2MEWA

Solution structure of nuse (s10) from thermotoga maritima
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of NusE from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Structural protein
molecule keywords 30S ribosomal protein S10
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mewA00
1XMQJ 4KHPJ 2UU9J 5BR8J 4LFCJ 3J81U 4PWWA 3R2CJ 2UUBJ 5AJ3J 4GKJJ 4X62J 4JI1J 2MQ8A 2ZM6J 1I94J 4LFBJ 5LMNJ 1N36J 5LM7E 4DV0J 4DR7J 4DV3J 4DR5J 4LF7J 4B3TJ 2MTLA 3J7AN 4JI8J 4YHHJ 4B3RJ 4DR6J 4LFAJ 1IBKJ 2UXCJ 3W1YC 4NXMJ 2VQFJ 4JI2J 3J80U 1N34J 5IWAJ 2KVQE 5LMUJ 4JI4J 4K0KJ 4NEZA 3T1HJ 3JAMU 4DR2J 4JI6J 2UXBJ 4LF6J 4DV4J 4DR3J 4DV7J 2UXDJ 4GKKJ 4DV5J 2HHHJ 4RJVA 4B3MJ 4YY3J 4DR1J 1IBLJ 4NXNJ 1HR0J 5IT9U 4NEYA 4DUYJ 4JI0J 1XMOJ 1N32J 2UUCJ 4B3SJ 1XNQJ 4HHUA 1J5EJ 4X65J 4DV2J 4JYAJ 4X66J 1N33J 4LF8J 4AQYJ 4JI5J 1FJGJ 3T1YJ 4LF9J 1HNZJ 4KYZA 3D3CJ 3D3BJ 4X64J 4LF5J 3OTOJ 4OX9J 2VQEJ 4JI3J 2F4VJ 1IBMJ 4JI7J 2KL8A 4LF4J 3R2DJ 4DV6J 5FLXU 3IMQJ 4V1Ak 4KY3A 4DUZJ 4DV1J 1HNXJ 2UUAJ 4DR4J 2MEWA 2E5LJ 1HNWJ 1XNRJ 4JV5J 5A2QU
chains in the Genus database with same CATH superfamily
1J2VA 5D78A 1MWYA 3VTIA 4PG8A 3RJMB 3SXLA 5GAHU 1SJFA 1NH7A 1P9QC 3D28A 2IBKA 1HQUA 3MHYA 4WYWA 4YB7A 4FN5A 2QFJA 1B0PA 3C15A 2ZZNA 4NCGA 2CPZA 5KT5A 3QRRA 1SJQA 2E5GA 2KZMA 5HVHA 2VC0A 2VFTA 2IA0A 3DMJA 1JLEA 1QM9A 2DGXA 2IFXA 5CYMB 1HNXF 4G3IA 5F8NA 3H2VE 2V6AA 3W2WA 5M2RA 4OJHA 1YZ6A 4F4ZA 5KFXA 3H25A 5H9FJ 1RABB 2BOPA 1KC8T 1TUGB 2FJDB 3MMBA 2VU5A 4M5JA 2MQ8A 2GAGC 5HBMB 3N5BA 2JZ5A 4FZVA 1SJ4P 3KLFB 3I5CA 2DT9A 1G4CA 2M3DA 4ED1A 2KXFA 3FEXB 1E6YB 2OPPA 3W9HA 3KHGA 1EKRA 2CWXA 2LXUA 1PJ5A 2HQGA 3MEDB 4E2FB 5HSPA 4KGVB 2RMLA 3JQJA 5BXIA 4B08A 2CJYB 3I9V9 3M8PB 3N0VA 1CC8A 2QG9B 1SI9A 2GVDA 4O3SA 4ECZA 1N5SA 1XK8A 3EXCX 2R8KA 2XYHB 3HT3A 2XLIA 2LEBA 1VK8A 2KRBA 4AUKA 4FXVA 4DX8H 2YH1A 2Y1IA 1EP4B 2Z0GA 4RLEA 3NOCA 3QT5A 3UVJB 1UEVA 2KXHA 4WU3A 4U8VA 4LFBF 1RAAB 5BJRA 4Y2KA 1UA1A 3M30A 5HP1A 3FCWA 4ZCIA 1U02A 3FFIB 1CS4A 4R0EA 3OXLA 3KLFA 1R8CA 3DM2B 4F3OA 4USTA 2MB0B 4IOCQ 3UDLA 3MEEA 4PG7A 3NGTA 4F2SA 1NEEA 1ZOTA 4OI2A 4Q2MA 1RT3B 3D4JA 4C0BA 1NJWA 1TV6B 2CUYA 4R5PA 2AYBA 4QYZK 1NMEB 2YPYA 3HULA 3TI0A 1AZSA 2YKMA 3F41A 3G82A 3MUTP 4K5RA 1UVNA 2HHTA 8RUCA 4MKAA 4B9TA 3KKFA 4JUZA 2V2QA 2MPUA 4A47A 4EYIB 3H40A 1SL1A 2RB7A 1RCXB 4F2RA 1AUSL 2CDRB 2M52A 3C46A 3A13A 1U7LA 2DHXA 2VG6A 4NLUA 3CCMS 1I5OB 1JIHA 3IM8A 5HL7Q 1Q5VA 2AV5A 2HYIB 1U24A 1LKZA 4DV2J 3PNIA 1UPMB 4K8RA 1LV5A 2D69A 2HEKA 5J1EA 5EGYA 1C1BA 3QIPA 2XWYA 3FFIA 4V19J 1JLQA 4J9NA 2OAUA 2NUHA 3CW2C 3FZBA 3OSNA 1WNEA 3JYTB 2KTQA 3AXMA 3CD0A 4DCOB 2GMHA 2EVZA 1UJ4A 3VVUA 2IM3A 1UWBA 1Q0NA 1U1MA 3DRSB 2YQ1A 5HJXA 4WP3A 3HDSA 4XK8C 5IT9Y 2MDAA 2HNDA 1YI2S 1XQIA 2HFUA 2VG6B 4PG4A 2GAHC 1IVZA 2O3DA 3CC7S 1Z2LA 3T6BA 5JMNA 2IJFA 5GAEU 2LKZA 4MFBB 4URSA 2BDPA 1REGX 5KG1A 4ZPAA 2QC3A 3CO9A 1ZM9A 4JI5F 3BO2A 3O1LA 1LWFA 2QA2A 4NA2A 5DQIA 5J2MB 4NYPA 3MR7A 3T1YF 1DJ0A 1Q53A 2JC0A 4PXDA 1SB6A 4QIEA 4OI4A 5A8RA 4ECSA 4MH8A 2ZFHA 3SIPB 3RUBL 5C7PA 4V19X 2LMIA 3BGFA 4IG0B 3I55S 1AW0A 2HVIA 4QPTA 2CXEA 3DHXA 5KG0A 4ECUA 2G2OA 2XNQA 4OL8A 4JV5J 3EYZA 4A8WA 2W2MP 3E01B 4DR7F 1FX2A 1ZBTA 1RWKB 1YKWA 5F0UA 2N82B 4HYKA 1T9WA 3BSOA 3GR0A 1X0FA 1W2IA 4LQ9A 1KSPA 2J7KA 2A6OA 2DGWA 5KFMA 1BWEA 2KYXA 5EUHA 1RTIA 2LEPA 1RTJB 2BUNA 1VHIA 2HIYA 3R2CJ 1KLNA 2R42A 3BN7A 4KH0B 4NLPA 5DS7A 3PG9A 4MKVA 4MYUA 2OFHX 4ZP6A 5KFLA 4DPTA 4ZDNA 5LOQA 2Q79A 2C3UA 4EZ6A 4G1QA 2AJFE 3IRXA 2HHPA 2NZ4A 5LMNJ 1N36J 2DXDA 5LM7E 3G6XA 3T3FA 4OYMA 1EZZB 2G9OA 4IFVA 4KO0B 3VCDA 4Z2XA 3GONA 3SYZA 2PI5A 3E01A 4J90A 4DBQA 2JFDA 1HQEA 4DOZA 3Q23A 2EK6A 2RDIA 1S79A 4FYXB 2XNRA 4DHVA 2BJ1A 3ITHB 3M6WA 4NXNF 3PKYA 1UVIA 4M5IA 1VGYA 3EM1A 2A18A 2DNLA 2CIMA 3A8EA 5GVQA 2UXCJ 4TYBA 2VBXA 3VWSA 1M0SA 4PZVA 2OEKA 1FTRA 2B8QA 4KV8A 4LRAA 3ZZZA 1YTYA 2IHR1 1LXNA 3CJQA 2RQKA 4O44A 4P75A 4U7CA 2V9WA 2CVEA 5BYRA 3CF5Q 1QSSA 2QZ8A 1RWXB 4ED6A 2DNRA 4RJVA 2QLFB 3SSQA 1M5PC 2VG7B 2MY7A 2CJKA 4IOBA 1QVFR 3N79A 2M88A 2WHOA 3D1QA 1NJYA 1JJCB 4M5MA 1I51B 3R9LA 2NR0A 4Y6IA 9ATCB 1Q5YA 2CRLA 5KG5A 4W98A 5T7LA 3G87A 5C2CA 3FCHA 4CRJA 3CVKA 2V4JB 3O8WA 2B4VA 1TVRA 3DGVA 2DHGA 2W2PP 3MMCA 2R8HA 2A2DA 3MAQA 2ACMA 4HVZA 4OZNA 2B56A 2GJIA 4KV8B 1RBLA 3KLIB 3NOGA 1RU1A 5ETLA 3BKFA 4OI6A 2HHQA 3MCOA 1FRLA 2VH7A 3EDQB 1SKRA 4ECYA 4YP3A 1RAFB 1NNDA 3DGPB 4A46A 1KVIA 2XI3A 4ED4A 3BS9A 3KUEA 1FJGJ 2IC3A 1YJ7A 1DLOB 5CD4H 1S72S 1VQKS 4J9QA 1DARA 2PIIA 3ISZA 1D0EA 2KVIA 3E51A 5K14B 4CLKA 1S9GB 4L3KA 3PRDA 5KFVA 2XZTB 4QIFA 3J7YI 4DPWA 2XS7A 3D3CJ 3MPUB 1AROP 2D9PA 3D0GE 4J9MA 2KHDA 4DL7A 1I6JA 2V4JA 2WBRA 1Y9OA 3CDUA 4Y2MA 1T02A 3UO0A 1OY9A 2VQEJ 4JI3J 3IBWA 5KFIA 1FRMA 1SJ3P 5IQ6A 2EFOA 2HNZA 4ZVSB 1H2VZ 4PWUA 4P74A 2B5JB 4KC5A 1K1SA 3FBFA 3GLJA 5IFMA 1FFGB 2BX6A 1R6VA 3MUMP 3OD2A 3I9ZA 3NBPA 3CO0P 4Z7CA 5ETMA 1RLDA 5IQQA 3T6JA 1RKJA 2DPJA 5IZHA 3UCUP 3HFZB 2BJDA 2BKOA 1SIWB 1HARA 4QYZJ 2CKWA 4OZ1A 4YR2A 1S1UB 1F9FA 2MQNA 5D0RA 3GYXB 3UNGC 4DPUA 3J7YU 1NJIT 2DEIA 1PYOB 1NKEA 1S0VA 3QJJA 1LWXA 1SQFA 3D6TB 2I5JA 4XAKA 4O3OA 1FJEB 3T5LA 2D74B 4KGZB 1TP7A 4EYHB 2XBPA 1S97A 3H4DA 2J7UA 1A0OB 2GVDB 3DYAB 3I4HX 3FQLA 4DQPA 3TUPA 5LSOA 4NASA 1FXRA 3DLGB 1DRZA 4LFAF 1UW4A 2BJ7A 3P96A 4P71A 1Q78A 1JWWA 1CG2A 2CPJA 4BWJA 1SBRA 3S7RA 1OY6A 1QE1B 5IT0A 2RAQA 3B54A 1TMMA 2QEXS 3C6TB 5K5MA 2R8IA 4IYQA 2V34A 4I68A 1TKZA 2CA9A 1FXDA 1NLKL 2MZRA 3DFEA 3M32B 2H54B 4RW9A 2PE8A 4PWDB 2CZ9A 3M1VB 2LXFA 3M8RA 2VJVA 2IAJA 3M2UB 1NK4A 2I9SA 2UVWA 4NLGA 1I1GA 5E33A 1VRUA 3AH6A 4WKYA 2CQ3A 5LJ3Y 1HNIA 3Q24A 1CLFA 4PG5A 2XMWA 2FIUA 3MPWA 3H42A 1REVA 4M1KA 1IWGA 4BBYA 3IO1A 1SCJB 2UUBF 4L3NA 1O51A 2FHJD 1SKUB 2GVZA 3OHBA 2X3DA 2ASLA 1RJJA 2EI5A 3BDPA 3D1HA 3FK4A 3BSCA 5DLGA 3DRXA 1V3SA 3R5JB 1KN6A 2KRRA 1MN7A 2IJRA 4NZ0A 4ZVQB 4I2QB 2W1BA 3F73A 1FD8A 4B3MJ 3SV4A 2XSJB 3Q2TC 1N0UA 4HHJA 1T05B 1IKYA 4HR2A 2HURA 5A0YB 5KFTA 2HHWA 3GB0A 1DTTA 3J81j 1RCOB 3JSBA 3UR3C 3PRVA 1FA0A 2W4CA 3HHLC 3FMWA 4FNIA 3UWTA 1HNIB 4ZLLA 2MLYA 1R0AB 3GCWP 1DAXA 1VMBA 4OHWA 4OLPA 5LL6d 3PJ9A 4UQTA 1Z4UA 4HHUA 4PEOA 3WIVA 2ERRA 1TUVA 3RGIA 5AXLA 1IQZA 1RXOB 4RNMA 1AYEA 2OP5A 4I6YA 3OTOF 1N33J 3LOUA 4P10A 5HP1B 1LW0B 1S1TB 4CCHA 4B3MF 3AOAA 4JBCA 3G8TA 3MR2A 4H4KC 4ID5B 2G0JA 3MM6A 2CG4A 3K5OA 3DC2A 3UE2A 2H5EA 5E3CA 2V50A 3RR8A 5IOLA 4OX7A 3VAJA 4JI0F 2OHDA 3DOMA 1U45A 2A6MA 4ZS6A 2XMVA 2JLGA 3VGTA 4B3SF 2AZ1A 2WONB 2YKNA 2KM8C 2DKOB 4ZIWA 1A9NB 1FKPB 3FBBA 3RZAA 5HQ8A 1X4DA 1SV5A 4I4BA 4KBIA 4JB8B 3VALA 3M4XA 4B9VA 1NDCA 3KK2A 1CQMA 4OX9J 3M8ZA 4C8NA 1RYRA 2Z58B 2VPXB 3FCVA 4HTIA 2MKKA 3BO3A 2KL8A 1GTEA 3VGVA 4NLWA 2E9RX 