  2PD1 A;  4KSE B;  2HWH A;  2KI2 A;  1PYS B;  4ZVT B;  2C2M B;  3D0I E;  1VOM A;  3UN5 A;  3RTV A;  3M7V A;  3IAS 9;  1U1N A;  4ZN3 A;  3VQT A;  4LIW A;  3D1H A;  1FF2 A;  1WF1 A;  2C2K B;  1F5B A;  1YX2 A;  5MAO A;  4ECR A;  2FDN A;  1UVJ A;  2HQG A;  3SFU A;  4QYZ J;  3EMT A;  2AJ2 A;  2BMB A;  2B3T B;  2KFN A;  3ZZP A;  1NB2 A;  1TKD A;  1SVD A;  3V5R A;  1S57 A;  5C5J A;  2JHE A;  4BBY A;  2CJK A;  2BOP A;  2OML A;  2EBE A;  1SQF A;  3HZE A;  3AJ2 A;  3QGP A;  4DX6 A;  1CEZ A;  4Q7A A;  2G0J A;  1JLQ A;  1I5O B;  3GV8 B;  4P72 A;  4ZVP B;  3IG1 B;  4YR0 A;  4WIQ A;  3DYA B;  4IUF A;  3CCU S;  1XMQ J;  3D1Q A;  1WEL A;  2OEM A;  2YWW A;  1MRO B;  4FNI A;  3ZTQ A;  1JLB B;  4ES3 A;  3PEJ A;  3OR1 B;  3UQS A;  1ZYQ A;  4JI2 F;  2YNH A;  3MM7 B;  2F4V F;  2LCW A;  3FEZ A;  1XC9 A;  3T6B A;  4DV3 J;  1I1G A;  3SDE A;  1VC5 A;  1N54 B;  1RTD A;  2ZHO A;  4NML A;  3J7Y U;  1NHK L;  3W8P A;  3OJS A;  2Z56 B;  2Q1L A;  5LSO A;  5U47 A;  3OFE A;  3W2W A;  2J7K A;  2XBP A;  2EBG A;  4UOG A;  3VTI A;  4LJM A;  6FD1 A;  3N4W A;  2UVV A;  3ZXW A;  4QYZ K;  2AYB A;  1FA0 A;  4JUZ A;  3H7H B;  1RCX B;  2V4R A;  4NRU A;  2ABY A;  5L9N A;  2QA1 A;  4A8S A;  3AA9 A;  2V50 A;  1CUL B;  3V4I A;  2BAC A;  3DOM A;  3KJN B;  4NCG B;  4V19 X;  3VZH A;  5IC4 B;  3W8G A;  3TRG A;  2XZD B;  2RRN A;  1NCL A;  1VQ6 S;  3H2L A;  2GJ2 A;  1EKR A;  2HHP A;  4I56 A;  4Q2L A;  4H54 A;  5ETN A;  2LEB A;  5KAK A;  3F41 A;  3EPI A;  1BQX A;  2WSE C;  1KVI A;  5L8R C;  3I5B A;  4RR5 A;  4PCQ A;  1HW9 A;  2GGP A;  4LF7 J;  4JYA J;  5F3T A;  2ZE2 A;  1HW8 A;  3OW2 R;  1WC1 A;  2UP1 A;  4URG A;  4GKJ J;  2KTQ A;  2LA6 A;  3QGI A;  3SEO A;  1FNM A;  4QW8 A;  5KG5 A;  4BHQ A;  1YSJ A;  4RUH A;  1CJV A;  3D6T B;  5GAH I;  1TKT B;  1SL1 A;  4HI2 A;  2C28 A;  2CJ9 A;  5K14 B;  2YKM A;  4ATN A;  3CD0 A;  3P5T L;  1K0T A;  3PIP Q;  5KT2 A;  4MKY A;  2HGM A;  3KOA A;  1REV B;  2V34 A;  2NUU G;  2OPR A;  3KDN A;  3LTO A;  3MR7 A;  4OZ5 A;  3JSM A;  1ZBT A;  1BE4 A;  2VU5 A;  1VQS A;  2HHH J;  5CYQ A;  4YB1 P;  5I42 B;  2U1A A;  3OSN A;  2V2V A;  1P6T A;  4X65 J;  3TUZ C;  2QSW A;  3MGJ A;  5L46 A;  1NM2 A;  2MTL A;  3M1V A;  3I0R A;  3TVY A;  3C66 A;  3MR6 A;  2P2C B;  3CPW R;  3R6G B;  5ETQ A;  2FHK A;  5D0H A;  1RTH A;  3I87 A;  4OYZ A;  4YQW A;  3QLH A;  4KPC A;  2ZJP Q;  1VFJ A;  2PMH A;  2QIF A;  2UXD F;  3M9O B;  3M8W A;  3CE8 A;  3PFO A;  4DR7 J;  2CNK B;  3OLB A;  3M6V A;  2D7S A;  4OYX A;  1RT4 A;  1WI8 A;  3GPA A;  4FS1 A;  1LWE B;  2MKS A;  1Y0H A;  2XWY A;  3AOA A;  1U8W A;  4ILL A;  3CUN A;  4ELU A;  4HAC A;  4CLU A;  2V6A A;  3G6V A;  4DBQ A;  1PIE A;  3MTJ A;  4N56 A;  3TJA A;  2UXB F;  3BKU A;  1UVK A;  1SJ3 P;  2VQF F;  2HNY B;  5KFZ A;  4F4X A;  4JP8 A;  4RWX A;  4DV0 F;  4WXO A;  3AQO A;  4I69 A;  4QIF A;  4BC7 A;  2NCK L;  4HR2 A;  1OMS A;  4HTI A;  3L95 X;  4LFA J;  5JVG Q;  4P9S A;  3H98 A;  3HZG A;  3TAM B;  1YJU A;  1YBA A;  4D3G A;  4YDD B;  1RTI B;  3M2U B;  1RP5 A;  5C42 B;  2CG4 A;  3GON A;  2AWZ A;  1AB8 A;  1Q81 T;  5AXN A;  4LRA A;  3KLH B;  4J9U E;  5KFV A;  4DL3 A;  1L3S A;  2LXI A;  4DV2 J;  1MN9 A;  2NYH A;  3SMZ A;  2RAQ A;  4H4K A;  1UW9 A;  5HMZ A;  3CDA A;  1XNQ J;  2OI2 A;  2CWX A;  2DNH A;  4DPY A;  1B3T A;  5J2M A;  4YDX A;  3SQO P;  4BWM A;  2CPI A;  3THT A;  3TZW A;  3KLG B;  1BGX T;  2DJW A;  3DNC A;  2IIH A;  2X7I A;  3HT3 A;  1U1Q A;  1T8E A;  3M30 B;  2HVI A;  5HBM A;  2W8L A;  2I5J A;  3OD2 A;  2E7W A;  2G1D A;  1FCA A;  3C46 A;  4OYW A;  2M3D A;  1AW0 A;  2E9R X;  2KJV A;  2FZC B;  1C0U A;  3NAH A;  3I4H X;  4QWB A;  2V67 A;  2VC1 A;  4OX6 A;  4XDD A;  2I0X A;  4X64 J;  3K5O A;  1VQM S;  1NME B;  2LDI A;  4ZMM A;  3ENW A;  4FXV A;  1SJ4 P;  1SKS A;  1FTR A;  2OO4 A;  1WTB A;  4CM0 A;  3J7A 1;  1MMN A;  2GQQ A;  3U7J A;  4O23 A;  3UO0 A;  1LW0 B;  4DR1 J;  2U2F A;  2CPE A;  5HRO A;  2WON A;  1N34 F;  4ZIW A;  1UAW A;  1CVJ A;  3GYX B;  2VG6 B;  1N36 F;  3RG6 A;  4WU2 A;  1OYE A;  4Q44 A;  5CZV A;  4PXE A;  2HHV A;  4IG3 B;  4USK A;  2HNZ B;  3ZZR A;  3MM9 B;  4IO1 A;  1FNX H;  1YHQ S;  1FE0 A;  3HHL B;  2ZH7 A;  1PAU B;  5GAE I;  3CED A;  5CZX A;  4TXS A;  4DFP A;  3ETO A;  2PEH A;  1JLA A;  4CP5 A;  2MGZ A;  4DCO B;  4QBU A;  2YWF A;  4LSN B;  2HWT A;  4J9V A;  3CJ0 A;  4RU2 A;  3TWZ A;  4DQP A;  2BQU A;  