3M8WA 3U27A 3JB9k 4C8YA 1U2FA 2DGOA 4FBTA 3WIUA 1P9YA 1Y4ZB 2MGZA 2E1AA 2R7SA 3HX9A 1OO0B 1U48A 3IC1A 5D77A 2UUAJ 4DR4J 1JLFB 4QJVA 3T41A 3PIPQ 3W7BA 2ZHBA 4I6AA 4HT7A 2CZVC 3PDNA 1XERA 1S1XB 3NEKA 2CQGA 4DL5A 1NK7A 4N56A 5LMNF 3R1LA 1N36F 2LQ9A 3WC2A 3AOCA 4FNHA 5KOWA 4QWAA 4DR5F 1H98A 1WI6A 1U2CA 3D1OA 2F5GA 1NPKA 3QFWA 1RB0A 3R6GB 1XWLA 3R8YA 4JP8A 3U1NA 4LQ3A 1R3NA 2BOAA 5L39A 4FF4A 2U2FA 1OMSA 1T9VA 4NLQA 3EE3A 1SQGA 4RW8A 3GJTB 2OD6A 2R2RA 3QBCA 1F3VA 3EZOA 1Z2ZA 2MKJA 2KXNB 4E0DA 5LXRA 4DFKA 1Q7YT 5J2QB 4I69A 3BF4A 1N34F 2DH8A 5A8RB 4OHYA 4K0KF 4P7TA 4D3HA 5G0RB 4F0KA 3P6YC 2ZUAA 2HS3A 1S10A 2B6AA 1NUEA 2E29A 4LRFA 3JTNA 1DQ8A 2DCLA 2GIFA 2OTLS 2J9CA 5DDQC 2MSSA 2FZCB 5KFAA 4CO5A 2ZDOA 1PYSB 1WOPA 2FHJA 3MFHA 1EQ0A 3CJ5A 3J7AN 2WSFC 2HVHA 3PYGA 3LP0A 2DHHA 5K8NA 2EWHA 4YHHJ 3MOZA 1GXUA 5T7LB 2OPSB 2YNHA 1VIOA 3CIMA 4CYUA 4ILMA 3W1YC 4TY8A 1VQSA 2ALZA 2OEMA 3J80U 2MHNA 1X0PA 3KLHA 1Z1ZA 4BS2A 1WG1A 1R0CB 4RWWA 4CLYA 4WKRA 2P2CB 2JJ4D 3I5BA 3P49B 2EFNA 2V94A 2XY6A 3W3SA 3PW0A 3UN2A 3GV5B 1NK8A 2HFNA 4WCEQ 3R6LB 4J9KA 1HFEL 3PM9A 3MAAA 4WFNQ 4IFVB 2QV6A 4KO0A 3CUNA 2HHXA 2MZSA 1H6KX 3K5MA 4ECVA 1FX4A 4B9SA 4I2PB 3KDOA 1ZTTA 2QA1A 4TKTA 4N8OA 4DF4A 3KK1B 4LMZA 1W26A 4IO9Q 4DWIA 3SZ2A 2WOMB 3LPEA 1BLUA 2H48B 2HIQA 2RUSA 5GAGU 1VQ9S 4PQAA 2RILA 4OFZA 4TY8B 2CPDA 3RU0A 1U6ZA 3UI3A 1U6FA 2FLOA 2BANA 4JI6F 4RBVA 3G96A 5D8HB 1C0TB 1HIYA 1YLXA 5DRKA 2HNZB 5KFWA 1WDTA 3T5HA 5KFKA 1XBWA 2OIHA 1SC6A 2PC6A 1FWLA 3VHQA 2DH7A 2I0XA 3Q83A 5GMDA 1FI4A 4WFBQ 3V6DB 3M9MB 5AT1B 5GMKa 3U02A 1NB7A 4JI5J 4Q7AA 2F9DA 1UZHA 5GAHI 4TY9A 3GFXA 2O01C 3M6UA 4C8OA 2UV8G 4C11B 2CJQA 4DS4A 3CCRS 1GXTA 1XNQF 4KT0C 3OJUA 1VS3A 4YFUA 4EFAC 1HNWF 2SXLA 4X64J 1ZM2A 3IWLA 4K4WA 2ZH7A 4JV5F 2EPIA 4LVOP 4DG1B 3E8OA 1QSLA 1TKXB 2EKNA 3QFHA 5D15A 3W5XA 3OTOJ 4K4TA 4USWA 1AUDA 3RR7A 2W24A 4C8MA 1VJWA 4IQXA 3U7JA 1G6BA 1RHRB 2ZKUA 3DI6A 3I0SB 4YB5A 2ATLA 3QATA 1RTDB 4M94A 1R6YA 3R2DJ 3A8JA 3BBCA 4TQSA 2E1RA 2V8GA 4KGMA 2CPFA 4ZP8A 1N5YA 3DLLQ 2A1BA 3I32A 3W5ZA 4OI0A 2E9TA 4JOUA 5EN1A 2J0WA 2ZITA 1KRPA 1U1QA 2QL5B 1V5VA 2VFVA 2HW3A 4YQWA 2B9XA 4GKJF 1TKZB 2BACA 3P3DA 5DZ6A 5IM0B 1KNZA 3KFWX 3I31A 3KJQB 4J9SA 4H4MA 1FKAF 3PYEA 4A8XA 4IFYB 2AZ3A 1HBUA 1HBOA 3VV2B 4Z37A 3OL6A 1FKOB 2YNFB 3I5AA 1YIJS 4NZ7A 4R8UA 1CQNA 2QE5A 1VRTA 3MPDA 1Y10A 1UJ6A 4CZCA 5BR8J 2YWHA 2L9DA 4MJKA 4QR1A 1Q1KA 3PX4A 5K20B 4FPIA 4G1PA 1O5JA 2ALYB 1Y11A 2IRYA 3US5A 4F0MA 5KTQA 3HSJA 4ED2A 2UUWA 3JQMA 1ZYQA 1K9MT 4QCLA 3HI9A 3SCJE 4BC7A 4FF2A 3QJPA 2Q6CA 3T19A 2RRBA 3QAEA 5F41A 2C1EB 1CS4B 1YG0A 3QJLA 1M1HA 3PTWA 2BBEA 1HWLA 2RT3A 2VOOA 2GFFA 1P27B 5DETA 5MAOA 1U1OA 4DSIA 1WC6A 2MY8A 1FCAA 2RD5C 3BM7A 4ECXA 3C14B 3QIDA 3WBZA 2ZH9A 3W63A 3PIOQ 1AZSB 2YKMB 3UN3A 1SJ1A 4FS1A 2R7QA 5C24B 3BR9A 1IKWB 2E5JA 4GVBA 2PDAA 3PR5B 2AJ1A 2JH3A 1Y3KA 4KB7A 1HBNA 3OXGA 1XMOF 4CQ1A 3CXCR 4YUDA 1U1NA 2POKA 2VFSA 1KQKA 2HFZA 2B9WA 1W2BR 1N34J 4UOGA 5ETNA 4ZVOB 4AFFA 2DYAA 1T9TA 1N52B 1WHWA 2CVIA 2DR6A 3ONQA 3P8BB 2QT7A 2ZKTA 4M5LA 3BGRA 3JAMU 4DV0F 1MU2A 2W9AA 2QL7B 4MKBA 2HGMA 3BBBA 4O4GB 1RACB 3MM6B 2H5IB 2Q3PA 4ID5A 3MCSA 4QIGA 3OR2B 4UW2A 2HHHJ 1FDNA 1KTQA 9RUBA 2VZ9A 1HD1A 4GO5X 5A8KB 4DFPA 4ECRA 1IBLJ 3D66A 1VQ4S 4LF8F 2HWTA 5K8MA 2KFYA 4GC6A 2HKEA 2BKPA 3BKTA 5H9EJ 1VRUB 1EARA 2QA4G 3AJDA 1WSRA 2WCXA 1WJ9A 3Q8VA 4KGXB 6FDRA 1BGXT 2NXCA 2AYGA 1VRQC 4B3SJ 1UZDA 4LF9F 3K5LA 4ELVA 2GHPA 5ETTA 1MSWD 1BE4A 3H0PA 3KK2B 1C1CA 1IKXB 2QX0A 2E7XA 3CNQP 3FQKA 3EMTA 1N6QB 5IT9U 1DY3A 1R8BA 7FD1A 3UDCA 4JI7F 1TQLA 1JXVA 1V5IB 2YKAA 5LSRA 4B3OA 4I2QA 3CE8A 1RHQB 2BJEA 3UW1A 2MJUA 2X3GA 2Z57B 3DXBA 3TEHB 2DNKA 2FYXA 3B6BA 3NKYA 4P2FA 2GQQA 2XMUA 3CJ2A 1H38A 3T1AA 1M5VC 2JEJA 3RBDA 1ZZFA 3A3PB 1FHTA 4ZHRB 2VC1A 4L72B 3D6HB 1SJRA 1J5EF 1JLCB 2RU3A 2ASDA 4C4WA 3HHEA 4J9RA 2HFSA 3BQ1A 2JWNA 1L5UA 4O3NA 3AHPA 2WSCC 2RQMA 4JI7J 4ZPWR 1BHNA 2J8AA 1TL7A 3LF0A 5J1NA 3Q8QB 3CJKB 5JVGQ 2CJAA 5L1LA 1FE4A 1PKUA 4KJIA 2HHUA 1YRXA 3B8HA 3GTYX 4ZVFA 3MMJA 3RBXA 4Q0BB 2DNZA 5KFQA 3DLHA 4HACA 1ITPA 1Q86T 1T95A 1YRTA 2ZEJA 3TUIC 1H2TZ 2B51A 4Q45A 4KRWA 1HNWJ 2A3JA 1FERA 2RF2A 3N5FA 3LH2S 3SSSA 4EUVA 4XO0A 4IOAQ 4ZHRA 2HNDB 1B4SA 4X4QA 3KYLA 4NRTA 4DQIA 2HQFA 1F5CA 3CMES 1SV5B 4DI6A 2R2SA 3RRGA 1HKAA 3TZYA 4K4ZA 4Q2LA 2ZJQQ 3WDOA 3GYGA 1LWEA 4ZPBA 3KJVA 4A8KA 2KFZA 1AFJA 1BY9A 2OPSA 3IAS9 4ZPTR 3LW5C 3G86A 3THPA 2ZC3A 2CQ2A 3TYTA 2AGOA 4EGLA 2IA6A 1RHKB 2DGUA 1N8RT 2L9WA 2MSTA 4NMLA 5J2MA 1B0VA 3T5KA 3BREA 4HACB 3TZWA 2C3YA 2C2RA 2FUG9 2DR5A 4RUCA 4U7UD 4RNFA 3NGSA 3Q8YA 4RW7A 1FNMA 5FIIA 4ZN1A 3C2PA 4YB1P 1S6PA 2MMYA 5DLFA 5A2QU 5I3UA 3TO8A 4GO7X 4FF3A 4J5OA 4FDFA 4RUAA 4YMEA 5I42A 3L7UA 5GADU 1KWMA 4NI2B 3L95X 3W61A 1GEHA 3NAIA 4RU2A 3VZHA 4NLOA 4F36A 1NK0A 3MEKA 4MK8A 4RBTA 3KTQA 3W2VB 3B4MA 1YJVA 4I7FA 4ZVPB 2ZH1A 3PW4A 3PHTA 3OTDA 2I38A 2ZWOA 4DX5A 2KT5A 1F5BA 3K8WA 4USMA 2GW8A 1HNVB 3TVZA 1RTJA 1NAQA 2EW9A 1F0XA 2VFUA 2KVQE 2MKSA 3LP1A 1F6TA 4C2MA 4X2BA 2B9YA 1N54B 4OX6A 2H3EB 3OTCA 1RADB 2J9DE 4NOHA 1RE1B 4RW7B 4DV7J 1SQEA 1S6UA 2OI2A 1JLBA 1NDLA 2PT0A 2C2KB 1KQGB 4YB6A 3TUJC 3MXHP 2ZNZA 2HRUA 2JDJA 2MZQA 3BPDA 3HZGA 2L08A 3JS9A 4DSEA 3G8QA 1SPBP 5FDLA 1ZAVA 5DG9A 4NXNJ 4B3RF 4M5GA 1S9GA 3W2VA 4TLRA 1VLOA 1YK9A 3NRBA 2UUCJ 1J5OB 2VB6A 2CPYA 4OYBA 4RBUA 3THTA 3DLBA 3HVTA 3V6HA 2JEGA 1XNQJ 7AT1B 1X4FA 3JSMA 2KJWA 1IUJA 3GIJA 4DG1A 1S77D 2Y1LB 5CZVA 1EX8A 4LF5F 3S6EA 2EKYA 3M9NB 3BQ2A 1X5OA 4A8MP 3G6YA 3TAMB 5D0GA 2VASA 1K8AT 2FZKB 1HQ2A 2RKIB 4KSEB 1YJRA 4RNOA 1WEYA 4YS2A 3GJQB 3L7PA 1RQ0A 5CYQB 2AEFA 3NP5A 3FBEA 2EG2A 2FC8A 4K4SA 4UOHA 1VIXA 5EDWA 1HR0F 2VG7A 1IXKA 3LPYA 3WZ0A 5T14A 3G4SS 1IBCB 1WUUA 1VQ7S 4ZJLA 2M8DB 3CCSS 3PY8A 1XR5A 2NYHA 2RJZA 3KK1A 5F8LA 3HXMA 4XIUA 3P5TL 2WOMA 5HATA 1S1UA 3HVTB 4G6VB 3ZZRA 5JVHQ 2YWGA 4A8QA 4K4UA 3PRBA 1HBMB 4NLRA 1GFWB 4FYVB 4AXJA 3MFIA 4PRFA 3RBZA 2V4QA 3MECB 4DEZA 4CO3A 1X7VA 3O3LA 4R8UB 5KG7A 1XMQF 2D3ZA 4KHPF 4DS5A 1RT4B 2FC9A 4C7QA 4J9OA 4WIIA 1V3RA 5G4DA 5KFZA 4A8YA 2F8HA 2R7XA 2DHSA 1GMWD 1WI8A 5FLXU 4DU8A 2AX1A 5CZXA 5DG7A 3W2WB 3THVA 2E1PA 4DZ6A 2F63A 1RT5B 3B4DA 3I82A 1UFKA 5K14A 3VQTA 3ZTPA 4M95A 3I0RB 4EO8A 2DIUA 1ZPVA 1U0HB 1CJUB 2R2UA 1DTQB 5KFBA 3HJVA 5C25A 4X4VA 4RW9B 1PC5A 2LU1A 1XN9A 3B78A 3CCQS 2F4VF 4IH6A 4NA1A 4KHPJ 2RVJA 1V9OA 3BQ0A 3TVKA 1LQ9A 4CLZA 1JX4A 1Q82T 2J7WA 2RH3A 2HGNA 2KKHA 3QYYA 3VZIA 2CQHA 2PFDA 2YWKA 2FVQA 3GV8B 1NK5A 2ROPA 3R27A 1RAOA 4DX7A 4CDIA 3BEGB 5F8IA 2FY1A 2GNKA 1RWMB 3W60A 1B70B 2MHEA 4KR0B 4LR9A 1IN0A 4C6AA 3GV7B 2ASYA 4X84A 3NS7B 1S6OA 3AAWB 4YDXA 3QGPA 4ANEA 4C98A 1FE0A 1LFPA 2FLNA 2YH0A 1U26A 3EDRB 2G0IA 3IG1A 2Q66A 2HVEA 