4B9M A;  2AX0 A;  3WC0 A;  2LLZ A;  1JJC B;  5DG9 A;  2Q6B A;  2RS2 A;  2V0N A;  3CJK A;  4EU0 A;  4WFY A;  2UVW A;  2HRY A;  4TVA B;  3DDN A;  4WZM A;  4K7Q A;  2B7B B;  1R7I A;  1E6V A;  1OSC A;  4DQS A;  3K17 A;  1IKV B;  5KFN A;  1NSP A;  4QWE A;  2ASJ A;  1R31 A;  1WKK A;  2ZZT A;  1UJ6 A;  1TK5 A;  4DL5 A;  4ZDN A;  4C0H A;  3HHE A;  4U7C A;  3SV3 A;  4PG6 A;  2WVB A;  1IBL F;  3R5D A;  3UR0 A;  4DV4 F;  1PYO B;  4D3H A;  2YWH A;  2XSJ B;  1LXN A;  4PUO A;  4ALZ A;  3QZ7 A;  4CO5 A;  1X4C A;  1IKY A;  1EX8 A;  1S12 A;  4LRF A;  4HYK A;  1RAG B;  2R9L A;  2M5Y A;  1K44 A;  5JVH Q;  4NLU A;  1IQZ A;  1TV6 B;  1SL2 A;  4QW9 A;  2PA3 A;  2MKY A;  3AHP A;  1J2V A;  3QJP A;  4B3T J;  2AV5 A;  1NU4 A;  4DV6 J;  2N7C A;  2XLJ A;  1FX4 A;  4CH1 A;  2RF2 B;  4MYT A;  5C25 B;  2KVI A;  1ITP A;  2IFX A;  4KH1 B;  3KK1 B;  2E5I A;  3IR6 B;  1HQE B;  3BGO P;  1WHW A;  1RSC A;  2NZC A;  1HNV B;  2E9T A;  5KFH A;  5KFA A;  3O8W A;  3TA0 A;  3KTQ A;  2CFX A;  1JMT A;  4X4R A;  4QOT A;  1XNR F;  1DQ9 A;  2CQ2 A;  1GMU A;  2DEI A;  4W98 A;  5GMD A;  4JI3 F;  3IO1 A;  8AT1 B;  4DSI A;  2RVJ A;  1BQM B;  2HVZ A;  2IVY A;  4A47 A;  3CD5 A;  4E2F B;  1RHR B;  1YKW A;  4I6Y A;  1RU2 A;  1C1B A;  2IRX A;  5IXU A;  2KFZ A;  4I2P B;  3CC4 S;  3H5Y A;  2M8H A;  3THP A;  2C42 A;  4USJ C;  5DQH A;  3FRZ A;  1S1X A;  4FF3 A;  3A3P B;  3V6D B;  5J1N A;  4CRJ A;  2JLG A;  3DRS A;  2GVD B;  1G4C A;  3O3L A;  4KGZ B;  5DRK A;  3BB5 A;  2P9C A;  1F6T A;  2IMW P;  1NPR A;  3D54 A;  4M8L A;  4XO0 A;  3I32 A;  1QE1 B;  2PSZ A;  2D1C A;  1WC3 A;  4LF6 J;  4C11 A;  4PYD A;  2GS8 A;  2YKQ A;  2N3L A;  1CBK A;  2DIS A;  5JMN A;  2IDE A;  4X62 F;  3E2E A;  2J5A A;  1KHV A;  3C16 B;  1OYD A;  1S0N A;  2LFV A;  1ZM3 A;  5B0E A;  3FZB A;  4J9O A;  2R7U A;  3DXB A;  3PO4 A;  4MMO A;  4X66 F;  5SZT A;  1H73 A;  1N56 A;  4IDK A;  3D66 A;  1Q0N A;  1SC1 B;  1VYA A;  1RAE B;  2HHS A;  2V4Q A;  4UOC A;  4DU7 A;  2KH9 A;  2XMV A;  3T41 A;  4WK3 A;  2KN4 A;  1GX5 A;  1OJ4 A;  2HFV A;  7FDR A;  4R25 A;  1RBL A;  3HJV A;  3M2R A;  1JNR B;  4YHH J;  3K57 A;  4P7V A;  1M1K T;  1WJ9 A;  3BQ1 A;  1M5S A;  3SI8 A;  3H0P A;  1KFS A;  5LOQ A;  1N5V A;  2A6M A;  4TKT A;  5A2Q Y;  1LV5 A;  4H4O B;  3LA0 A;  5D8H B;  5FLX U;  3NS7 B;  1PO6 A;  1HQU A;  1VGY A;  4CDI A;  2PFD A;  3WZ0 A;  2AJ0 A;  4OI6 A;  1RU1 A;  4RW8 A;  4WXW A;  3C15 A;  2OUG A;  2KXH A;  4C48 A;  3I0S B;  1MU2 A;  4I64 A;  3M8R A;  1Z4U A;  1SH2 A;  1RT5 A;  4OZ1 A;  2XNQ A;  1WUU A;  2AP6 A;  2Z2L A;  2H3E B;  4MIB A;  3OL8 A;  5HK4 A;  4GO5 X;  1PBA A;  3DRX A;  1G6B A;  3N9U C;  1Z2Z A;  1M90 T;  1RT6 B;  2JVR A;  5EWE A;  3P45 B;  5GMK a;  3MMB A;  2MQP A;  1Q79 A;  1YJR A;  3ILI A;  2ZKT A;  2J6S A;  4RW6 B;  5D4N A;  2WW4 A;  5F8H A;  4CH7 A;  1SV5 B;  1GFW B;  5BYS A;  3G9C A;  2PII A;  2IRU A;  3VQS A;  1VRT A;  4WZQ A;  4XAK A;  3EVO A;  2XB2 D;  2VZ9 A;  3W5Y A;  2JEI A;  1T05 A;  3DLG A;  1ZPW X;  1D3W A;  4G1Q B;  2HLU A;  4DV5 J;  4KO0 A;  2CPH A;  3JTO A;  4A4J A;  1RAC B;  4IG0 B;  4C8Z A;  2RSQ A;  1LW2 B;  2R2S A;  2HVE A;  1ZET A;  1YJW S;  3TAR A;  4GKK J;  1WOR A;  2KZM A;  4CYU B;  3A3O B;  1F9F A;  4I67 A;  1OQ6 A;  1WC0 A;  3TUJ C;  4YR3 A;  2KG1 A;  2RU9 A;  1UEV A;  1XMQ F;  4KAI A;  3O1L A;  5EX3 A;  4LF4 J;  2VL1 A;  5KG2 A;  2WHO A;  4ECU A;  3HCX A;  2WCX A;  3ZZO A;  5T41 A;  2OEJ A;  3GMG A;  2FHO B;  4RBU A;  3DRY A;  4WF9 Q;  4F2R A;  4E8U A;  3CC7 S;  1KVJ A;  5HMY A;  1VRU A;  5A6P A;  5A8K A;  2IJR A;  2XCP A;  3T5K A;  4DV3 F;  3V6J A;  2OKQ A;  3MED B;  3GIJ A;  5DDP C;  3KJV A;  1N4L A;  4J9M A;  3EGN A;  2MHE A;  1FNO A;  3W61 A;  5IOL A;  2EFQ A;  4F2S A;  4U8V A;  2NUH A;  2BVZ A;  2YWE A;  4XIU A;  3KLI B;  5EGY A;  3EGZ A;  1SH3 A;  3L7O A;  2ZDP A;  5B0F A;  4QWC A;  4DV7 J;  1QSS A;  2NYI A;  2QLF B;  4JV5 J;  4J9P A;  1TMJ A;  4B02 A;  2R3V A;  4J7C A;  4JBC A;  1RGV A;  5ETM A;  1JLG A;  3AXM A;  4C8Y A;  2Y1I A;  1RWO B;  5L38 A;  4O4G B;  3ITH A;  2QV6 A;  1Q53 A;  4KT0 C;  2W2M P;  4ZOS A;  4LF7 F;  4FKY A;  4JYA F;  2FY1 A;  2FJA B;  1S1W A;  4GKJ F;  3FQK A;  5MLC V;  3G8Q A;  1RQ0 A;  3JQK A;  5KG0 A;  3HFZ B;  1JWW A;  4CLL A;  1G3O A;  5KT3 A;  4Z2X A;  5EWG A;  2M8D B;  4ZPA A;  3TQ1 A;  2AEJ A;  1O0P A;  2HMI A;  3PR4 A;  3NGK A;  2LKZ A;  3FEY B;  3RZA A;  4K4Y A;  2EWH A;  2CUY A;  3DXS X;  4AE5 A;  1RT7 A;  3QAU A;  4DR5 J;  4NLS A;  1F2H A;  4DG1 B;  2GO9 A;  3R2C J;  2HHH F;  1KQF B;  3VAH A;  4X65 F;  1N52 B;  3RYL A;  4QIE A;  5KFO A;  1S6Q A;  1NND A;  3ZZZ A;  2OD4 A;  4LF9 J;  2EFO A;  3CJ8 A;  2CQ1 A;  4CI0 B;  4Y2C A;  2DNL A;  2ADC A;  2GA7 A;  4K4W A;  1RWK B;  4C2M A;  2XUL A;  2PI5 A;  3LOU A;  4KGK A;  1UFK A;  3KUE A;  1S1V B;  5GAD U;  2FPH X;  1TUV A;  3EVM A;  2W8K A;  1TKZ A;  2JVO A;  5KFY A;  2WVF A;  4DR7 F;  3QJJ A;  3CCS S;  1XR5 A;  1R43 A;  2J76 E;  3DRR B;  5DDO C;  2XS5 A;  4LVN P;  2IDL A;  2A2C A;  2Y1J A;  5HSP A;  5DQI A;  4ZLL A;  2QA4 G;  2R2U A;  2DNG A;  3QIP A;  1U1P A;  4USI A;  5RUB A;  4HHU A;  2Z4P A;  1CJU A;  7AT1 B;  3KLE A;  1HD1 A;  4ZCL A;  3QRR A;  3M8Y A;  4UOH A;  1ZA2 B;  2Z30 B;  3RR7 A;  3MM8 A;  4L73 A;  5KG3 A;  3CDU A;  3MPU B;  4I1T A;  3MPV A;  4KB7 A;  1CG2 A;  2DXE A;  4WTO B;  2BYC A;  2QZ8 A;  1NZA A;  3C6U A;  3W5Z A;  4BLG A;  2GJI A;  3FCV A;  4Q2M A;  5ETO A;  1LWF A;  2AMC B;  4LFA F;  4CLP A;  1A9N B;  4F4Y A;  3VCD A;  2C22 A;  2XZW A;  3MAA B;  5E3Q A;  2WOM B;  2CDR B;  3E01 B;  4NCB A;  2MZ1 A;  3EVW A;  3R97 A;  2GCF A;  3GIM A;  2GW8 A;  2Y8W A;  2HFZ A;  3PW4 A;  3K2Y A;  3DI6 B;  4A8Y A;  5CYM A;  2AEM A;  1FES A;  4RO0 A;  2C3O A;  4V1A k;  1XNQ F;  2CZ4 A;  2VFV A;  2CAJ A;  2CZV C;  3LGM A;  1FJG J;  1SB6 A;  1ACM B;  4IRC A;  2IVF B;  2DGS A;  4NLR A;  5BJR A;  2NXN A;  3Q86 A;  2RJZ A;  4F67 A;  2YY3 A;  2B8Q A;  1NH7 A;  1C0T A;  3IN5 A;  3D4J A;  3A12 A;  4NYP A;  4EBC A;  5A6W A;  2R7T A;  5CAB A;  1TUW A;  2WZ1 A;  2UUW A;  1FFW B;  3DLB A;  4RWW A;  4UW2 A;  1HHT P;  1IUJ A;  5A8W A;  3UW1 A;  4Y3C A;  1CLF A;  3W2V B;  5C24 A;  2E7X A;  2BKN A;  4PG5 A;  4FF2 A;  1UVM A;  5DG7 A;  4X64 F;  3MOZ A;  4USU A;  3GG1 A;  5LJ3 Y;  1EET A;  2ZHB A;  1KSP A;  3SCJ E;  1RAD B;  4LBI A;  1JLQ B;  1MWQ A;  4FXW A;  2V68 A;  2KT5 A;  4P10 A;  2B4P A;  3K5N A;  2H54 B;  3I6P A;  2R2R A;  2QFI A;  1RA7 A;  2NPF A;  1YJT A;  4NI2 A;  4TYA A;  4P2X A;  4NOH A;  4ECW A;  2YNH B;  1RWX B;  2EC2 A;  3LWL A;  2MZT A;  4DR1 F;  2ZOF A;  5IT4 A;  2VC0 A;  2RIJ A;  3BR8 A;  4HKQ A;  4O44 A;  1QM9 A;  2NXE A;  1RTD B;  2KT2 A;  4QPT A;  3RAQ A;  3GV5 B;  3W2W B;  3LUY A;  3PW0 A;  1AA1 B;  3JQJ A;  2G4B A;  5KFQ A;  4U7U D;  2MLZ A;  4I6A A;  3MUT P;  3B54 A;  1U1R A;  2MQ8 A;  4IQM A;  3CCZ A;  3MAQ A;  1FJ7 A;  3LP2 B;  4RUA A;  2XS7 A;  1IKW A;  3AH6 A;  1NKB A;  2BKP A;  3KG4 A;  1BLU A;  3ETM A;  1KVK A;  2CJQ A;  2VBY A;  2J8S A;  5A8R B;  3V4I B;  3BSO A;  2UZA A;  1VLY A;  5F0W A;  4IOB A;  1ZH5 A;  3PHE A;  3OVB A;  1XMO J;  4DL2 A;  4DEZ A;  4UTG A;  4PG4 A;  3UCZ P;  1SH0 A;  2L08 A;  3AOD A;  1RDR A;  4N8N A;  2YH1 A;  4LF2 A;  2FYX A;  5J1E A;  1R3N A;  2FJV A;  1H72 C;  2GGP B;  3I5A A;  2ZE2 B;  2HUR A;  5DG8 A;  2V8P A;  3SQG B;  4ID8 A;  4C0O C;  3Q8Q B;  3I4P A;  3PYE A;  4KJI A;  4UT4 A;  1CJV B;  1T9W A;  2MKH A;  2BUN A;  3RUB L;  1OY8 A;  1D8Y A;  2EG2 A;  2YKM B;  3UCU P;  3GII A;  3BBF A;  1KOH A;  2VFT A;  2JOQ A;  2LDY A;  1WEX A;  1WKJ A;  1EAR A;  3BPD A;  4OHY A;  2OPR B;  3OL9 A;  4YUD A;  2BXJ A;  4P6Q A;  4YB5 A;  1SIW B;  4LVO P;  1F3F A;  1N5Q A;  2QTW A;  2HGN A;  3H4D A;  3PX4 A;  1J5O A;  4DN0 A;  1TEL A;  2J8A A;  2A2D A;  1H38 A;  2A3J A;  2RD5 C;  4B3T F;  1HYS A;  4OLP A;  4DV6 F;  3I0R B;  4OHX A;  2XMM A;  5DDR C;  2B9X A;  4HT7 A;  2FHJ D;  2DR5 A;  2M88 A;  3DLK A;  3R5G A;  1UTA A;  2RQM A;  1NEE A;  5CHC B;  1IM4 A;  3CD6 S;  3QLH B;  1RHM B;  1XN9 A;  1FKA F;  2DR6 A;  5IV3 A;  4DZ6 A;  1CC8 A;  2NXJ A;  2CNL B;  3NS6 A;  2HQI A;  2BJ8 A;  3M2V A;  1RT4 B;  1NPP A;  4KIA A;  3FZ2 A;  4IR1 A;  2F7V A;  2M70 A;  4YEA A;  2LA4 A;  2NS1 B;  3AJD A;  3GQC A;  3MCS A;  1H2V Z;  2DGT A;  2VKR A;  3B4D A;  4HAC B;  4CNZ A;  2DK2 A;  3VGT A;  2DTJ A;  2CQD A;  2RQK A;  3OFF A;  3F73 A;  2HPU A;  3IRW P;  2ZC4 A;  3FGV A;  2R8G A;  3IR7 B;  4ZPB A;  3U27 A;  4CT9 A;  2CQ3 A;  4NA3 A;  4Y34 A;  3G8S A;  3JYT B;  3DMJ A;  4M94 A;  1HL6 A;  1N0V C;  2W1B A;  1F3V A;  3Q8P B;  3OFG A;  2C2E A;  4C7Q A;  4TYB A;  4DPO A;  2LYV A;  5LM7 E;  2XQC A;  3QGH A;  4OI2 A;  2BV3 A;  4NLY A;  4PWD A;  3HX9 A;  3DGV A;  2VF3 A;  2NSB A;  3BBC A;  4LF6 F;  