1H72C 5C25B 1IWAA 3HO1A 4XPCA 3DOLB 1S48A 3SFUA 3CCLS 3PKMA 1BC6A 1DBDA 1VQLS 1DTTB 2HVZA 5JXSA 3P45B 4IRKA 2ZH8A 2NZCA 3PJWA 2ZBQA 1M5OC 2DRAA 4ZITA 3NNCA 5KFEA 1VRTB 2CNOB 5DZ7A 5ITHA 1D1UA 3TQEA 3WHIA 4O0NA 2HQ3A 1UJ5A 1YBTA 5B09A 2FDNA 1NBEB 1RAIB 1WDDA 2AW0A 3QPIA 2ZUGA 3BH7B 1C1CB 3GFZA 3K17A 3T1HJ 1QE1A 4OYIA 3V4MA 4DX6A 5J2PB 3KJFB 1NU4A 4DR3J 4IKAA 3AJ1A 4F7VA 4PYAA 1JLQB 2NSBA 1T03A 2LQBA 2BMBA 3M8SA 5GADI 2Z4PA 3GMGA 4M5NA 1WC4A 1L3SA 3DOLA 3K89A 4NMXA 2HBZB 3VAKA 1FRIA 2NXNA 5L9XA 1R89A 5E3AA 3ADAC 3QT8A 2AQ4A 3C19A 1WOSA 5SZTA 2DRBA 1Y00A 3DU6A 4KAIA 4NLYA 5AXKA 3D67A 3TJ9A 1FEHA 1QJHA 4ZIVA 2GJFA 1JK9B 1HBNB 1OYEA 3CJ3A 1S4EA 3GR1A 4BHQA 1UVMA 1KKHA 1TL4A 4RNHA 2P9GA 4DCPB 3NS6A 2NSCA 3DRYA 5F8HA 3IWXA 3OFGA 1WEZA 4PPZA 5EWGA 2ZE2A 4MFBA 5DDPC 5J2PA 2G4BA 1RWNB 4GKKF 3CTRA 3HFVA 3HD1A 4WFXA 2C2EA 2BV3A 2GX8A 3ENQA 4LJMA 4OMFG 2UUTA 3NXZA 1JKHA 2E5IA 4RPFA 1V3ZA 5D4LA 5KFSA 3EPIA 4WWSA 4DV6F 3M6VA 3N9UC 5EHHA 1WSVA 2QRRA 4DPXA 3ZNUA 3TZZA 1FRXA 2WVCA 3HD2A 1CJVB 2E1CA 3TR5A 3BZQA 3QQCD 5K9FA 2DEJA 3I4PA 5CD4A 1RKIA 3GCXP 1B0TA 1KFDA 1ZM4A 2IM1A 3F56A 4KPCA 4ZPDA 3PXGa 4MTPA 4ZJOA 3UDVA 5RUBA 2MJNA 2NLWA 4X65F 3NNAA 4AD6A 1F5AA 5D0HA 1SC1B 1VQ6S 2W25A 1YJNS 1S1VA 5F3ZA 1QDUB 2F65A 3VF0B 4CLUA 4P72A 2IVYA 3QIPB 3H2UB 2R8GA 4AQYF 1N48A 3AD9C 1Y5IB 3HKWA 3QO9B 4V1Ak 1RTIB 3ZZPA 2Z8QA 1PO6A 5F0WA 1IM4A 3PCOB 4NE9C 4A48A 3CJ8A 3FGVA 2GZOA 4U8YA 2MEWA 1VFJA 4LF2A 2KYZA 2FVRA 2Y0BB 3AB4B 3HVWA 2W7AA 3ENWA 1C4CA 1OJ4A 5B0AA 5KFDA 2DR7A 2ZBCA 1JLCA 2YNIB 1P6TA 3DOKA 5HVGA 2IVMA 1WTFA 4CM2A 4N7TA 1LOUA 2D1CA 2X1GA 1ELOA 3BV8A 5B0BA 1VDHA 2L3MA 4ETXA 1G7CB 3ZFVA 2YKQA 1S1VB 3KWMA 1MWZA 1H3DA 2EFGA 3MZIA 3ZZUA 5DG8A 4IR1A 2HAIA 4I7FB 2ADBA 1XEZA 2W4PA 4KPYA 1RWUA 3AD7C 4Y34A 3H5XA 2ZC4A 4CTAB 1U0SA 2IMWP 4P2MA 1LWCB 2CPXA 3KLVA 2RRNA 1X8DA 1XR6A 2UUBJ 3DLEB 4CNYA 3HK2A 5ETQA 1B7YB 3M6XA 4ETZA 4D3GA 2R7RA 3M8QB 1TFYA 1HWKA 3IBCB 1IKVA 3IP0A 4J9VA 1UWAA 4IG0A 4Q8FA 2BJ9A 2FJEB 5GAGI 1U1RA 4ZVEA 2UP1A 3FDSA 2X7IA 2VKRA 3R5DA 4USUA 2RDJA 3KLGB 3K0JA 3MMAB 2UU9F 2XGQA 2BM0A 2ZWPA 5DDRC 4NLSA 2J6TA 2EC0A 1RHMB 3R97A 4JI8J 2YY3A 4WBFA 2Z2YB 4M5HA 2ZOFA 1S9FA 2LFVA 1IBLF 2Y8WA 1G3OA 2XY5A 3H98A 3M8YA 4DR6J 2HAFA 3SQGA 4DL6A 3AXKA 2DVIA 2BKNA 5ETVA 4CTAA 2ZH5A 1K1QA 5F9NA 3K58A 2EK1A 1ZS6A 2BE7D 4WP8A 5HQLA 2BANB 5IWAJ 2BR0A 5A8WA 4M5DB 2HHVA 2HWIA 3PEJA 1R8PA 2H5JB 4WTOB 2J9DA 3HVAA 4Y2CA 3C16B 1TTHB 2IJNA 1RT7A 3MM7A 4PPDA 3DRPB 3WX4A 6FD1A 1FJ7A 1LK5A 1Y0HA 3EWGA 4RKUC 3OR1A 2Q43A 3V6DA 5F9LA 2ZHAA 3GFYA 2B3TB 4URQU 2C2DA 2B43A 2KU7A 2OELA 1VISA 1CJKB 2KG1A 2YXLA 1NSQA 1UEKA 4EWTA 1N4LA 1TK8A 2C2MB 2JNJA 1WWHA 5IC4B 4JI0J 3CJ4A 2CPIA 2BJ8A 4WFYA 4Y00A 4M5KA 4C48A 1WKKA 3HKZD 1PG5B 3BB5A 5D4OA 2MKHA 2V8DA 2AYMA 3ISND 3CWJA 3TZXA 4YR3A 4DF8A 3FEZA 4WXOA 3BSNA 1CEZA 1HNVA 1NSPA 4OYWA 1J5EJ 1DHMA 1P8GA 2LDIA 3OPKA 2FVSA 1A7GE 2GA7A 2VBYA 4ZCMA 5KT7A 2HSEB 2YX4A 4DR3F 2AU0A 1PC4A 4X4OA 1D9DA 3H4BA 1RT4A 4X66J 4EBEA 3C16A 3DKDA 3NLCA 3KHLA 1N5QA 1ZA2B 2Y1JA 2LQ5A 5CAAA 1YWXA 3MAAB 1NK9A 3KOAA 3Q8PB 4OZ3A 2QO3A 4ES3A 1RT5A 4NCBA 2XTJP 1SKWA 2RE1A 2L41A 3CJTA 4KYZA 1X9MA 2OSQA 2CJXB 2NCKL 2C42A 2PSZA 5IXUA 3V6JA 2JRSA 3K5PA 3NAHA 3DDNA 2RS8A 2K7JA 4X66F 3EGWB 3CDAA 2JVOA 5BYQA 4ZLJA 3KLIA 3PYFA 4LR8A 1VQOS 3TAMA 2QSFA 4OHVA 1D9AA 4NCGB 4DPOA 4USHA 1EIYB 4DV6J 1VQ8S 2HZVA 1S57A 4CLSA 1PAEX 4LSNB 4XPEA 2K7KA 3HHLA 2B7CB 3IMQJ 4DUZJ 3U1MA 1CULA 2OSRA 2NYIA 2WVBA 1UFWA 2XCPA 1WHYA 4I1TA 5L1JA 2C22A 1YJWS 2E9ZA 3BKUA 5KG2A 4FYYB 1OPIA 1HPZA 4X64F 4UZBA 2BYCA 4FVMA 1R27B 3D5MA 3R5GA 4QR2A 3PX0A 1RT6A 3LUYA 4ICLA 2IAJB 3L3CA 2DNNA 1BWVA 4J9LA 3MPVA 1WKJA 2P9CA 1VHFA 5KT3A 5EWFA 2HS0A 7FDRA 1T7PA 3KNAA 2FGOA 4LSLB 3TNVA 4ZVHA 3SI8A 5HAOA 3TP2A 2GMJA 2VPWB 3B82A 3MD3A 2W7PA 1UA0A 1N5YB 1KR4A 3MM9A 1GMUA 2QMUB 1CULB 4NA3A 4PWWA 5I3QA 2VQFF 2J5AA 1TK0A 2GC8A 3HHDA 3UVJA 4AT1B 1EQMA 5ADZA 3GIIA 4ILRA 2MLZA 3QSIA 4OI1A 3IWNC 4JI1J 4GKJJ 5FJ4A 5ETOA 3IBFB 2DNGA 2GGPA 3I0RA 1QTNB 1RTHA 2OUGA 4K2XA 4O4GA 4BDPA 4ZMMA 2GQ2A 1CJUA 1NO8A 4HI2A 4NLDA 1JJ2R 2PD1A 2MYFA 4H4MB 2NPIA 4F50A 2HRYA 3A12A 3ETOA 4DXLA 5A0YA 3R5CA 1HD0A 4USVA 3Q0AA 1EETB 1FVQA 2CNNB 5LXYA 2XGPA 3DHWC 3LGMA 4I0WA 3BN4A 1RWWB 4K4VA 1PILA 3C15B 3HT0A 2XHWA 1LW2B 4KHMA 4F25A 1MN9A 2UUCF 2VQFJ 2VDHA 2GS8A 4N8NA 5CYMA 5ETKA 4LT6A 1KQFB 3ZZ0A 3GP9A 1HWIA 1WEXA 2Z2LA 3CCWA 3N6MA 4B9LA 1KOOA 3RAXA 4JI4J 1RDRA 2ZVSA 3CCZA 4TXSA 3IGVA 4PR6A 1S7HA 3OLAA 2ZE2B 3KG0A 4OHXA 3MMBB 2F7VA 1N6QA 1KONA 1S9EA 5KFUA 4JI6J 2EG1A 3SSRA 4DV3F 1FXLA 3R3TA 1DURA 5A76A 2KG0A 2G1DA 4HI1A 1YBAA 2ZH6A 2XC9A 1FVSA 3MM8B 2QJ3A 3I87A 4MKYA 2GMLA 3W65A 3MEDA 2K1RA 2D9OA 3OT9A 3R7BB 3O6QA 3CDEA 4NEYA 3EXYA 1R8HA 1XMOJ 1NK6A 3E2EA 5HN0A 4DL4A 5HROA 2C2OB 1NSKL 1REVB 1WF0A 3G6VA 4C8KA 1V6HA 3AT1B 3HPOA 2AD9A 1H74A 3LWLA 4KGKA 3NS5A 5E0OA 4QBUA 5J2NA 4HKQA 5KFOA 1VQYA 2MXYA 1RHJB 4ZVGA 1F9HA 3Q22A 3FRYA 1NJZA 2WVEA 1UKUA 1VK3A 2IRXA 2N3OA 2DH9A 3ZTQA 4AQYJ 1KBRA 4ZA1A 5L1IA 2J76E 1RT3A 2OGUA 1T05A 4Y3CA 3NNHA 1T3NA 2K1RB 3N6LA 4CH7A 4DU7A 5KFNA 3KLEB 4G65A 2RF2B 2BM1A 2VKZG 4GRSA 3UDEA 1FEEA 1Q79A 4OZ0A 1GX5A 2ZBPA 1R0AA 1SC3B 3KMQA 5U47A 3U1LA 3UD4P 1GNKA 2W01A 2IM0A 2XS2A 2CQ1A 1RWPB 1X4BA 3EGVA 1U8WA 3LGHA 2NPFA 1KVKA 1VLYA 5HK4A 3SCKE 3OVSA 4EBCA 2ZJRQ 5J1EB 2E5HA 2XO7A 3CCVS 1BQMB 4UZCA 5GAEI 2K8GA 1PAUB 5HMYA 2V5HG 4RNNA 1WTBA 1UVLA 2OD4A 1LXJA 4HH0A 2APOA 5BR8F 2PFFB 3EUNA 3LP2B 5HMWA 2QMXA 4DSLA 2PGCA 3A1YG 1A6LA 4ZLNA 2N4DA 3DRSA 5HLFA 3M2RA 2E5LJ 2VUGA 3IRXB 4HLBA 5DGAA 1S6PB 4O4RA 2H65B 5EX3A 1FO1A 2A10A 3CEDA 2Y8YA 1TL3B 3RYLA 1R7IA 5KFCA 2DGQA 4J9UE 3CPWR 1HQEB 2VPZB 1Q7LB 2CNKB 2UU9J 1QUPA 3TUZC 3LAKA 2AIRB 2DBBA 4S0MA 2OPRB 2OJ3A 2ZD1B 3V81A 3FVYA 1OS5A 1XMBA 3VAMA 3QO9A 3ICLA 4XDCA 1S59A 4J9PA 1C2PA 3LP2A 3EGZA 5A8WB 1VBYA 3OL7A 2VL1A 3DN9A 1HW8A 2IDLA 2BVZA 2F4FA 2BZ2A 1RYSA 4UY85 5HLFB 3SBMA 1NDPA 2RDDA 2LVWA 3N01A 3IRWP 3DRPA 4WPAA 1S0OA 1VQNS 4RO0A 4LFBJ 1TR0A 4N5SA 5JUMA 3CC4S 1G1XA 1T8EA 1TL5A 3J7ZT 4X4UA 2KFNA 2D41A 4F26A 3NWRA 3TA2A 3W62A 2DR9A 1UTAA 2HHHF 1GH8A 2MTLA 5FDLB 4LIRA 3LTOA 1LWEB 1DQ9A 4HT5A 4LFCF 2PMHA 5KFJA 2FGCA 2E7VA 3ET6B 5CYJA 2N4CA 2ZD1A 3V81B 2YTCA 3MTKA 2YQ0A 1FDBA 3GJRB 5T41A 4F4WA 3TJ8A 2HZCA 2B4PA 1Q16B 2HGLA 4NEZA 5A6WA 5DM6Q 3BYRA 2WZ1A 1VQPS 4DFMA 2W2QP 4HDHA 4IG3B 5F3TA 2R8JA 3MR6A 1VC6A 3J7A1 2FY8A 2XQCA 2CWKA 2YVSA 3DGPA 2BE2B 3HHKA 2QL9B 5E3RA 2VODA 3V4IB 4YY3J 4H54A 2IC3B 3JSRA 4LVNP 4NI2A 1VCTA 3NCRA 3ZNJ1 2AEJA 3DXSX 4QWCA 3DLKB 1N32J 2IYIA 4PUOB 3ETMA 4DUTA 1HMVB 1P1LA 3ET6A 1PSDA 3ILIA 3H5YA 3TEGA 3MURP 4PXBA 3HP6A 1K73T 1HBMA 2B8PA 3FC9A 4RR5A 3DRRA 