4CQ1 A;  2FHJ A;  1CJT A;  2W9C A;  1O51 A;  3D3B J;  2ZBR A;  3CJQ A;  1HWL A;  4DL7 A;  2G2Z A;  3W3S A;  3W66 A;  1RAO A;  2W4D A;  2W7O A;  1X5O A;  2BKO A;  2J0S D;  1S72 S;  2EW9 A;  3CNQ P;  3DLJ A;  4CCH A;  4MK7 A;  3PKY A;  2DH8 A;  2CPX A;  4DX5 A;  1TL1 A;  3FMW A;  3CCE S;  2RML A;  2WVE A;  3KLF A;  1GQE A;  4KKO A;  1TUG B;  1AZS A;  2NPI A;  4ED1 A;  2IC3 A;  4YHH F;  2BE2 A;  3HVR A;  5HBM B;  4OMF G;  3AOB A;  2JFD A;  3AXK A;  3DOK A;  1GAO A;  2V2K A;  5L1I A;  5LL6 d;  1HPZ A;  4M1K A;  3NL0 A;  1XBW A;  1C0U B;  4NEY A;  3CSK A;  1CJK A;  1WHX A;  2HBY B;  3GSI A;  1EHW A;  2WVC A;  3FSY A;  4XTT A;  2DHH A;  4X4P A;  1WI6 A;  1HMV A;  4F4Z A;  3NNH A;  4UUX A;  1HNX J;  3TX8 A;  4CLY A;  4ICL B;  1XMB A;  5I3Q A;  5IWA J;  3EJM A;  3T1A A;  2FZG B;  4Q43 A;  3L9Z A;  5FDL A;  5K20 B;  1NKC A;  3C19 A;  3DU5 A;  2QJ3 A;  3JSR A;  6AT1 B;  2FVS A;  4BCA A;  4K4T A;  3ILJ A;  2EXU A;  2PN6 A;  2MMY A;  4DR4 J;  2JL9 A;  5HRO B;  2WON B;  1WF0 A;  2R7V A;  4U95 A;  1IBM F;  2I2Y A;  2LQ5 A;  3G4S S;  5H9E J;  1UFL A;  1AFI A;  5G0R A;  2OEK A;  3P4U B;  1HBU A;  4NMX A;  4ENO A;  3KHL A;  3S01 A;  2OFH X;  3JS9 A;  4OI0 A;  4DFM A;  1HLW A;  4I2Q A;  3SSQ A;  3VAI A;  4DV5 F;  4K4X A;  2LQJ A;  3KHR A;  2PGC A;  2CPZ A;  1F2G A;  2D9P A;  2OMO A;  4ANE A;  3MTK A;  2G13 A;  3EZO A;  1NJW A;  4FN5 A;  2KM8 B;  2Q6C A;  3ZTP A;  3QT7 A;  1JLA B;  2MGZ B;  4GKK F;  2MPU A;  1KS2 A;  3Q8R B;  1EP4 A;  1FEE A;  2UUB J;  4OZ2 A;  4CO4 A;  5HAT A;  3CJK B;  1T0T V;  4NZ6 A;  4CH0 S;  2HBZ B;  3W60 A;  1E6V B;  1LFW A;  3GZ7 A;  3T5H A;  4NLO A;  5AXK A;  4FYV B;  3IP0 A;  4ANC A;  3TQE A;  1U6F A;  5EN1 A;  4J37 A;  1FX2 A;  3P8B B;  4UOF A;  3TA1 A;  1D09 B;  4DXL A;  5HQM A;  2L41 A;  1K9M T;  4Q45 A;  5H9E K;  1ZAV A;  3H42 A;  2DY1 A;  2X1B A;  5LJ5 Y;  3S7R A;  2JFK A;  2JWN A;  1IKY B;  4LR8 A;  3FJ2 A;  3A8K A;  4DV7 F;  8ATC B;  4ECY A;  4KBI A;  4ED0 A;  2LU2 A;  3H2V E;  3MI7 X;  1VHI A;  1EQ0 A;  3V81 B;  2B9W A;  1UL3 A;  5M2R A;  2DNZ A;  4IRD A;  1YLX A;  4RNN A;  4B3M J;  1NBE B;  3V4M A;  3MCM A;  2CQB A;  3HI9 A;  1Y00 A;  2POK A;  4OZL A;  3KJQ B;  3EZU A;  3K0J A;  3PM9 A;  2XTJ P;  5G4D A;  2FLO A;  5KT6 A;  2R7W A;  4NA2 A;  5D0R A;  4LSL A;  5L39 A;  3RBD A;  4H4M A;  1S49 A;  3SCK E;  3R5C A;  3LH2 S;  4LUB A;  3W5X A;  3VAM A;  1RWV B;  1TAU A;  3IWX A;  2E44 A;  4OYI A;  4DSJ A;  2G2O A;  3FDS A;  1FO1 A;  3LAN A;  3PJX A;  2H48 B;  4DR5 F;  1C1B B;  2OAU A;  2VPX B;  4KTQ A;  4DQI A;  5KFD A;  3CJ4 A;  2HRU A;  3J80 Y;  2VPY B;  3UNG C;  1H7X A;  4DL6 A;  3HSJ A;  1S1X B;  4LF9 F;  3CJ2 A;  3HMJ G;  4FBT A;  3QO9 A;  5A76 A;  1T03 A;  1RAA B;  3W62 A;  2ZZN A;  3DRP A;  3CIZ A;  2V4J A;  3NKY A;  2ZOG A;  4DUT A;  3MF5 A;  3ILL A;  1HNW J;  2XSF A;  1UET A;  4C11 B;  1Q8L A;  5HL7 Q;  3W1Y C;  1TK8 A;  1QLN A;  1W25 A;  2QLW A;  3P49 B;  4JI0 J;  2HQC A;  2FHM A;  2ZIT A;  4DOZ A;  4LFB J;  4R8U A;  3OR2 A;  4PQU A;  1M0S A;  3DHX A;  1B0T A;  3PYF A;  2VG7 A;  4WP3 A;  4OZ0 A;  5HMW A;  4ED3 A;  3K8V A;  2J9C A;  1RHU B;  1DHM A;  1RHQ B;  5F9N A;  3DM2 A;  3IGV A;  3WIV A;  2DNY A;  5FII A;  3M2R B;  5BXI A;  4TY9 A;  1NXI A;  2XEX A;  3TW0 A;  4DR2 J;  2LEC A;  1EQM A;  1R6Y A;  1U2C A;  4RX6 A;  1G7C B;  3R5J B;  1TKX B;  2YX4 A;  2XY5 A;  2CNO B;  2AKW B;  4B9V A;  4Q8E A;  3MPW A;  5GAG I;  3QGG A;  2CJB A;  4DU8 A;  2W9B A;  3H8Y A;  1KLM A;  4RW8 B;  1TL3 B;  1PC4 A;  3C15 B;  2GQC A;  1OPZ A;  2ZH8 A;  4P7T A;  1YVF A;  4ZPC A;  1MU2 B;  3JTN A;  4AXJ A;  5IS2 A;  5M2P A;  4Y2I A;  2G0I A;  2JC0 A;  1RT5 B;  4ECQ A;  4Y6I A;  2BZ2 A;  2GQ2 A;  1S7I A;  4L75 A;  4FXD A;  4B3S F;  1FJG F;  2V8G A;  2DO4 A;  1UCN A;  3U02 A;  1X5S A;  4ID5 A;  2UUA J;  3OTE A;  2QE5 A;  2PMZ D;  5ETR A;  2UXC J;  2GO8 A;  2HG4 A;  1QAJ A;  4C8M A;  1WAC A;  5LMU J;  4DL0 C;  1RCO B;  2L9N A;  5HVG A;  1GX6 A;  5HQ8 A;  1Y10 A;  5KFG A;  3UNY A;  1ZM4 A;  1VRT B;  4X4T A;  2IA6 A;  3IXQ A;  5IC6 B;  2O1P A;  4MK9 A;  3DLG B;  4X4U A;  1XJW B;  4KO0 B;  5KFB A;  2EFG A;  2B4U A;  3BSC A;  2DH7 A;  4CLS A;  2ZDO A;  3LWM A;  3HM9 A;  2O01 C;  1RXO B;  3QNW B;  3Q0A A;  4GC6 A;  4HHJ A;  5EX0 A;  2AGP A;  1RZM A;  2DH9 A;  3LPE A;  2VUG A;  4KYZ A;  4KQZ A;  5J2P B;  3I9V 9;  2MSS A;  