3KLHB 3H5SA 1HI8A 3LP1B 4X65J 3HF5A 4ES1A 2EC2A 2B7BB 2FD2A 4DV7F 2V68A 2Y9HA 4O44B 3GSDA 4DL2A 2OKQA 2HFVA 4IG3A 2RRAA 5SUHA 5B08A 2ADCA 4N76A 1OQ3A 4LSNA 2I8EA 4ELTA 5KFYA 2ROGA 2K3KA 2AX0A 5ETSA 2R7VA 2V2ZA 3QWUA 4FKYA 1VI7A 4TU7A 4RW6B 1N32F 3PEHA 4I2PA 2DY9A 3T1YJ 3QRQA 2JL9A 1W7WA 1RP5A 2GIRA 2I1RA 3AODA 4P7VA 5EX0A 3ZC4A 4C0HA 4XDDA 3GWCA 3CCJS 1N5VA 3OW2R 4LF5J 4O3QA 4PABA 2VF3A 3ENAA 3TA0A 3TW0A 4YDDB 3PW7A 2BW7A 1TK5A 3E3XA 1YJ9S 5F8MA 1ROFA 1RA7A 2G2YA 3DYAA 4WIQA 5CABA 1C4AA 3I6PA 3KJNB 2H51B 5L8RC 1CSJA 3VGUA 1E6VB 5K8OA 2XO6A 2ZOMA 3TAQA 2HS4A 1KDNA 2H4WB 3FEYB 3IM9A 4QZVB 2C2ZB 2HZAA 3ILOA 2R2TA 5KT4A 3RRKA 2CAJA 1K0VA 2XYPB 3ENVA 2PEBA 3UFCX 3PVXA 1SIZA 2AP6A 5M2UA 5HBMA 4NWBA 3QLHA 1OY8A 1XNRJ 4W92B 1U49A 4X4PA 3FSIA 3DCAA 5AE2A 1U09A 1AT1B 1X60A 2XG8A 1I94F 5HMZA 4FS2A 3C6UA 4B02A 2FHOB 1SH3A 2CADA 3Q86A 2NREA 4CH1A 3VVTA 2BABA 2PA3A 5F8GA 3H5UA 3EVOA 4JI8F 3I0SA 4ZP9A 4NCAA 2ILZA 4OYZA 5H1SV 3H90A 1I3OB 1HW9A 1ZETA 3OL8A 2CZ4A 2H4YB 2MQMA 2XWXA 2IYGA 1HWJA 4O3PA 4K50A 3GE9A 4UY8T 5IWAF 3RW6A 3MAHA 3BGRB 2ILYA 3M30B 4CI0B 1IJFB 2KHCA 4JI4F 2HBQB 2ZH3A 1TFWA 4Q44A 3OJSA 4ZLPA 4DV0J 5A2QY 5LJ5Y 3HHNB 1DTQA 3D68A 2YKOA 4DR5J 3MCMA 4OIXA 4UUWA 5A8KA 4B3TJ 3P4UB 4R5PB 3GPAA 1S0MA 4AL5A 4CT8A 2R7TA 4L73A 3H8YA 4ZK7M 4TU9A 2ACYA 2FJXA 3LQVA 1R0BG 3OFEA 1IBKJ 2CFXA 3KK3B 3DMJB 2DXEA 3IS9A 1OYDA 2R4FA 1O0PA 1HI1A 2DNYA 3CIZA 3QMQA 4WK3A 4JI2J 1PBAA 1TUWA 4A8SA 5AJ3F 2FPHX 2XYGB 4GMKA 4DL0C 5J2NB 5E3QA 4DDFA 1ICEB 3I56S 3AD8C 1URNA 3PW5A 2AF6A 1Y7PA 1UVKA 3MTJA 4RWXA 2BW2A 1RSCA 3C6TA 1SH2A 3Q8RB 2GO8A 4HHHA 5F8JA 3GZ7A 5GMEA 1FT8A 1KHWA 2MZTA 4YN3B 1X4EA 3JYTA 1NM2A 5CCMA 5D4NA 4PWDA 3T9NA 3C14A 3MEGA 3V6KA 2VA2A 2NUUG 2QN6B 2MQQA 1RTZA 5KT6A 2M4MA 2O66A 2FHMA 2XZDB 1HR0J 2CJBA 4WZQA 2H9ZA 5C24A 3GILA 3TQ1A 3HSDA 4FYWB 5L38A 4QIWD 1LW2A 2B9EA 2FVCA 2ROEA 2JLFA 3W66A 1WHVA 1RK8A 2RUGA 4LRDA 4URGA 4EZ9A 3T1HF 4WU2A 4QWBA 4ES2A 1GX6A 2YWFA 1VC5A 3TX8A 2H1YA 2CQBA 2AYEA 1NHKL 1RAJA 1U2RA 1MNEA 4WXWA 5ETPA 2UXDF 4JYAJ 5HJYA 1BQMA 4EMDA 4Y0FA 1QAXA 1RAGB 1S9EB 3FMBA 2AJ4A 3QZ8A 1NKBA 4KTQA 1L3UA 4HTJA 3BR8A 3OUYB 1MMLA 2ASJA 2U1AA 2XSJA 5HI7A 4CO1A 2FLLA 3QNWB 4DN0A 4DUZF 1LEOA 1KFSA 4TQRA 2Z2ZA 5E7OB 2XLJA 3KXDA 4ANCA 2FLPA 4B9UA 1OWXA 2W9CA 4OJGA 4X4SA 3RRHA 2E5LF 4IH5A 2CQ4A 4C97A 4J7CA 2YNIA 4Z7YA 4U6PA 4LUBA 1FRHA 5I3PA 2WW4A 2DR8A 2PO4A 4JYAF 2GHWA 4WE1A 2F1FA 1VQ5S 1D3WA 1C0UB 3OVAA 4P9SA 1PYTA 1QUVA 1VYAA 4RL1A 2B4UA 4LF4J 2CJ9A 1JKHB 3J80Y 2XMKA 4OJ1A 4QW9A 3D2WA 5MLCV 3OTEA 2GCFA 1IM6A 2N3LA 4CLPA 3S8SA 2J0QD 2IY5B 5KOXA 2HNYB 1UWBB 4HL9A 1JLAB 3S1TA 3ZTRA 5C42A 1FNOA 3M8QA 1JJHA 3KLEA 2LLZA 5D3GA 2P9EA 1X9SA 2UVVA 1N56A 1GK8A 2B6AB 2BEFA 2IPOB 3SV3A 1NHVA 4QWEA 1G2EA 1FKPA 3M2VA 2BA9A 3O5TB 4DCJB 3FSYA 3IN5A 1IJEB 2ZVIA 2BQRA 2DTJA 2EFQA 4MYTA 3A3OB 4R0JA 3QWPA 2K06A 1PJ7A 4UUXA 5D0EA 4CO2A 4NLXA 5LSLA 2OTJS 2DITA 3L09A 3AA9A 4PXEA 3UN5A 1H2UX 4MIBA 4N47A 2ATCB 3MDFA 4ZN3A 2EFPA 5BYSA 1U25A 3RBEA 4IRDA 2XMTA 2XMJA 2Z30B 1M5KC 4F67A 1X4GA 1S6QA 3HM9A 1WG4A 1YHQS 2F8MA 1QSYA 1BQNA 4C3MA 4F3QA 5DQGA 1WC3A 5D3GB 4ED3A 2FJBB 4OYOA 4DPYA 4A4JA 2ZNYA 4RU9A 2V63A 1S0NA 2BQ3A 4B9NA 1JLGB 1S1XA 3M2VB 4HEA9 3N28A 3KG1A 1NSAA 4NYZA 3V4IA 3RB0A 2NXEA 1N5TA 1Q4RA 4YY3F 1RGVA 1B64A 3KMSA 1TMJA 2DB1A 4DFJA 5M2PA 2W7OA 4PUOA 2OPRA 2HLTA 3H20A 3AJ2A 4ECWA 4OZLA 1K44A 3OV7A 3DRRB 4LBPA 5AXNA 3MR5A 2R9LA 1QAYA 5DJBA 3RAQA 3JSYA 4I64A 5B7WA 4OZ5A 2QFIA 4DR2J 4WFZA 3V2UC 3RTVA 4DV4J 4B9MA 2I6WA 4G1QB 1IKVB 2RKIA 1M1KT 3QAUA 4MIWA 4C3KA 1X9WA 1PGZA 4GKKJ 5KAKA 2J8SA 4F4YA 1QVGR 3OFHA 4P6QA 4OZ2A 3BGUA 2QLXA 4LIWA 2FTRA 4Q8EA 2VONA 1JMTA 4WK1A 1GT8A 1RT1A 2XY7A 4RW6A 2C28A 3M05A 3LP0B 3MD1A 3POTB 4DUYJ 1OSCA 1WC5A 2AGQA 2DCUB 4CLWA 2UXCF 2OO4A 4ID8A 1CJTB 1PIEA 2JEFA 5B0GA 3SDEB 1RHUB 1KHVA 2HK2A 1H7WA 4OZJA 4ZPCA 2MKIA 4DR2F 1NPPA 1DFDA 2FHKA 2FZGB 4P73A 1Q81T 2YX1A 4BC9A 2KM8B 1U8SA 3LALA 2JFKA 4OV1A 3CCES 1WC0A 4DLEA 1SL2A 4O23A 4OI3A 1D8YA 1E6VA 2EXUA 2P6SA 4MMOA 3HHLB 1QY7A 4KHRA 3KG4A 2V8VA 3EGNA 5JJBA 1FK9A 1T3OA 1CC7A 1WACA 1RT1B 1CJKA 4OJ3A 4YOEA 3K5NA 1U47A 2NS1B 2KT3A 1NKCA 3RG6A 1VQMS 2UUAF 2F3JA 1TL1A 2DNHA 2HMIA 2PMWA 4C9DA 2Y1RI 2WW8A 4B17A 3BJYA 2LQ8A 3N4WA 2P8IA 3MMCB 3TARA 3C6UB 3RB3A 1KVJA 4UOFA 1H7XA 4DJBA 3CJSA 2K2PA 4DSFA 1K47A 1PCAA 1KEKA 2M8HA 2KI2A 3M9OB 4ZJQA 4Q5VA 3OVBA 2EEYA 3C8YA 1VJQA 2QYGA 2V8PA 2HQIA 3DLGA 1CVJA 2C3OA 3IR7B 3NCPA 4ED0A 3BYPA 4FKXA 1WG5A 1RZMA 4N41A 3WX8A 2HQDA 3KHHA 2DPIA 3D54A 1LNQA 1RTHB 3CB4A 2W2NP 1YJUA 4OYAA 3DLJA 1NCLA 4USJC 4WP9A 3VAGA 5DQHA 3H2LA 4F3MA 4QW8A 1JXLA 3GG0A 1TKXA 3H7HB 4WF9Q 1EAYC 1RUSA 2E66A 2O1PA 4LF1A 4RUHA 2HRTA 2A0FB 3JXOA 4LF4F 2Z56B 2JEIA 1MMDA 1TAQA 1EB0A 4CO4A 1WD6A 2B5JA 2PA8D 1FJGF 4YHHF 4B3RJ 1EHWA 2NXUA 3HFKA 3IS9B 5IT4A 1X4HA 1VBKA 3F0NA 2YBVA 4IDKA 3MCNA 2BE9B 2M70A 1S7IA 2OMOA 2P6TA 2LP4A 2V0NA 2WVFA 2YNGB 4JI2F 3TWZA 3PR4A 2W8LA 4FF1A 1U6BA 4NPOA 4ZCLA 4KIAA 2OMLA 2DGVA 1QD1A 1ZPWX 3IAM9 3DM2A 3K7RA 3KUHA 4FPRA 1U0HA 1WHXA 2J0XA 3MEEB 4DSKA 4Y28C 2DO4A 2CPEA 3EICA 4IFYA 1TZ0A 1IKYB 2KB2A 4IQMA 4PXCA 4ZVUB 4LF7J 3OQ2A 1FKOA 3ZXWA 4ZOSA 5AXMA 5L46A 2DRDA 5K8PA 5CHCB 5A6PA 3HVRA 1YSJA 1S99A 4TN2A 4CWBA 4MK7A 4DQSA 3SFGA 3OBIA 1JLEB 2E7WA 1DZ5A 4QYRA 2IBOA 2VFRA 3NMAA 2HBYB 4OQJA 3WQPA 5EWEA 2XSFA 2MQLA 2LQJA 1MW7A 4L75A 1Y5LB 3UCGA 1KLMB 4OYXA 1S1TA 3IR6B 3BPSP 4K59A 2GGPB 2N7CA 5DM7Q 4C3LA 3EX7B 2KT2A 3IG1B 3OTBA 2KDOA 3M32A 3OUYA 1NHUA 4QQBA 3ZTOA 1E6YA 2OPPB 2JSXA 5THWA 4QU7A 1TELA 2HLUA 2YWWA 3CDWA 1L3KA 4G1IA 3FJ2A 4FP9A 3G9CA 1EETA 1YVFA 3DOMB 4CH0S 1JQGA 1RWVB 4XTTA 3FNNA 1FWPA 2WONA 2YKNB 2Z2MA 3GSIA 1HA1A 1LFWA 1W25A 2L48A 4QPXA 1UL3A 3BSAA 1U1LA 1NJXA 3PJXA 3NL0A 3KK3A 4PG6A 2XMAA 2M7SA 3LO3A 1Q8IA 2V4RA 4BCAA 2GVZB 2UXBF 1FTCA 4LR7A 3RAMA 3V5RA 1YITS 2OPQB 1WELA 4I67A 1MWQA 4AE5A 4WFAQ 3DDIA 5AE3A 2MGZB 1T03B 4Q0BA 4RW4B 4HH1A 3CULA 3Q2SC 4MK9A 1VR6A 1YJTA 1YZ7A 3MEGB 4DV1F 1JLFA 4PQUB 4QWDA 1FD2A 2F8EX 2VV5A 4PCQA 2DK2A 3M2RB 1HHTP 3AOBA 1XC9A 1FNXH 2C3MA 4L74A 4K4YA 3GYNA 3VAIA 2ZZTA 3IGNA 4MAKA 1M90T 3WC0A 5LMUJ 2LCWA 2V8HA 5DO2A 1IR1A 3M7VA 1X5SA 4UT4A 3FSXA 1XR7A 2RQ4A 1NXIA 3S01A 4U95A 1N33F 4U7UK 1M1GA 2OPQA 3AQPA 3D6MB 3TRGA 1UCNA 1WF1A 4CT9A 3X3UA 1NPRA 5AE1A 3ZZYA 6AT1B 3PO5A 3DNCA 1ZTWA 2WAQD 3W64A 4RW8B 1NB2A 2N7YA 2BXJA 1RLCL 4HDGA 4P2SA 5HVFA 3Q89A 1T9UA 1UEUA 5J2QA 1RAHB 3FKBA 4O3RA 2K3IA 3K59A 4FVCA 1N88A 2CDQA 4H4OB 1OPZA 4WJBA 3Q8SB 3TVYA 5I3UB 3H59A 3MM5A 4PKDB 4OX9F 2J9EA 3OL9A 2HFOA 1XMQJ 2V2VA 5D4PA 3TAPA 1R43A 3NGRA 4AYBD 4B3TF 2KZZA 2PI4A 3BGOP 4EEYA 1RAEB 4ED8A 2MLXA 5KG3A 4TNOA 2CQPA 3SQGB 1Q8KA 5KFHA 2RHQB 2VA3A 5CH7B 1SUQA 2WVDA 3FUYA 1HWUA 3A4TA 4Q43A 3NGDA 3NCQA 4K5SA 2ABYA 2WSEC 1U4BA 3C66A 2MZJA 4IUFA 2HNYA 4X62J 2ZH4A 3IFEA 2V67A 4Y2AA 5CCLA 1RT7B 3LANA 3MM7B 2ZZMA 1O8BA 1OQ6A 2MQOA 4DV4F 3EJMA 3G2XA 1MLAA 4ENOA 4DV3J 2Q6BA 1TL3A 1MROA 2LA6A 1U1PA 1T9YA 3OFFA 3DOKB 2FJWA 1JXEA 4CO0A 1HYSA 3CCTA 4K2JA 2XLKA 2VDIA 1D9FA 2IM2A 3NWGA 4DR1F 3KJVB 4U9RA 3DLKA 3QT6A 4H4KA 5B0DA 5DGBA 3CCUS 3MF5A 1NZ8A 1GTHA 2UZAA 3SDEA 4DUYF 4E8UA 2VOPA 3QGIA 5KT2A 3JSMB 5L1KA 2Q1LA 2DIVA 4R25A 2AGPA 1LWCA 4DMZA 5HQMA 4PYDA 2WRMA 4N77A 3W5YA 2G2ZA 1BQNB 1C0TA 2DNMA 4M8LA 4NL5A 2JLEA 4LBIA 4UOCA 4FBUA 3X1LB 1SKSA 4X4NA 1D09B 3KNGA 2UXDJ 4OLOA 4PAAA 2GHVC 1S1WB 5CYQA 1FK9B 2VG5A 4A8OA 4X4RA 4DR1J 1HYSB 1YX2A 2DHAA 3DDKA 3GJSB 3ILLA 4F04B 2HK3A 2UVRA 3AB2B 3ITHA 2YQ3A 1TL1B 1T9XA 1QAJA 2HMIB 2M9KA 2XULA 2YNHB 4USKA 2FJAB 1HLWA 3GIRA 2GQCA 2R7UA 2DNPA 4USIA 1ZAWA 5DDOC 2GO9A 2IDEA 1QTMA 4M5DA 2M0GB 3N6NA 3CD6S 2I2YA 3TOQA 3D7SB 2VQEF 4C8LA 2DGSA 4JI3F 1ACMB 2UV8A 2W8KA 1JLBB 3AY0A 3BDEA 4EU0A 1S1WA 2KO1A 2BE2A 2DNQA 3RW7A 2XM3A 2VBWA 4EK2A 3ZO7A 1ZAXA 2R3VA 2MKCA 4YR0A 1FWKA 3LWMA 2FQQB 2LECA 2EBGA 4L6V3 1DQAA 5KG6A 1FDDA 1WKLA 1JNRB 1VBXA 3L9ZA 2J6SA 4F4AA 2Y0SD 4C8ZA 4U67Q 1X4AA 5D6GA 2X1AA 1CJTA 4AL6A 3CC2S 3PYDA 5ETRA 2V2KA 4IH7A 2VJUA 1TVRB 1URRA 2CQDA 4DV2F 2D7SA 3FRZA 3QRPA 1RT6B 4ICLB 3GQCA 2BJ3A 5CQGA 2OLWA 3I96A 4EBDA 5B0EA 1O6XA 3T5JA 1KS2A 1IBMJ 4DSJA 4CP5A 4FYDA 2WB4A 4ALZA 2QTWA 2WBMA 3PACA 1L3TA 4OYPA 5HO4A 2DGTA 1S49A 3MR3A 1K0TA 4ITSA 3CDBA 4M63A 4EO6A 4ELUA 4DV1J 4KY3A 3HJFA 2RNEA 4IDKB 1FESA 2DJWA 3IR5B 1GMWA 1IR0A 3CD7A 4QOTA 4U96A 1DLOA 2JOQA 2JX2A 2VIHA 1Q8BA 1RT2A 3VAFA 5H9EK 1EKSA 2UVUA 1Y5NB 1QLNA 5I4MA 2LU2A 4WZMA 2X51A 4NRUA 1F60B 4OHZA 1GXLA 4JI1F 1UW9A 2DNOA 1RWOB 2YX7A 3L7OA 2XZWA 1KOHA 2BRKA 1M5HA 2HBRB 3M2UA 1RI7A 3OSPA 1L3VA 1NH8A 3M8PA 2XI2A 3PW2A 2VD3A 3AQOA 1JNZB 1OIAA 2WK4A 3ZZOA 3O2IA 3CD5A 3HLUA 2D3OR 1TKDA 4LFCJ 2CQCA 3MOJB 2WTFA 3ELHA 3OXFA 2FB0A 4OX8A 4DR4F 2PMZD 2YWEA 4NXMF 3K2YA 3SCLE 2IIHA 2C3PA 2FVPA 3SCIE 4UTGA 1XNRF 2W2OP 4GVLA 1KLMA 1SH0A 2Y3YA 1TKTA 3R5BA 2ZM6J 3KHRA 3CJRA 1I94J 2ZBRA 3QLHB 1UPPA 4CIOA 4WYLA 3A8KA 5IM0A 1YBUA 4DR7J 3D9BA 3OR2A 1JB0C 3W8GA 2ZOGA 1WC1A 3MM8A 8AT1B 4DV5F 1AB8A 1HBUB 1HBOB 1TV6A 3KDNA 4JV0A 3C3LA 2I5JB 2AJQA 2V69A 1AXQA 1Q8LA 2HVDA 3A3NB 1HQUB 3A8IA 5E3PA 1BD6A 1H73A 2CYYA 4KQZA 4O0IA 4LSLA 1HHQA 4JV1A 3W8PA 4NXMJ 1HL6A 5FLXY 2G0CA 3MM9B 4UF4A 1B99A 4K0KJ 1IR2A 2VBZA 2YKPA 2YNGA 3LAMA 2ZM6F 1F3FA 3ILJA 4K7QA 2BQUA 1PBUA 1SXLA 4LF6J 1R8AA 1TKTB 2GIQA 3W9IA 2DD8S 2GJ2A 5KFPA 4I6WA 1F1BB 3UR0A 3UNYA 4DV5J 3GU0A 4MT1A 1VOMA 3QGGA 1KD1T 2D3UA 1QAIA 4RW4A 2RSQA 2PEHA 3NG8A 4P2XA 1F9EB 3J7Z5 4F8RA 1YDLA 3LGNA 3PV8A 4TVAB 1CBKA 1YQHA 3MGJA 4DR6F 2QYCA 2R7OA 2W9CB 2HG4A 1IKWA 3D6FB 4GVBB 1VBZA 2B0GA 1B7FA 1UETA 2HWHA 2XEXA 3D0HE 2RU9A 3RB6A 3CMAS 1J27A 2G13A 1ZH5A 1XTZA 3HSZA 4LF6F 5HMXA 1EP4A 1TU0B 3PO4A 1H0HB 2AWZA 1FFSB 3K8VA 4DN9A 3CJKA 5IV4A 1S76D 3KUGA 1MU2B 4ZCKA 4RUBA 1LWFB 4C0OC 2D3O1 4QR0A 3D0IE 1AA1B 2RQCA 1U1KA 3GFHA 3UQSA 1S12A 1KP6A 3LA0A 1BUXA 3NGKA 3PHEA 4TLQA 3G82B 3MPYA 4J37A 3HCXA 2CQIA 4LF9J 1KTVA 2XHCA 3DU5A 4H4OA 1HNZJ 1UVJA 4CLTA 5HROB 1WOOA 4OV6A 3Q8UA 5KFFA 2MQPA 1FDAA 1LK7A 1XJWB 4F4KA 1EJ7L 2O5DA 4K4XA 4IRCA 3NY0A 1HHSA 2CNLB 2A2CA 1IKXA 1R31A 2BRLA 4KE5A 4LSZB 4MIAA 4ZVRB 3UD3P 3R1HA 3ZTSA 2F4VJ 4NX9A 2LDYA 3JTPA 4P52A 3SQOP 3MUVP 1C1BB 4CLFA 3PFOA 1LW0A 1MG7A 1M5SA 2O67A 4W90B 4E98A 2FJVA 1SUQB 4ED5A 4J91A 3NMRA 4B3OB 1TAUA 1S6QB 2HPUA 3FBCA 4TU8A 2DO0A 2VPYB 5B0CA 4ED7A 2W9BA 1HNXJ 3FZ2A 2COLA 2XS5A 4PQUA 1HNZF 4ATNA 5G0RA 1CJVA 2RS2A 2OEJA 3QT7A 1BQXA 4W4MA 4AL7A 2CPHA 5E2QA 2JC1A 3TJAA 3O44A 3UD5A 4A8FA 1YRUA 4DQQA 1MROB 1MMNA 3HSGA 4LRBA 5I42B 3BO4A 3MMAA 1HI0P 5HANA 2QLBB 1X31C 3OLBA 1YGYA 4WE1B 3G6ES 4GC7A 2AT1B 2QIFA 4AXIA 2XMMA 4LF7F 1C0UA 3K57A 2NQPA 3GG1A 4BLGA 2W4DA 3F44A 3G8SA 1TL7B 8ATCB 2VHGA 2KJVA 1FRKA 1GMVA 4Y2IA 4BWMA 2EFVA 2QLJB 3GIMA 1NZAA 3J81U 3GIKA 1IBKF 1AFIA 1KQSR 3J81Y 2ZDPA 4F0HA 2X1BA 4UQGA 2W9BB 2J0SD 3UPFA 2LA4A 4NYOA 1T94A 2C2NA 1JLAA 3ULHA 4FXWA 5C42B 3CSKA 2ZBIA 5KFGA 5AJ3J 5LMUF 4WTYA 3EZ5A 4KFBA 2IRUA 2VICA 2L9NA 1S5ZA 3OR1B 3HHLD 3VAHA 5C5JA 3MM5B 3W9JA 5FD1A 3UCZP 2VG5B 2M5YA 5IC6B 1SC4B 2V9KA 2P5VA 3CMQA 1X5TA 4ZVTB 3RB4A 5J1PA 4QU6A 3SEOA 3R7SB 2ZH2A 2AHOB 4RX6A 2KH9A 5IS2A 3POTA 1T0TV 1UAWA 2R7WA 4F02A 1WORA 2DY1A 1NDKA 2AKWB 4LFAJ 4ZPVR 3BH6B 3TA1A 1J5OA 2NXJA 4I56A 4FXDA 2AJ0A 3QGHA 3VQSA 2QSWA 4CM0A 2E1MC 1ZA1B 4Y65A 1T11A 2ZHOA 1SVDA 3DLEA 2DXFA 3JTOA 4DLGA 3NGUA 4ECTA 2QLWA 2QMWA 4IR9A 3TX0A 2UXBJ 4ECQA 2J6UA 1FF2A 4DZDA 1X5PA 5KG4A 4LREA 2HQCA 2LYVA 4KFBB 1JLGA 3PFEA 3HMJG 1BMQB 3PX6A 3KLGA 3AFGA 5L9NA 2HHSA 3EVMA 1FFWB 5B0FA 4KH1B 2JVRA 3M1VA 2AMCB 4DL3A 5IV3A 2MKYA 1IQTA 3JQKA 2KN4A 3MI7X 4CNZA 4CYUB 2QGFB 3EZUA 4NZ6A 5LT5A 3OHAA 3QSYB 5CA5A 3IA0A 4ANDA 1Y3JA 1B3TA 2XB2D 2DISA 3QZ7A 4NLVA 3VR1A 1UP1A 4ILLA 2F9JA 3MECA 2OH2A 4ERDA 1F2GA 3CT9A 1ZM3A 5C2GA 2RIJA 3CGIA 3DI6B 1RTDA 2AEMA 2E44A 1RBOB 1RBAA 2YPZA 4LBHA 2LEAA 1CPZA 3VGSA 2CG8A 4X4TA 1UMJA 1GQEA 4KKOA 4LF8J 4CLLA 2LXIA 2OFGX 3SMZA 1P1TA 3NBPB 3MWBA 1ULRA 1OSDA 1BXNA 1VC0A 4LRCA 1RT2B 1PJ6A 4ER8A 1SL0A 3TANA 3CJ0A 5H9FK 3PZPA 1HPZB 1S4FA 3BGLA 1N0VC 3ISNC 3R7NB 1HMVA 3HZEA 3D3BJ 4QIVA 3BBFA 3P5BP 1IBMF 4JV2A 1X4CA 5E41A 3T9ZA 3AA8A 2B4OA 5E5NA 4ZP7A 1F2HA 1XIQA 2PN6A 2YNFA 3ZZTA 4RZRA 2CQ0A 2IVFB 2MZ1A 1FJCA 2IMOA 4NLTA 2X1FA 4YEAA 2AJ2A 1RU2A 3JAMY 4IO1A 3EPGA 2EBEA 2JHEA 1JJ4A 1D8ZA 2M2BA 2WB1D 3R5AA 4EI2A 4ZKAA 1NRKA 4DQRA 4KKOB 1APSA 1Q95G 2G1HA 1FRJA 1UFLA 2XCAA 1WF2A 2ZJPQ 4TYAA 1RA6A 2GV1A 3G71S 4L76A 1ZZNA 5CXTA 4C11A 4X62F 2RHSB 1GAOA 3EVWA 2F40A 4F4XA 3IXQA 5KFRA 1RISA 2QA4S 3L4BC
chains in the Genus database with same CATH topology