4NWB A;  3H5U A;  1JLF A;  2B0G A;  2YNG A;  2D3U A;  1V9O A;  2C2N A;  3IG1 A;  3K7R A;  3DYA A;  4QJV A;  2ZUA A;  3LP0 B;  4Y65 A;  4M5H A;  1KQK A;  1MRO A;  4ZVR B;  5A8K B;  3A8E A;  4A8M P;  2VKZ G;  1FKP A;  3IWL A;  4F04 B;  3AQP A;  1N0U A;  2V63 A;  1MML A;  1RAB B;  3D68 A;  3HXM A;  1SJQ A;  3PKM A;  1GMV A;  2KO1 A;  1MWZ A;  2QLB B;  1FDD A;  3FFI A;  2C2O B;  3BM7 A;  5J2Q B;  1U6B A;  3BPS P;  3ICL A;  1RT3 A;  4C97 A;  2NR0 A;  1T3O A;  4ZLN A;  3M6U A;  2GJF A;  4TLR A;  3SYZ A;  1HWK A;  1XMO F;  2R7R A;  2D3O 1;  2IHR 1;  3CW2 C;  3NP5 A;  4ZLJ A;  4U7U K;  1CUL A;  3BN4 A;  4USV A;  3F44 A;  4NL5 A;  1S5Z A;  2GAH C;  5A0Y B;  3G71 S;  4FYD A;  5ETT A;  3PRB A;  3FK4 A;  3ILO A;  3W65 A;  1TP7 A;  2ZUG A;  4ECT A;  2OP5 A;  1NJX A;  1WHY A;  1S1W B;  2LQ9 A;  2V9K A;  3TUP A;  4PXC A;  2X1A A;  4A46 A;  1YWX A;  3HVT A;  3UN3 A;  4HLB A;  3C8Y A;  4JI5 J;  3CUL A;  4A8W A;  3IC1 A;  1JX4 A;  3UR3 C;  1TKT A;  2ZD1 B;  1U1M A;  4EO8 A;  2VPW B;  4C8K A;  2O3D A;  4DMZ A;  1RT7 B;  3MMJ A;  4WFA Q;  2K8G A;  2RKI B;  5KG1 A;  2E7V A;  2V8D A;  2DO0 A;  1REV A;  4RNM A;  4OV6 A;  3ZZY A;  4B9L A;  4M5D A;  2R8I A;  3MPY A;  5LXR A;  2FQQ B;  5JUM A;  1K1Q A;  5D4P A;  3OL6 A;  2FVP A;  4IO9 Q;  4NAS A;  1YTY A;  4RUB A;  2AJF E;  1HNZ J;  3VVU A;  2VFS A;  3X1L B;  3PW7 A;  2HHQ A;  1FKO A;  4QR2 A;  3M9N B;  2QEX S;  2XMK A;  5HLF A;  3GV7 B;  3HSD A;  1N5Y A;  1TKZ B;  1IWA A;  3G2X A;  4K2X A;  1FD8 A;  1U6Z A;  4ERD A;  1KDN A;  4OLO A;  4K0K J;  5K8M A;  4WCE Q;  1X8D A;  2F8M A;  4O3P A;  1KN6 A;  1S9E A;  4DL4 A;  3NNA A;  1SL0 A;  5AT1 B;  1T11 A;  3QIP B;  2YH0 A;  2WVD A;  5DGA A;  5CXT A;  4JI7 J;  2HZC A;  4B3O A;  4NLG A;  5D0E A;  3MM8 B;  4KGX B;  2K1R A;  1S77 D;  1JXV A;  1U7L A;  4F3Q A;  1UWB A;  1WOS A;  5IM0 A;  1ZM2 A;  4ZP9 A;  3M8S A;  3UI3 A;  2ZH5 A;  2UUC F;  2DGO A;  3C6U B;  3D6M B;  1QDU B;  2CNN B;  2DGV A;  2FUG 9;  4ZJO A;  2DHG A;  1SC4 B;  4O3N A;  4RPF A;  2XMJ A;  5CD4 A;  1LWF B;  1APS A;  3RRK A;  1TVR A;  3ENQ A;  4IFY A;  4A8Q A;  3H20 A;  4RW7 A;  4KHR A;  2K3K A;  5KFX A;  1H6K X;  5B7W A;  4P2M A;  5C42 A;  4ZCK A;  2RQ4 A;  2HZA A;  1TMM A;  2YQ3 A;  4ILR A;  1YJ7 A;  2DNN A;  3CO0 P;  2CZ9 A;  3JSY A;  1JLC A;  5D15 A;  1C0T B;  4P71 A;  2PEB A;  4EGL A;  1I3O B;  1HNI B;  5B0C A;  1PC5 A;  2KRR A;  1N6Q A;  1VC6 A;  3PYG A;  2NZ4 A;  3MEE A;  1X9S A;  1PGZ A;  4YP3 A;  1U0H A;  3G96 A;  5CCL A;  4C3M A;  5IQQ A;  4USH A;  4WYW A;  3M30 A;  5F8J A;  5A8W B;  2N4C A;  4FS2 A;  2XMW A;  5C24 B;  2MYF A;  4PWW A;  3DLH A;  3EWG A;  2E1P A;  1EET B;  3W9H A;  4TY8 B;  2XO6 A;  4DJB A;  3AB4 B;  4F3O A;  3HKW A;  2W2Q P;  1HNX F;  4W90 B;  1ZAW A;  2AEF A;  1RWM B;  2OTL S;  4JV1 A;  2FC9 A;  5AXL A;  1Q78 A;  1B0P A;  4M5G A;  4NI2 B;  2HS4 A;  9ATC B;  2AX1 A;  2JLE A;  2DHS A;  1K47 A;  3KUG A;  2BEF A;  4CO3 A;  3ZZU A;  4DR4 F;  1B70 B;  2CJY B;  1NAQ A;  1GXU A;  2V5H G;  3AA8 A;  3CJT A;  1F5C A;  2DNP A;  2ZH3 A;  2DNQ A;  2MQO A;  2Z2Y B;  1DZ5 A;  1SJR A;  1DTQ A;  3UD5 A;  3NNC A;  2RE1 A;  4ZP7 A;  2M52 A;  2A1B A;  1QJH A;  4TN2 A;  2P6S A;  5DS7 A;  3LGH A;  1FDB A;  4MK8 A;  1IKW B;  2ATL A;  1XER A;  3PFE A;  3D67 A;  2DGX A;  2G2Y A;  3BV8 A;  2ZHA A;  2MDA A;  2IY5 B;  3BGF A;  4NX9 A;  3HFK A;  4NLX A;  2UUB F;  3G82 A;  2UUT A;  1VQK S;  2VOP A;  1UWA A;  1LEO A;  4LSN A;  3FSX A;  1MG7 A;  4B9S A;  5LMN J;  4DR6 J;  4KGM A;  4MIW A;  4K4Z A;  4C6A A;  3TX0 A;  5B09 A;  4C8N A;  3K59 A;  4P52 A;  4CLT A;  2HFS A;  4YOE A;  3CJ3 A;  1PKU A;  5K8O A;  4NXN J;  2XMT A;  3SFG A;  1X0P A;  3NAI A;  2CXE A;  3D0G E;  2WB4 A;  4ZVE A;  4KE5 A;  2R8H A;  2VBW A;  2UV8 G;  1X4G A;  4EWT A;  1NJZ A;  3K5P A;  2E5L J;  4DZD A;  2UV8 A;  4AT1 B;  3AJ1 A;  1J5O B;  1FVQ A;  3B4M A;  1MNE A;  2AGQ A;  3M8Q A;  4GC7 A;  3V6K A;  1UP1 A;  1K1S A;  2M7S A;  1HYS B;  3MM5 B;  3UE2 A;  2F65 A;  3P6Y C;  1S9G A;  1JXL A;  2IA0 A;  1TV6 A;  2ADB A;  2R7O A;  1RLC L;  1G2E A;  4IRK A;  2KB2 A;  1YJV A;  3VR1 A;  2KYZ A;  3KXD A;  3IRX A;  2OFG X;  1BQN A;  3NEK A;  2W7A A;  1KTV A;  4BWJ A;  3M2V B;  5DM7 Q;  3R8Y A;  3C2P A;  2AIR B;  2UXD J;  3S6E A;  5GAG U;  2HW3 A;  1KEK A;  1IWG A;  2D3O R;  2ZJR Q;  1XK8 A;  1M1H A;  4F3M A;  3JQM A;  1R27 B;  2AZ1 A;  3PJ9 A;  4MYU A;  2VG5 A;  2E5G A;  4IQX A;  1BQM A;  1AFJ A;  1LNQ A;  3HHN B;  3OQ2 A;  3TR5 A;  1IKX A;  3CVK A;  1QVF R;  4G1I A;  1JIH A;  1LWX A;  2F5G A;  4EYI B;  3DMJ B;  5GAD I;  4I2P A;  4AL7 A;  2Z2Z A;  5JXS A;  3VWS A;  4FDF A;  3IBW A;  4U67 Q;  1IBC B;  4MJK A;  4PQA A;  1V6H A;  2IJF A;  4PG7 A;  3BGR B;  2E9Z A;  2YBV A;  3V6D A;  2J9D E;  4PWD B;  1HNW F;  2GVD A;  2FB0 A;  2QL7 B;  1CJT B;  2W9C B;  2HFN A;  2XYH B;  4F50 A;  1WDT A;  4WFZ A;  1U1L A;  3MZI A;  4ED5 A;  1Y5I B;  1NKE A;  1ROF A;  4JI0 F;  4OI1 A;  1QVG R;  1I94 J;  4LFB F;  2B7C B;  4XDC A;  5EHH A;  4DR3 J;  2H4W B;  1WG1 A;  1U45 A;  2HQD A;  2ZBI A;  5F8G A;  1SKU B;  5E2Q A;  1U4B A;  4Z37 A;  1TL1 B;  1JJ2 R;  1CS4 A;  2XMA A;  2F63 A;  2Z0G A;  3KLF B;  1AZS B;  2V8V A;  2VBZ A;  4YB7 A;  1DUR A;  2IC3 B;  2LVW A;  3OTB A;  1FI4 A;  4DR2 F;  1J27 A;  2YQ0 A;  3SV4 A;  3DOK B;  2EFP A;  4AL6 A;  3H2U B;  1WKL A;  4G1P A;  1VS3 A;  2J0W A;  4QIG A;  2HIY A;  1SCJ B;  3PZP A;  4B3R J;  3R5B A;  3OUY B;  4R5P A;  3DGP A;  1CJK B;  3D6H B;  3A8J A;  4A8O A;  1FJE B;  4YFU A;  3M32 A;  2AT1 B;  3KFW X;  1RWN B;  1W26 A;  4H4K C;  1Q7L B;  3PDN A;  2BM0 A;  1R0A A;  3H90 A;  4ZHR B;  1TL7 A;  4ZK7 M;  3SCL E;  2QN6 B;  2YKP A;  4OJH A;  2W24 A;  1RIS A;  1NHU A;  2VFU A;  2GZO A;  2CPD A;  5T7L A;  1WC4 A;  3HD1 A;  3Q8V A;  1IN0 A;  3J81 j;  4JOU A;  1WC5 A;  4P2F A;  4IKA A;  2UUA F;  3ZNJ 1;  2UXC F;  1C1C A;  1Z1Z A;  2O5D A;  5LMU F;  4F0K A;  3PR5 B;  2FJD B;  2AU0 A;  2J6U A;  4DFJ A;  2G1H A;  4CLW A;  4RW6 A;  1XQI A;  3TJ9 A;  3EM1 A;  2Q43 A;  4I2Q B;  1SIZ A;  1M5V C;  4UQT A;  2ROG A;  2Y9H A;  1SV5 A;  5DZ6 A;  4L76 A;  4ZVH A;  1TZ0 A;  4Q0B B;  1M5O C;  4K59 A;  3W64 A;  2APO A;  3BS9 A;  2WW8 A;  4ED6 A;  3PNI A;  2V8H A;  2XGP A;  1FRL A;  2ASD A;  4JI6 J;  3GLJ A;  4DPX A;  2Q3P A;  1U09 A;  1RJJ A;  3OSP A;  1N5T A;  4RW4 A;  1EP4 B;  1MN7 A;  3UFC X;  1UFW A;  5D3G B;  2D3Z A;  1JNZ B;  4N77 A;  1M5H A;  2I9S A;  2HSE B;  2GMH A;  2LP4 A;  1NK9 A;  2CDQ A;  3OVS A;  2BM1 A;  1X4F A;  1FD2 A;  4Q5V A;  2QMW A;  4OHZ A;  2YNI A;  2HZV A;  3KK3 A;  1Y3J A;  5LSR A;  3IM8 A;  1LK5 A;  3DU6 A;  1YRX A;  4F4A A;  1Q95 G;  4PZV A;  2MZS A;  2GVZ A;  3M9M B;  2XLI A;  4EZ9 A;  5F8N A;  2BAB A;  1S4E A;  3EE3 A;  2HAI A;  4OI3 A;  3CXC R;  5CCM A;  1ZS6 A;  3LP1 A;  1U0S A;  2HYI B;  2KM8 C;  1VQP S;  1FJC A;  5HO4 A;  3ZTS A;  1VQ7 S;  5IT0 A;  3GE9 A;  2OIH A;  4JI1 F;  5KFK A;  1IBL J;  2OPS A;  1DAX A;  1GTH A;  2HS3 A;  5JJB A;  1IVZ A;  1H2T Z;  3QZ8 A;  4WKR A;  4ECX A;  1BY9 A;  3I5C A;  5J2N B;  1Q8I A;  2XMU A;  1IBK J;  5IT9 Y;  1T95 A;  4DUY J;  2HBQ B;  3MHY A;  3GJT B;  3UCG A;  2ZH2 A;  3GJS B;  2NSC A;  2N4D A;  2RQC A;  2L3M A;  2HWI A;  4WWS A;  4K5S A;  2ZM6 J;  3MMC A;  1RT2 A;  3H40 A;  4OX9 J;  1T7P A;  3JAM Y;  3O2I A;  4DN9 A;  1HWJ A;  3CJR A;  5DO2 A;  3FEX B;  2MST A;  2GIQ A;  2MJU A;  1S9F A;  1U24 A;  4G3I A;  5IFM A;  1FRJ A;  4BC9 A;  2XI3 A;  1ZA1 B;  5F9L A;  3CO9 A;  3G87 A;  3LAK A;  3PEH A;  4RKU C;  4YB6 A;  3UVJ A;  3RR8 A;  4JI5 F;  2CQG A;  3X3U A;  3PIO Q;  3NWG A;  3RGI A;  5ETP A;  1R0C B;  3I55 S;  2RDD A;  1JK9 B;  4K50 A;  2H9Z A;  2QMU B;  3TAN A;  3BO3 A;  2J0X A;  1EAY C;  2ZKU A;  3A1Y G;  3DKD A;  2RNE A;  1DQ8 A;  1IR2 A;  2ZBQ A;  2UVU A;  3KJF B;  1IXK A;  1KKH A;  3MD3 A;  1YIT S;  1V5V A;  5GVQ A;  1KP6 A;  5E7O B;  1PCA A;  3ZO7 A;  3RW6 A;  4DG1 A;  2HHU A;  1HFE L;  3QO9 B;  1T03 B;  1LOU A;  2VQE J;  4X84 A;  4ZS6 A;  1S1T A;  3CGI A;  4EUV A;  1VCT A;  2V2Z A;  4CO0 A;  2W01 A;  3K8W A;  3TOQ A;  3NBP A;  4DX7 A;  2R4F A;  2CQ4 A;  3J7A N;  1UPM B;  3IBC B;  4YME A;  2E66 A;  3QMQ A;  7FD1 A;  4QWA A;  4LRE A;  4K0K F;  4WFB Q;  1QUV A;  1S1V A;  2GC8 A;  3RBX A;  4R8U B;  3OR2 B;  1HBN A;  4PYA A;  3BF4 A;  3TI0 A;  3MR3 A;  1N32 J;  2VG7 B;  2KXF A;  2DPJ A;  4RW9 B;  2BAN A;  1JB0 C;  3K89 A;  5K9F A;  4LMZ A;  1GXL A;  4J9R A;  1HD0 A;  3BGL A;  4JI7 F;  3NMA A;  4O0I A;  1NLK L;  3DM2 B;  3Q24 A;  3HK2 A;  3N5F A;  3P3D A;  2KXN B;  2YNF B;  2FJW A;  5K8P A;  2QMX A;  3D3C J;  3DCA A;  1D9D A;  3CTR A;  5DDQ C;  5KT4 A;  3J81 Y;  3MXH P;  2D41 A;  3KG1 A;  3GB0 A;  2F4F A;  4WE1 B;  2YXL A;  3KK2 A;  4WK1 A;  5KFI A;  3B78 A;  2Y0B B;  4CM2 