1XMQJ 4KHPJ 2UU9J 5BR8J 4LFCJ 3J81U 4PWWA 3R2CJ 2UUBJ 5AJ3J 4GKJJ 4X62J 4JI1J 2MQ8A 2ZM6J 1I94J 4LFBJ 5LMNJ 1N36J 5LM7E 4DV0J 4DR7J 4DV3J 4DR5J 4LF7J 4B3TJ 2MTLA 3J7AN 4JI8J 4YHHJ 4B3RJ 4DR6J 4LFAJ 1IBKJ 2UXCJ 3W1YC 4NXMJ 2VQFJ 4JI2J 3J80U 1N34J 5IWAJ 2KVQE 5LMUJ 4JI4J 4K0KJ 4NEZA 3T1HJ 3JAMU 4DR2J 4JI6J 2UXBJ 4LF6J 4DV4J 4DR3J 4DV7J 2UXDJ 4GKKJ 4DV5J 2HHHJ 4RJVA 4B3MJ 4YY3J 4DR1J 1IBLJ 4NXNJ 1HR0J 5IT9U 4NEYA 4DUYJ 4JI0J 1XMOJ 1N32J 2UUCJ 4B3SJ 1XNQJ 4HHUA 1J5EJ 4X65J 4DV2J 4JYAJ 4X66J 1N33J 4LF8J 4AQYJ 4JI5J 1FJGJ 3T1YJ 4LF9J 1HNZJ 4KYZA 3D3CJ 3D3BJ 4X64J 4LF5J 3OTOJ 4OX9J 2VQEJ 4JI3J 2F4VJ 1IBMJ 4JI7J 2KL8A 4LF4J 3R2DJ 4DV6J 5FLXU 3IMQJ 4V1Ak 4KY3A 4DUZJ 4DV1J 1HNXJ 2UUAJ 4DR4J 2MEWA 2E5LJ 1HNWJ 1XNRJ 4JV5J 5A2QU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ J;  4KHP J;  2UU9 J;  5BR8 J;  4LFC J;  3J81 U;  4PWW A;  3R2C J;  2UUB J;  5AJ3 J;  4GKJ J;  4X62 J;  4JI1 J;  2MQ8 A;  2ZM6 J;  1I94 J;  4LFB J;  5LMN J;  1N36 J;  5LM7 E;  4DV0 J;  4DR7 J;  4DV3 J;  4DR5 J;  4LF7 J;  4B3T J;  2MTL A;  3J7A N;  4JI8 J;  4YHH J;  4B3R J;  4DR6 J;  4LFA J;  1IBK J;  2UXC J;  3W1Y C;  4NXM J;  2VQF J;  4JI2 J;  3J80 U;  1N34 J;  5IWA J;  2KVQ E;  5LMU J;  4JI4 J;  4K0K J;  4NEZ A;  3T1H J;  3JAM U;  4DR2 J;  4JI6 J;  2UXB J;  4LF6 J;  4DV4 J;  4DR3 J;  4DV7 J;  2UXD J;  4GKK J;  4DV5 J;  2HHH J;  4RJV A;  4B3M J;  4YY3 J;  4DR1 J;  1IBL J;  4NXN J;  1HR0 J;  5IT9 U;  4NEY A;  4DUY J;  4JI0 J;  1XMO J;  1N32 J;  2UUC J;  4B3S J;  1XNQ J;  4HHU A;  1J5E J;  4X65 J;  4DV2 J;  4JYA J;  4X66 J;  1N33 J;  4LF8 J;  4AQY J;  4JI5 J;  1FJG J;  3T1Y J;  4LF9 J;  1HNZ J;  4KYZ A;  3D3C J;  3D3B J;  4X64 J;  4LF5 J;  3OTO J;  4OX9 J;  2VQE J;  4JI3 J;  2F4V J;  1IBM J;  4JI7 J;  2KL8 A;  4LF4 J;  3R2D J;  4DV6 J;  5FLX U;  3IMQ J;  4V1A k;  4KY3 A;  4DUZ J;  4DV1 J;  1HNX J;  2UUA J;  4DR4 J;  2MEW A;  2E5L J;  1HNW J;  1XNR J;  4JV5 J;  5A2Q U; 
#chains in the Genus database with same CATH topology
 1J2V A;  5D78 A;  1MWY A;  3VTI A;  4PG8 A;  3RJM B;  3SXL A;  5GAH U;  1SJF A;  1NH7 A;  1P9Q C;  3D28 A;  2IBK A;  1HQU A;  3MHY A;  4WYW A;  4YB7 A;  4FN5 A;  2QFJ A;  1B0P A;  3C15 A;  2ZZN A;  4NCG A;  2CPZ A;  5KT5 A;  3QRR A;  1SJQ A;  2E5G A;  2KZM A;  5HVH A;  2VC0 A;  2VFT A;  2IA0 A;  3DMJ A;  1JLE A;  1QM9 A;  2DGX A;  2IFX A;  5CYM B;  1HNX F;  4G3I A;  5F8N A;  3H2V E;  2V6A A;  3W2W A;  5M2R A;  4OJH A;  1YZ6 A;  4F4Z A;  5KFX A;  3H25 A;  5H9F J;  1RAB B;  2BOP A;  1KC8 T;  1TUG B;  2FJD B;  3MMB A;  2VU5 A;  4M5J A;  2MQ8 A;  2GAG C;  5HBM B;  3N5B A;  2JZ5 A;  4FZV A;  1SJ4 P;  3KLF B;  3I5C A;  2DT9 A;  1G4C A;  2M3D A;  4ED1 A;  2KXF A;  3FEX B;  1E6Y B;  2OPP A;  3W9H A;  3KHG A;  1EKR A;  2CWX A;  2LXU A;  1PJ5 A;  2HQG A;  3MED B;  4E2F B;  5HSP A;  4KGV B;  2RML A;  3JQJ A;  5BXI A;  4B08 A;  2CJY B;  3I9V 9;  3M8P B;  3N0V A;  1CC8 A;  2QG9 B;  1SI9 A;  2GVD A;  4O3S A;  4ECZ A;  1N5S A;  1XK8 A;  3EXC X;  2R8K A;  2XYH B;  3HT3 A;  2XLI A;  2LEB A;  1VK8 A;  2KRB A;  4AUK A;  4FXV A;  4DX8 H;  2YH1 A;  2Y1I A;  1EP4 B;  2Z0G A;  4RLE A;  3NOC A;  3QT5 A;  3UVJ B;  1UEV A;  2KXH A;  4WU3 A;  4U8V A;  4LFB F;  1RAA B;  5BJR A;  4Y2K A;  1UA1 A;  3M30 A;  5HP1 A;  3FCW A;  4ZCI A;  1U02 A;  3FFI B;  1CS4 A;  4R0E A;  3OXL A;  3KLF A;  1R8C A;  3DM2 B;  4F3O A;  4UST A;  2MB0 B;  4IOC Q;  3UDL A;  3MEE A;  4PG7 A;  3NGT A;  4F2S A;  1NEE A;  1ZOT A;  4OI2 A;  4Q2M A;  1RT3 B;  3D4J A;  4C0B A;  1NJW A;  1TV6 B;  2CUY A;  4R5P A;  2AYB A;  4QYZ K;  1NME B;  2YPY A;  3HUL A;  3TI0 A;  1AZS A;  2YKM A;  3F41 A;  3G82 A;  3MUT P;  4K5R A;  1UVN A;  2HHT A;  8RUC A;  4MKA A;  4B9T A;  3KKF A;  4JUZ A;  2V2Q A;  2MPU A;  4A47 A;  4EYI B;  3H40 A;  1SL1 A;  2RB7 A;  1RCX B;  4F2R A;  1AUS L;  2CDR B;  2M52 A;  3C46 A;  3A13 A;  1U7L A;  2DHX A;  2VG6 A;  4NLU A;  3CCM S;  1I5O B;  1JIH A;  3IM8 A;  5HL7 Q;  1Q5V A;  2AV5 A;  2HYI B;  1U24 A;  1LKZ A;  4DV2 J;  3PNI A;  1UPM B;  4K8R A;  1LV5 A;  2D69 A;  2HEK A;  5J1E A;  5EGY A;  1C1B A;  3QIP A;  2XWY A;  3FFI A;  4V19 J;  1JLQ A;  4J9N A;  2OAU A;  2NUH A;  3CW2 C;  3FZB A;  3OSN A;  1WNE A;  3JYT B;  2KTQ A;  3AXM A;  3CD0 A;  4DCO B;  2GMH A;  2EVZ A;  1UJ4 A;  3VVU A;  2IM3 A;  1UWB A;  1Q0N A;  1U1M A;  3DRS B;  2YQ1 A;  5HJX A;  4WP3 A;  3HDS A;  4XK8 C;  5IT9 Y;  2MDA A;  2HND A;  1YI2 S;  1XQI A;  2HFU A;  2VG6 B;  4PG4 A;  2GAH C;  1IVZ A;  2O3D A;  3CC7 S;  1Z2L A;  3T6B A;  5JMN A;  2IJF A;  5GAE U;  2LKZ A;  4MFB B;  4URS A;  2BDP A;  1REG X;  5KG1 A;  4ZPA A;  2QC3 A;  3CO9 A;  1ZM9 A;  4JI5 F;  3BO2 A;  3O1L A;  1LWF A;  2QA2 A;  4NA2 A;  5DQI A;  5J2M B;  4NYP A;  3MR7 A;  3T1Y F;  1DJ0 A;  1Q53 A;  2JC0 A;  4PXD A;  1SB6 A;  4QIE A;  4OI4 A;  5A8R A;  4ECS A;  4MH8 A;  2ZFH A;  3SIP B;  3RUB L;  5C7P A;  4V19 X;  2LMI A;  3BGF A;  4IG0 B;  3I55 S;  1AW0 A;  2HVI A;  4QPT A;  2CXE A;  3DHX A;  5KG0 A;  4ECU A;  2G2O A;  2XNQ A;  4OL8 A;  4JV5 J;  3EYZ A;  4A8W A;  2W2M P;  3E01 B;  4DR7 F;  1FX2 A;  1ZBT A;  1RWK B;  1YKW A;  5F0U A;  2N82 B;  4HYK A;  1T9W A;  3BSO A;  3GR0 A;  1X0F A;  1W2I A;  4LQ9 A;  1KSP A;  2J7K A;  2A6O A;  2DGW A;  5KFM A;  1BWE A;  2KYX A;  5EUH A;  1RTI A;  2LEP A;  1RTJ B;  2BUN A;  1VHI A;  2HIY A;  3R2C J;  1KLN A;  2R42 A;  3BN7 A;  4KH0 B;  4NLP A;  5DS7 A;  3PG9 A;  4MKV A;  4MYU A;  2OFH X;  4ZP6 A;  5KFL A;  4DPT A;  4ZDN A;  5LOQ A;  2Q79 A;  2C3U A;  4EZ6 A;  4G1Q A;  2AJF E;  3IRX A;  2HHP A;  2NZ4 A;  5LMN J;  1N36 J;  2DXD A;  5LM7 E;  3G6X A;  3T3F A;  4OYM A;  1EZZ B;  2G9O A;  4IFV A;  4KO0 B;  3VCD A;  4Z2X A;  3GON A;  3SYZ A;  2PI5 A;  3E01 A;  4J90 A;  4DBQ A;  2JFD A;  1HQE A;  4DOZ A;  3Q23 A;  2EK6 A;  2RDI A;  1S79 A;  4FYX B;  2XNR A;  4DHV A;  2BJ1 A;  3ITH B;  3M6W A;  4NXN F;  3PKY A;  1UVI A;  4M5I A;  1VGY A;  3EM1 A;  2A18 A;  2DNL A;  2CIM A;  3A8E A;  5GVQ A;  2UXC J;  4TYB A;  2VBX A;  3VWS A;  1M0S A;  4PZV A;  2OEK A;  1FTR A;  2B8Q A;  4KV8 A;  4LRA A;  3ZZZ A;  1YTY A;  2IHR 1;  1LXN A;  3CJQ A;  2RQK A;  4O44 A;  4P75 A;  4U7C A;  2V9W A;  2CVE A;  5BYR A;  3CF5 Q;  1QSS A;  2QZ8 A;  1RWX B;  4ED6 A;  2DNR A;  4RJV A;  2QLF B;  3SSQ A;  1M5P C;  2VG7 B;  2MY7 A;  2CJK A;  4IOB A;  1QVF R;  3N79 A;  2M88 A;  2WHO A;  3D1Q A;  1NJY A;  1JJC B;  4M5M A;  1I51 B;  3R9L A;  2NR0 A;  4Y6I A;  9ATC B;  1Q5Y A;  2CRL A;  5KG5 A;  4W98 A;  5T7L A;  3G87 A;  5C2C A;  3FCH A;  4CRJ A;  3CVK A;  2V4J B;  3O8W A;  2B4V A;  1TVR A;  3DGV A;  2DHG A;  2W2P P;  3MMC A;  2R8H A;  2A2D A;  3MAQ A;  2ACM A;  4HVZ A;  4OZN A;  2B56 A;  2GJI A;  4KV8 B;  1RBL A;  3KLI B;  3NOG A;  1RU1 A;  5ETL A;  3BKF A;  4OI6 A;  2HHQ A;  3MCO A;  1FRL A;  2VH7 A;  3EDQ B;  1SKR A;  4ECY A;  4YP3 A;  1RAF B;  1NND A;  3DGP B;  4A46 A;  1KVI A;  2XI3 A;  4ED4 A;  3BS9 A;  3KUE A;  1FJG J;  2IC3 A;  1YJ7 A;  1DLO B;  5CD4 H;  1S72 S;  1VQK S;  4J9Q A;  1DAR A;  2PII A;  3ISZ A;  1D0E A;  2KVI A;  3E51 A;  5K14 B;  4CLK A;  1S9G B;  4L3K A;  3PRD A;  5KFV A;  2XZT B;  4QIF A;  3J7Y I;  4DPW A;  2XS7 A;  3D3C J;  3MPU B;  1ARO P;  2D9P A;  3D0G E;  4J9M A;  2KHD A;  4DL7 A;  1I6J A;  2V4J A;  2WBR A;  1Y9O A;  3CDU A;  4Y2M A;  1T02 A;  3UO0 A;  1OY9 A;  2VQE J;  4JI3 J;  3IBW A;  5KFI A;  1FRM A;  1SJ3 P;  5IQ6 A;  2EFO A;  2HNZ A;  4ZVS B;  1H2V Z;  4PWU A;  4P74 A;  2B5J B;  4KC5 A;  1K1S