A;  3PW2 A;  2IAJ A;  3VV2 B;  2A6O A;  4FBU A;  1EB0 A;  2AJ1 A;  1S0V A;  1VBZ A;  3T5L A;  2QGF B;  3PRD A;  3WQP A;  1QD1 A;  2W9B B;  4OZJ A;  2GV1 A;  4OYP A;  4A8F A;  2WAQ D;  1PJ5 A;  1P27 B;  3R2D J;  1YRT A;  1RAF B;  1O5J A;  4DHV A;  1R8A A;  4HI1 A;  2P6T A;  3I82 A;  1PBU A;  3MEG A;  3MAA A;  2WOM A;  4HTJ A;  2Z2M A;  3MOJ B;  3GIK A;  2B8P A;  3VF0 B;  1AT1 B;  5SUH A;  3RAM A;  4MT1 A;  2DIV A;  2MXY A;  3DI6 A;  5HQL A;  4C0B A;  2XG8 A;  3Q83 A;  6FDR A;  4FPI A;  4ID5 B;  2E1A A;  2PFF B;  3IS9 B;  2RH3 A;  4DF8 A;  1F5A A;  4JV0 A;  2K3I A;  1QTN B;  1W7W A;  1T3N A;  2X1F A;  4C3L A;  5KFC A;  2L9D A;  1DQA A;  1GK8 A;  2DR8 A;  3GFZ A;  3WX8 A;  1H98 A;  2IYI A;  4PG8 A;  4EO6 A;  4PXB A;  4EK2 A;  4U8Y A;  1B4S A;  1WC6 A;  2MHN A;  1AXQ A;  2HND A;  2PMW A;  4LQ3 A;  1FEH A;  3HKZ D;  5D4O A;  3W2V A;  2JC1 A;  1LK7 A;  1AYE A;  2AQ4 A;  4DX8 H;  1NDP A;  2H5E A;  2DKO B;  4ED8 A;  4FNH A;  4NRT A;  3US5 A;  4LF1 A;  4B9U A;  2HQF A;  2XC9 A;  4HVZ A;  3HDS A;  1VQN S;  1JLF B;  2B9Y A;  2YNG B;  1NDC A;  3FBB A;  4UZC A;  2OD6 A;  3BZQ A;  3NOC A;  2L9W A;  1EZZ B;  5BYR A;  4NLW A;  4KFB A;  1RTJ A;  3ZZT A;  4CLZ A;  4DV1 J;  5KFR A;  1N33 J;  4ZPD A;  1FKP B;  3RRG A;  1UPP A;  4E98 A;  5LXY A;  3V6H A;  4F8R A;  1Q7Y T;  2YPY A;  3BEG B;  4J90 A;  1WF2 A;  2MLX A;  1VQ8 S;  2X1G A;  3FFI B;  4ZP8 A;  4ZJL A;  3IBF B;  3PW5 A;  5FD1 A;  2MQL A;  1L5U A;  5KFS A;  3MPD A;  3H25 A;  1GMW D;  1RT3 B;  2B6A A;  3LP2 A;  3WX4 A;  2ZEJ A;  1Y9O A;  1F60 B;  4K4S A;  4F7V A;  3TUI C;  2DNK A;  2EC0 A;  1S48 A;  4LF5 J;  2H1Y A;  1BXN A;  2RU3 A;  3SCI E;  5A8R A;  1KNZ A;  2HLT A;  4PRF A;  2C3P A;  2VIC A;  4UY8 5;  4F0H A;  3QQC D;  1JKH B;  1DJ0 A;  2LMI A;  3D2W A;  3CC2 S;  3FMB A;  5LMN F;  4DR6 F;  1S6U A;  3HVT B;  4DSF A;  2CA9 A;  5I3P A;  4OJ1 A;  1U48 A;  4C3K A;  4FF1 A;  3D6F B;  2AJ4 A;  3SQG A;  2WK4 A;  4NXN F;  1LKZ A;  4C8O A;  2BBE A;  5HP1 B;  1ZTT A;  1N5S A;  1UMJ A;  2BR0 A;  4QR1 A;  4CLF A;  2QX0 A;  5HI7 A;  2G0C A;  2E5L F;  4CNY A;  2OTJ S;  1B7Y B;  1K73 T;  1X4A A;  5E0O A;  4LFC J;  4HDG A;  5D0G A;  3I56 S;  2ZBP A;  4U9R A;  1U2F A;  4DPU A;  4M5D B;  1NDK A;  1DLO A;  1XWL A;  4UZB A;  4HL9 A;  2HHT A;  5ETV A;  1YBU A;  2JSX A;  2QL9 B;  3MD1 A;  4R0J A;  1GMW A;  1WSV A;  3DLE A;  2FIU A;  3BN7 A;  1FKO B;  1X5T A;  2A0F B;  1SQG A;  4IFV A;  3CCV S;  5HLF B;  2HEK A;  5D77 A;  4DSE A;  2FJX A;  1N5Y B;  2I38 A;  2I6W A;  2ZVI A;  2B56 A;  1Y5N B;  1LQ9 A;  5THW A;  1KQS R;  5CA5 A;  1RHK B;  2OPQ A;  3IGN A;  1KBR A;  3CCJ S;  3PCO B;  1S9E B;  4N8O A;  2W4P A;  1L3V A;  1XTZ A;  4DV2 F;  4ECV A;  2FTR A;  3PO5 A;  1OWX A;  3BGU A;  3T1Y J;  1OY9 A;  2RUS A;  4UQG A;  1V5I B;  3JXO A;  4IOC Q;  2QYC A;  4B3O B;  4CTA A;  1BC6 A;  5DLF A;  3CB4 A;  2K1R B;  2CPF A;  2D69 A;  1Y5L B;  2MY8 A;  5BYQ A;  2B4O A;  1UWB B;  3WDO A;  5IM0 B;  1F1B B;  2CQP A;  1VQO S;  1U8S A;  2ALY B;  4L6V 3;  2J9E A;  4B9T A;  2Z58 B;  4WFN Q;  3CCW A;  3JYT A;  1P1T A;  4OX7 A;  2IM2 A;  1VIX A;  3RRH A;  2R7X A;  3SSS A;  3HHD A;  3PX0 A;  4Q8F A;  1TVR B;  2H65 B;  4J9Q A;  5KG4 A;  4IFY B;  1HAR A;  1B7F A;  4RW7 B;  3EGV A;  2BQR A;  1ZZN A;  1I94 F;  1RAI B;  3Q22 A;  2BJE A;  4DR3 F;  3MEK A;  1HBM A;  2V69 A;  2VOO A;  3G6X A;  1YI2 S;  3UPF A;  3PV8 A;  1ZAX A;  1WOP A;  1KHW A;  5E3C A;  2Y1R I;  3PJW A;  1K0V A;  1UW4 A;  4GVB A;  2XY6 A;  2LXF A;  2E1R A;  1D9F A;  2EVZ A;  1WDD A;  1JLC B;  4F4W A;  4LSZ B;  3TO8 A;  5LT5 A;  4W4M A;  1CQN A;  1VC0 A;  1N6Q B;  3MEE B;  1RYR A;  1S6P A;  3GCW P;  1U0H B;  2OPP A;  3SDE B;  1YRU A;  2DBB A;  1VQ9 S;  2RT3 A;  2UU9 J;  4B3R F;  3D9B A;  3POT A;  3CJ5 A;  1S0M A;  4X4S A;  2GX8 A;  4MKA A;  4HDH A;  3OTO J;  3N79 A;  3CWJ A;  1KC8 T;  2V2Q A;  3QT8 A;  3TVZ A;  3NCQ A;  4O4R A;  4Y00 A;  3CCT A;  2NLW A;  1NK4 A;  2EFN A;  1O6X A;  2P8I A;  3G6Y A;  3RB4 A;  3DOM B;  1T02 A;  3U1M A;  5HVH A;  2MQN A;  3R1L A;  2QYG A;  4J9K A;  1TQL A;  5LSL A;  3L4B C;  2F9D A;  2FD2 A;  3NGT A;  4ICL A;  1SPB P;  3G86 A;  1YGY A;  3LGN A;  4P73 A;  1LXJ A;  4UF4 A;  2MY7 A;  4IYQ A;  1X4B A;  4Y2M A;  3C6T A;  1Y7P A;  1RWP B;  1I6J A;  3GR1 A;  4AD6 A;  2HK2 A;  4NLD A;  3EPG A;  1J5E J;  4TU8 A;  1DTQ B;  1YJN S;  2VJV