A;  3FBF A;  3GLJ A;  5IFM A;  1FFG B;  2BX6 A;  1R6V A;  3MUM P;  3OD2 A;  3I9Z A;  3NBP A;  3CO0 P;  4Z7C A;  5ETM A;  1RLD A;  5IQQ A;  3T6J A;  1RKJ A;  2DPJ A;  5IZH A;  3UCU P;  3HFZ B;  2BJD A;  2BKO A;  1SIW B;  1HAR A;  4QYZ J;  2CKW A;  4OZ1 A;  4YR2 A;  1S1U B;  1F9F A;  2MQN A;  5D0R A;  3GYX B;  3UNG C;  4DPU A;  3J7Y U;  1NJI T;  2DEI A;  1PYO B;  1NKE A;  1S0V A;  3QJJ A;  1LWX A;  1SQF A;  3D6T B;  2I5J A;  4XAK A;  4O3O A;  1FJE B;  3T5L A;  2D74 B;  4KGZ B;  1TP7 A;  4EYH B;  2XBP A;  1S97 A;  3H4D A;  2J7U A;  1A0O B;  2GVD B;  3DYA B;  3I4H X;  3FQL A;  4DQP A;  3TUP A;  5LSO A;  4NAS A;  1FXR A;  3DLG B;  1DRZ A;  4LFA F;  1UW4 A;  2BJ7 A;  3P96 A;  4P71 A;  1Q78 A;  1JWW A;  1CG2 A;  2CPJ A;  4BWJ A;  1SBR A;  3S7R A;  1OY6 A;  1QE1 B;  5IT0 A;  2RAQ A;  3B54 A;  1TMM A;  2QEX S;  3C6T B;  5K5M A;  2R8I A;  4IYQ A;  2V34 A;  4I68 A;  1TKZ A;  2CA9 A;  1FXD A;  1NLK L;  2MZR A;  3DFE A;  3M32 B;  2H54 B;  4RW9 A;  2PE8 A;  4PWD B;  2CZ9 A;  3M1V B;  2LXF A;  3M8R A;  2VJV A;  2IAJ A;  3M2U B;  1NK4 A;  2I9S A;  2UVW A;  4NLG A;  1I1G A;  5E33 A;  1VRU A;  3AH6 A;  4WKY A;  2CQ3 A;  5LJ3 Y;  1HNI A;  3Q24 A;  1CLF A;  4PG5 A;  2XMW A;  2FIU A;  3MPW A;  3H42 A;  1REV A;  4M1K A;  1IWG A;  4BBY A;  3IO1 A;  1SCJ B;  2UUB F;  4L3N A;  1O51 A;  2FHJ D;  1SKU B;  2GVZ A;  3OHB A;  2X3D A;  2ASL A;  1RJJ A;  2EI5 A;  3BDP A;  3D1H A;  3FK4 A;  3BSC A;  5DLG A;  3DRX A;  1V3S A;  3R5J B;  1KN6 A;  2KRR A;  1MN7 A;  2IJR A;  4NZ0 A;  4ZVQ B;  4I2Q B;  2W1B A;  3F73 A;  1FD8 A;  4B3M J;  3SV4 A;  2XSJ B;  3Q2T C;  1N0U A;  4HHJ A;  1T05 B;  1IKY A;  4HR2 A;  2HUR A;  5A0Y B;  5KFT A;  2HHW A;  3GB0 A;  1DTT A;  3J81 j;  1RCO B;  3JSB A;  3UR3 C;  3PRV A;  1FA0 A;  2W4C A;  3HHL C;  3FMW A;  4FNI A;  3UWT A;  1HNI B;  4ZLL A;  2MLY A;  1R0A B;  3GCW P;  1DAX A;  1VMB A;  4OHW A;  4OLP A;  5LL6 d;  3PJ9 A;  4UQT A;  1Z4U A;  4HHU A;  4PEO A;  3WIV A;  2ERR A;  1TUV A;  3RGI A;  5AXL A;  1IQZ A;  1RXO B;  4RNM A;  1AYE A;  2OP5 A;  4I6Y A;  3OTO F;  1N33 J;  3LOU A;  4P10 A;  5HP1 B;  1LW0 B;  1S1T B;  4CCH A;  4B3M F;  3AOA A;  4JBC A;  3G8T A;  3MR2 A;  4H4K C;  4ID5 B;  2G0J A;  3MM6 A;  2CG4 A;  3K5O A;  3DC2 A;  3UE2 A;  2H5E A;  5E3C A;  2V50 A;  3RR8 A;  5IOL A;  4OX7 A;  3VAJ A;  4JI0 F;  2OHD A;  3DOM A;  1U45 A;  2A6M A;  4ZS6 A;  2XMV A;  2JLG A;  3VGT A;  4B3S F;  2AZ1 A;  2WON B;  2YKN A;  2KM8 C;  2DKO B;  4ZIW A;  1A9N B;  1FKP B;  3FBB A;  3RZA A;  5HQ8 A;  1X4D A;  1SV5 A;  4I4B A;  4KBI A;  4JB8 B;  3VAL A;  3M4X A;  4B9V A;  1NDC A;  3KK2 A;  1CQM A;  4OX9 J;  3M8Z A;  4C8N A;  1RYR A;  2Z58 B;  2VPX B;  3FCV A;  4HTI A;  2MKK A;  3BO3 A;  2KL8 A;  1GTE A;  3VGV A;  4NLW A;  2E9R X;  3M8W A;  3U27 A;  3JB9 k;  4C8Y A;  1U2F A;  2DGO A;  4FBT A;  3WIU A;  1P9Y A;  1Y4Z B;  2MGZ A;  2E1A A;  2R7S A;  3HX9 A;  1OO0 B;  1U48 A;  3IC1 A;  5D77 A;  2UUA J;  4DR4 J;  1JLF B;  4QJV A;  3T41 A;  3PIP Q;  3W7B A;  2ZHB A;  4I6A A;  4HT7 A;  2CZV C;  3PDN A;  1XER A;  1S1X B;  3NEK A;  2CQG A;  4DL5 A;  1NK7 A;  4N56 A;  5LMN F;  3R1L A;  1N36 F;  2LQ9 A;  3WC2 A;  3AOC A;  4FNH A;  5KOW A;  4QWA A;  4DR5 F;  1H98 A;  1WI6 A;  1U2C A;  3D1O A;  2F5G A;  1NPK A;  3QFW A;  1RB0 A;  3R6G B;  1XWL A;  3R8Y A;  4JP8 A;  3U1N A;  4LQ3 A;  1R3N A;  2BOA A;  5L39 A;  4FF4 A;  2U2F A;  1OMS A;  1T9V A;  4NLQ A;  3EE3 A;  1SQG A;  4RW8 A;  3GJT B;  2OD6 A;  2R2R A;  3QBC A;  1F3V A;  3EZO A;  1Z2Z A;  2MKJ A;  2KXN B;  4E0D A;  5LXR A;  4DFK A;  1Q7Y T;  5J2Q B;  4I69 A;  3BF4 A;  1N34 F;  2DH8 A;  5A8R B;  4OHY A;  4K0K F;  4P7T A;  4D3H A;  5G0R B;  4F0K A;  3P6Y C;  2ZUA A;  2HS3 A;  1S10 A;  2B6A A;  1NUE A;  2E29 A;  4LRF A;  3JTN A;  1DQ8 A;  2DCL A;  2GIF A;  2OTL S;  2J9C A;  5DDQ C;  2MSS A;  2FZC B;  5KFA A;  4CO5 A;  2ZDO A;  1PYS B;  1WOP A;  2FHJ A;  3MFH A;  1EQ0 A;  3CJ5 A;  3J7A N;  2WSF C;  2HVH A;  3PYG A;  3LP0 A;  2DHH A;  5K8N A;  2EWH A;  4YHH J;  3MOZ A;  1GXU A;  5T7L B;  2OPS B;  2YNH A;  1VIO A;  3CIM A;  4CYU A;  4ILM A;  3W1Y C;  4TY8 A;  1VQS A;  2ALZ A;  2OEM A;  3J80 U;  2MHN A;  1X0P A;  3KLH A;  1Z1Z A;  4BS2 A;  1WG1 A;  1R0C B;  4RWW A;  4CLY A;  4WKR A;  2P2C B;  2JJ4 D;  3I5B A;  3P49 B;  2EFN A;  2V94 A;  2XY6 A;  3W3S A;  3PW0 A;  3UN2 A;  3GV5 B;  1NK8 A;  2HFN A;  4WCE Q;  3R6L B;  4J9K A;  1HFE L;  3PM9 A;  3MAA A;  4WFN Q;  4IFV B;  2QV6 A;  4KO0 A;  3CUN A;  2HHX A;  2MZS A;  1H6K X;  3K5M A;  4ECV A;  1FX4 A;  4B9S A;  4I2P B;  3KDO A;  1ZTT A;  2QA1 A;  4TKT A;  4N8O A;  4DF4 A;  3KK1 B;  4LMZ A;  1W26 A;  4IO9 Q;  4DWI A;  3SZ2 A;  2WOM B;  3LPE A;  1BLU A;  2H48 B;  2HIQ A;  2RUS A;  5GAG U;  1VQ9 S;  4PQA A;  2RIL A;  4OFZ A;  4TY8 B;  2CPD A;  3RU0 A;  1U6Z A;  3UI3 A;  1U6F A;  2FLO A;  2BAN A;  4JI6 F;  4RBV A;  3G96 A;  5D8H B;  1C0T B;  1HIY A;  1YLX A;  5DRK A;  2HNZ B;  5KFW A;  1WDT A;  3T5H A;  5KFK A;  1XBW A;  2OIH A;  1SC6 A;  2PC6 A;  1FWL A;  3VHQ A;  2DH7 A;  2I0X A;  3Q83 A;  5GMD A;  1FI4 A;  4WFB Q;  3V6D B;  3M9M B;  5AT1 B;  5GMK a;  3U02 A;  1NB7 A;  4JI5 J;  4Q7A A;  2F9D A;  1UZH A;  5GAH I;  4TY9 A;  3GFX A;  2O01 C;  3M6U A;  4C8O A;  2UV8 G;  4C11 B;  2CJQ A;  4DS4 A;  3CCR S;  1GXT A;  1XNQ F;  4KT0 C;  3OJU A;  1VS3 A;  4YFU A;  4EFA C;  1HNW F;  2SXL A;  4X64 J;  1ZM2 A;  3IWL A;  4K4W A;  2ZH7 A;  4JV5 F;  2EPI A;  4LVO P;  4DG1 B;  3E8O A;  1QSL A;  1TKX B;  2EKN A;  3QFH A;  5D15 A;  3W5X A;  3OTO J;  4K4T A;  4USW A;  1AUD A;  3RR7 A;  2W24 A;  4C8M A;  1VJW A;  4IQX A;  3U7J A;  1G6B A;  1RHR B;  2ZKU A;  3DI6 A;  3I0S B;  4YB5 A;  2ATL A;  3QAT A;  1RTD B;  4M94 A;  1R6Y A;  3R2D J;  3A8J A;  3BBC A;  4TQS A;  2E1R A;  2V8G A;  4KGM A;  2CPF A;  4ZP8 A;  1N5Y A;  3DLL Q;  2A1B A;  3I32 A;  3W5Z A;  4OI0 A;  2E9T A;  4JOU A;  5EN1 A;  2J0W A;  2ZIT A;  1KRP A;  1U1Q A;  2QL5 B;  1V5V A;  2VFV A;  2HW3 A;  4YQW A;  2B9X A;  4GKJ F;  1TKZ B;  2BAC A;  3P3D A;  5DZ6 A;  5IM0 B;  1KNZ A;  3KFW X;  3I31 A;  3KJQ B;  4J9S A;  4H4M A;  1FKA F;  3PYE A;  4A8X A;  4IFY B;  2AZ3 A;  1HBU A;  1HBO A;  3VV2 B;  4Z37 A;  3OL6 A;  1FKO B;  2YNF B;  3I5A A;  1YIJ S;  4NZ7 A;  4R8U A;  1CQN A;  2QE5 A;  1VRT A;  3MPD A;  1Y10 A;  1UJ6 A;  4CZC A;  5BR8 J;  2YWH A;  2L9D A;  4MJK A;  4QR1 A;  1Q1K A;  3PX4 A;  5K20 B;  4FPI A;  4G1P A;  1O5J A;  2ALY B;  1Y11 A;  2IRY A;  3US5 A;  4F0M A;  5KTQ A;  3HSJ A;  4ED2 A;  2UUW A;  3JQM A;  1ZYQ A;  1K9M T;  4QCL A;  3HI9 A;  3SCJ E;  4BC7 A;  4FF2 A;  3QJP A;  2Q6C A;  3T19 A;  2RRB A;  3QAE