A;  3ET6 A;  2CJX B;  5AE2 A;  4DCJ B;  4HH0 A;  3EIC A;  3MDF A;  4YY3 J;  1VMB A;  2R2T A;  1X9M A;  4ELT A;  2P9E A;  2JZ5 A;  4NZ0 A;  2VDH A;  2OJ3 A;  3NLC A;  3N6M A;  1XR6 A;  4MKV A;  4JI6 F;  3JSM B;  3JSB A;  1DTT A;  4NXM J;  3W9I A;  1SUQ A;  4X4N A;  3G82 B;  5CYQ B;  3IMQ J;  4LRD A;  3FUY A;  4MIA A;  2M9K A;  2CIM A;  3TP2 A;  3M1V B;  4TLQ A;  1P9Y A;  4J91 A;  2J7W A;  2LQB A;  1NRK A;  3CJS A;  1LWC A;  4K2J A;  3HO1 A;  1SJF A;  4WYL A;  1RTH B;  4DPT A;  1Q4R A;  3IM9 A;  1FVS A;  3MR2 A;  3FRY A;  1VIS A;  2YKA A;  2AJQ A;  3C14 A;  3CD7 A;  2MLY A;  2VV5 A;  2JEJ A;  3EYZ A;  2R42 A;  3UDL A;  4OFZ A;  4OYM A;  3SSR A;  4F4K A;  1OSD A;  4S0M A;  4LR9 A;  2BE9 B;  1NHV A;  3B82 A;  1QAX A;  3QFW A;  3OTD A;  1I51 B;  5KT7 A;  4ETX A;  3M8Q B;  4O3O A;  1D8Z A;  5AE1 A;  2KL8 A;  5FJ4 A;  1RBO B;  2HVD A;  4ITS A;  1IBK F;  1E6Y A;  2CJA A;  4YR2 A;  3OJU A;  4DUY F;  1KRP A;  1S9G B;  3B6B A;  4CZC A;  4WBF A;  3V81 A;  1FXR A;  2DIT A;  3TJ8 A;  2DCL A;  4KRW A;  3CMA S;  4FYW B;  1VK8 A;  3P96 A;  2ZM6 F;  1UA0 A;  1FWP A;  3ZZ0 A;  2MQM A;  4OX9 F;  3SIP B;  3GP9 A;  5I3U A;  2EK1 A;  1S1U A;  1QUP A;  3HSZ A;  3IRX B;  4OI4 A;  2Q79 A;  2Y0S D;  3R5A A;  4OIX A;  3AD7 C;  1BQN B;  4OYO A;  1S4F A;  1U1K A;  3FBE A;  4X4Q A;  1NPK A;  1FRM A;  4N7T A;  4M63 A;  1TFW A;  1NB7 A;  4PPD A;  2WB1 D;  4OX8 A;  4AXI A;  1NJI T;  2ZH4 A;  2I1R A;  2XCA A;  1V3Z A;  1A7G E;  3BYR A;  5C2G A;  2HS0 A;  3BSA A;  2H51 B;  2R8J A;  1KOO A;  1MWY A;  4B08 A;  1HR0 J;  2JLF A;  1IR0 A;  2VG5 B;  5J2M B;  4JB8 B;  1FK9 A;  3H5X A;  3ELH A;  4ECS A;  2KT3 A;  4K4V A;  2QLX A;  1IKX B;  1U49 A;  2PT0 A;  2AW0 A;  4FVC A;  1D1U A;  1RT1 A;  3TVK A;  2MKJ A;  3NOG A;  2D9O A;  3D1O A;  2KVQ E;  4FVM A;  2RDI A;  1VRQ C;  4KC5 A;  2E1M C;  2DNO A;  2I5J B;  3LW5 C;  4ED7 A;  2P9G A;  2JDJ A;  2VQE F;  2AZ3 A;  4NLQ A;  2DY9 A;  1YIJ S;  1Q5Y A;  2IMO A;  2HHW A;  2E5H A;  3HJF A;  2A18 A;  3R3T A;  3AAW B;  3RJM B;  4KH0 B;  5H9F J;  3NGR A;  4KY3 A;  5KTQ A;  2FVC A;  2KRB A;  4LF8 J;  3R7S B;  4AL5 A;  2KHD A;  2JRS A;  2W2P P;  3TEH B;  3BO4 A;  3J7Z 5;  3J80 U;  1ZZF A;  3GYG A;  1N32 F;  1UZH A;  1F9E B;  4ZIV A;  1WHV A;  4FP9 A;  4GMK A;  5DET A;  3A8I A;  1HI0 P;  2FGO A;  2C3U A;  3KNG A;  3E3X A;  3L09 A;  3UDC A;  3LAL A;  2YKN A;  1N8R T;  1TR0 A;  4DF4 A;  4KV8 A;  1CS4 B;  1ZOT A;  1RA6 A;  2DT9 A;  4O3R A;  4PXD A;  1ZTW A;  1AUS L;  4F02 A;  1BUX A;  3MUM P;  1JLE A;  2WBR A;  3NXZ A;  1BWE A;  2GML A;  4QZV B;  4A8K A;  3ONQ A;  2XGQ A;  4R5P B;  2ACY A;  3KDO A;  4I7F A;  3DGP B;  2C2R A;  3RU0 A;  3ZNU A;  1JQG A;  3MEC A;  1TKX A;  3CCL S;  3QRQ A;  2IJN A;  3SBM A;  2ASL A;  5ETL A;  3M32 B;  4L72 B;  2JEF A;  2EG1 A;  3QWP A;  1R0A B;  1TL7 B;  2IBK A;  2LEA A;  5DGB A;  4G65 A;  1TL3 A;  1WD6 A;  5H9F K;  4AQY J;  2XO7 A;  4OZ3 A;  4LBP A;  8RUC A;  2V9W A;  5F41 A;  5HAN A;  5AXM A;  3QT6 A;  2FGC A;  5L9X A;  2Y1L B;  3ZTR A;  5T7L B;  1S76 D;  1KLN A;  2EKY A;  5ITH A;  2FJB B;  4LF4 F;  4DCP B;  1UVI A; 
#chains in the Genus database with same CATH homology
 5AJ3 J;  4YY3 J;  1HR0 J;  3J7A N;  2UXD J;  2UUB J;  3D3B J;  4OX9 J;  4YHH J;  1FJG J;  4NXN J;  2UU9 J;  4LF5 J;  3R2D J;  1HNX J;  4X62 J;  1XMQ J;  4LFA J;  4HHU A;  4B3M J;  1N34 J;  4X64 J;  5IWA J;  1XNR J;  1N36 J;  2KL8 A;  1HNW J;  4LF7 J;  4JYA J;  4DR5 J;  1IBM J;  4B3T J;  3OTO J;  4DV5 J;  2KVQ E;  4DV6 J;  1N32 J;  4X66 J;  2E5L J;  4GKJ J;  4NXM J;  3W1Y C;  2UXB J;  2MEW A;  4JI3 J;  4DR7 J;  5FLX U;  3R2C J;  4B3S J;  4DV7 J;  4PWW A;  4JI1 J;  4KYZ A;  1HNZ J;  4JI0 J;  2VQF J;  4DV2 J;  4DV4 J;  4DR4 J;  4DV0 J;  4DV3 J;  4JV5 J;  3IMQ J;  4LFB J;  4GKK J;  4DV1 J;  1XNQ J;  4LF9 J;  2MQ8 A;  4LF6 J;  1N33 J;  3T1H J;  3J81 U;  4B3R J;  4KY3 A;  4DR1 J;  4RJV A;  3D3C J;  1IBL J;  4K0K J;  4LF8 J;  4LF4 J;  2UUA J;  3T1Y J;  5BR8 J;  5IT9 U;  2UXC J;  4JI2 J;  4AQY J;  4JI6 J;  3J80 U;  2F4V J;  1XMO J;  4JI5 J;  1IBK J;  5LM7 E;  5LMU J;  4NEY A;  2HHH J;  4DUY J;  5LMN J;  4LFC J;  2VQE J;  4DR6 J;  4JI8 J;  5A2Q U;  4X65 J;  1J5E J;  4DR2 J;  1I94 J;  4JI4 J;  4DUZ J;  4V1A k;  2MTL A;  4NEZ A;  4KHP J;  3JAM U;  4DR3 J;  4JI7 J;  2UUC J;  2ZM6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...