A;  5F41 A;  2C1E B;  1CS4 B;  1YG0 A;  3QJL A;  1M1H A;  3PTW A;  2BBE A;  1HWL A;  2RT3 A;  2VOO A;  2GFF A;  1P27 B;  5DET A;  5MAO A;  1U1O A;  4DSI A;  1WC6 A;  2MY8 A;  1FCA A;  2RD5 C;  3BM7 A;  4ECX A;  3C14 B;  3QID A;  3WBZ A;  2ZH9 A;  3W63 A;  3PIO Q;  1AZS B;  2YKM B;  3UN3 A;  1SJ1 A;  4FS1 A;  2R7Q A;  5C24 B;  3BR9 A;  1IKW B;  2E5J A;  4GVB A;  2PDA A;  3PR5 B;  2AJ1 A;  2JH3 A;  1Y3K A;  4KB7 A;  1HBN A;  3OXG A;  1XMO F;  4CQ1 A;  3CXC R;  4YUD A;  1U1N A;  2POK A;  2VFS A;  1KQK A;  2HFZ A;  2B9W A;  1W2B R;  1N34 J;  4UOG A;  5ETN A;  4ZVO B;  4AFF A;  2DYA A;  1T9T A;  1N52 B;  1WHW A;  2CVI A;  2DR6 A;  3ONQ A;  3P8B B;  2QT7 A;  2ZKT A;  4M5L A;  3BGR A;  3JAM U;  4DV0 F;  1MU2 A;  2W9A A;  2QL7 B;  4MKB A;  2HGM A;  3BBB A;  4O4G B;  1RAC B;  3MM6 B;  2H5I B;  2Q3P A;  4ID5 A;  3MCS A;  4QIG A;  3OR2 B;  4UW2 A;  2HHH J;  1FDN A;  1KTQ A;  9RUB A;  2VZ9 A;  1HD1 A;  4GO5 X;  5A8K B;  4DFP A;  4ECR A;  1IBL J;  3D66 A;  1VQ4 S;  4LF8 F;  2HWT A;  5K8M A;  2KFY A;  4GC6 A;  2HKE A;  2BKP A;  3BKT A;  5H9E J;  1VRU B;  1EAR A;  2QA4 G;  3AJD A;  1WSR A;  2WCX A;  1WJ9 A;  3Q8V A;  4KGX B;  6FDR A;  1BGX T;  2NXC A;  2AYG A;  1VRQ C;  4B3S J;  1UZD A;  4LF9 F;  3K5L A;  4ELV A;  2GHP A;  5ETT A;  1MSW D;  1BE4 A;  3H0P A;  3KK2 B;  1C1C A;  1IKX B;  2QX0 A;  2E7X A;  3CNQ P;  3FQK A;  3EMT A;  1N6Q B;  5IT9 U;  1DY3 A;  1R8B A;  7FD1 A;  3UDC A;  4JI7 F;  1TQL A;  1JXV A;  1V5I B;  2YKA A;  5LSR A;  4B3O A;  4I2Q A;  3CE8 A;  1RHQ B;  2BJE A;  3UW1 A;  2MJU A;  2X3G A;  2Z57 B;  3DXB A;  3TEH B;  2DNK A;  2FYX A;  3B6B A;  3NKY A;  4P2F A;  2GQQ A;  2XMU A;  3CJ2 A;  1H38 A;  3T1A A;  1M5V C;  2JEJ A;  3RBD A;  1ZZF A;  3A3P B;  1FHT A;  4ZHR B;  2VC1 A;  4L72 B;  3D6H B;  1SJR A;  1J5E F;  1JLC B;  2RU3 A;  2ASD A;  4C4W A;  3HHE A;  4J9R A;  2HFS A;  3BQ1 A;  2JWN A;  1L5U A;  4O3N A;  3AHP A;  2WSC C;  2RQM A;  4JI7 J;  4ZPW R;  1BHN A;  2J8A A;  1TL7 A;  3LF0 A;  5J1N A;  3Q8Q B;  3CJK B;  5JVG Q;  2CJA A;  5L1L A;  1FE4 A;  1PKU A;  4KJI A;  2HHU A;  1YRX A;  3B8H A;  3GTY X;  4ZVF A;  3MMJ A;  3RBX A;  4Q0B B;  2DNZ A;  5KFQ A;  3DLH A;  4HAC A;  1ITP A;  1Q86 T;  1T95 A;  1YRT A;  2ZEJ A;  3TUI C;  1H2T Z;  2B51 A;  4Q45 A;  4KRW A;  1HNW J;  2A3J A;  1FER A;  2RF2 A;  3N5F A;  3LH2 S;  3SSS A;  4EUV A;  4XO0 A;  4IOA Q;  4ZHR A;  2HND B;  1B4S A;  4X4Q A;  3KYL A;  4NRT A;  4DQI A;  2HQF A;  1F5C A;  3CME S;  1SV5 B;  4DI6 A;  2R2S A;  3RRG A;  1HKA A;  3TZY A;  4K4Z A;  4Q2L A;  2ZJQ Q;  3WDO A;  3GYG A;  1LWE A;  4ZPB A;  3KJV A;  4A8K A;  2KFZ A;  1AFJ A;  1BY9 A;  2OPS A;  3IAS 9;  4ZPT R;  3LW5 C;  3G86 A;  3THP A;  2ZC3 A;  2CQ2 A;  3TYT A;  2AGO A;  4EGL A;  2IA6 A;  1RHK B;  2DGU A;  1N8R T;  2L9W A;  2MST A;  4NML A;  5J2M A;  1B0V A;  3T5K A;  3BRE A;  4HAC B;  3TZW A;  2C3Y A;  2C2R A;  2FUG 9;  2DR5 A;  4RUC A;  4U7U D;  4RNF A;  3NGS A;  3Q8Y A;  4RW7 A;  1FNM A;  5FII A;  4ZN1 A;  3C2P A;  4YB1 P;  1S6P A;  2MMY A;  5DLF A;  5A2Q U;  5I3U A;  3TO8 A;  4GO7 X;  4FF3 A;  4J5O A;  4FDF A;  4RUA A;  4YME A;  5I42 A;  3L7U A;  5GAD U;  1KWM A;  4NI2 B;  3L95 X;  3W61 A;  1GEH A;  3NAI A;  4RU2 A;  3VZH A;  4NLO A;  4F36 A;  1NK0 A;  3MEK A;  4MK8 A;  4RBT A;  3KTQ A;  3W2V B;  3B4M A;  1YJV A;  4I7F A;  4ZVP B;  2ZH1 A;  3PW4 A;  3PHT A;  3OTD A;  2I38 A;  2ZWO A;  4DX5 A;  2KT5 A;  1F5B A;  3K8W A;  4USM A;  2GW8 A;  1HNV B;  3TVZ A;  1RTJ A;  1NAQ A;  2EW9 A;  1F0X A;  2VFU A;  2KVQ E;  2MKS A;  3LP1 A;  1F6T A;  4C2M A;  4X2B A;  2B9Y A;  1N54 B;  4OX6 A;  2H3E B;  3OTC A;  1RAD B;  2J9D E;  4NOH A;  1RE1 B;  4RW7 B;  4DV7 J;  1SQE A;  1S6U A;  2OI2 A;  1JLB A;  1NDL A;  2PT0 A;  2C2K B;  1KQG B;  4YB6 A;  3TUJ C;  3MXH P;  2ZNZ A;  2HRU A;  2JDJ A;  2MZQ A;  3BPD A;  3HZG A;  2L08 A;  3JS9 A;  4DSE A;  3G8Q A;  1SPB P;  5FDL A;  1ZAV A;  5DG9 A;  4NXN J;  4B3R F;  4M5G A;  1S9G A;  3W2V A;  4TLR A;  1VLO A;  1YK9 A;  3NRB A;  2UUC J;  1J5O B;  2VB6 A;  2CPY A;  4OYB A;  4RBU A;  3THT A;  3DLB A;  3HVT A;  3V6H A;  2JEG A;  1XNQ J;  7AT1 B;  1X4F A;  3JSM A;  2KJW A;  1IUJ A;  3GIJ A;  4DG1 A;  1S77 D;  2Y1L B;  5CZV A;  1EX8 A;  4LF5 F;  3S6E A;  2EKY A;  3M9N B;  3BQ2 A;  1X5O A;  4A8M P;  3G6Y A;  3TAM B;  5D0G A;  2VAS A;  1K8A T;  2FZK B;  1HQ2 A;  2RKI B;  4KSE B;  1YJR A;  4RNO A;  1WEY A;  4YS2 A;  3GJQ B;  3L7P A;  1RQ0 A;  5CYQ B;  2AEF A;  3NP5 A;  3FBE A;  2EG2 A;  2FC8 A;  4K4S A;  4UOH A;  1VIX A;  5EDW A;  1HR0 F;  2VG7 A;  1IXK A;  3LPY A;  3WZ0 A;  5T14 A;  3G4S S;  1IBC B;  1WUU A;  1VQ7 S;  4ZJL A;  2M8D B;  3CCS S;  3PY8 A;  1XR5 A;  2NYH A;  2RJZ A;  3KK1 A;  5F8L A;  3HXM A;  4XIU A;  3P5T L;  2WOM A;  5HAT A;  1S1U A;  3HVT B;  4G6V B;  3ZZR A;  5JVH Q;  2YWG A;  4A8Q A;  4K4U A;  3PRB A;  1HBM B;  4NLR A;  1GFW B;  4FYV B;  4AXJ A;  3MFI A;  4PRF A;  3RBZ A;  2V4Q A;  3MEC B;  4DEZ A;  4CO3 A;  1X7V A;  3O3L A;  4R8U B;  5KG7 A;  1XMQ F;  2D3Z A;  4KHP F;  4DS5 A;  1RT4 B;  2FC9 A;  4C7Q A;  4J9O A;  4WII A;  1V3R A;  5G4D A;  5KFZ A;  4A8Y A;  2F8H A;  2R7X A;  2DHS A;  1GMW D;  1WI8 A;  5FLX U;  4DU8 A;  2AX1 A;  5CZX A;  5DG7 A;  3W2W B;  3THV A;  2E1P A;  4DZ6 A;  2F63 A;  1RT5 B;  3B4D A;  3I82 A;  1UFK A;  5K14 A;  3VQT A;  3ZTP A;  4M95 A;  3I0R B;  4EO8 A;  2DIU A;  1ZPV A;  1U0H B;  1CJU B;  2R2U A;  1DTQ B;  5KFB A;  3HJV A;  5C25 A;  4X4V A;  4RW9 B;  1PC5 A;  2LU1 A;  1XN9 A;  3B78 A;  3CCQ S;  2F4V F;  4IH6 A;  4NA1 A;  4KHP J;  2RVJ A;  1V9O A;  3BQ0 A;  3TVK A;  1LQ9 A;  4CLZ A;  1JX4 A;  1Q82 T;  2J7W A;  2RH3 A;  2HGN A;  2KKH A;  3QYY A;  3VZI A;  2CQH A;  2PFD A;  2YWK A;  2FVQ A;  3GV8 B;  1NK5 A;  2ROP A;  3R27 A;  1RAO A;  4DX7 A;  4CDI A;  3BEG B;  5F8I A;  2FY1 A;  2GNK A;  1RWM B;  3W60 A;  1B70 B;  2MHE A;  4KR0 B;  4LR9 A;  1IN0 A;  4C6A A;  3GV7 B;  2ASY A;  4X84 A;  3NS7 B;  1S6O A;  3AAW B;  4YDX A;  3QGP A;  4ANE A;  4C98 A;  1FE0 A;  1LFP A;  2FLN A;  2YH0 A;  1U26 A;  3EDR B;  2G0I A;  3IG1 A;  2Q66 A;  2HVE A;  1H72 C;  5C25 B;  1IWA A;  3HO1 A;  4XPC A;  3DOL B;  1S48 A;  3SFU A;  3CCL S;  3PKM A;  1BC6 A;  1DBD A;  1VQL S;  1DTT B;  2HVZ A;  5JXS A;  3P45 B;  4IRK A;  2ZH8 A;  2NZC A;  3PJW A;  2ZBQ A;  1M5O C;  2DRA A;  4ZIT A;  3NNC A;  5KFE A;  1VRT B;  2CNO B;  5DZ7 A;  5ITH A;  1D1U A;  3TQE A;  3WHI A;  4O0N A;  2HQ3 A;  1UJ5 A;  1YBT A;  5B09 A;  2FDN A;  1NBE B;  1RAI B;  1WDD A;  2AW0 A;  3QPI A;  2ZUG A;  3BH7 B;  1C1C B;  3GFZ A;  3K17 A;  3T1H J;  1QE1 A;  4OYI A;  3V4M A;  4DX6 A;  5J2P B;  3KJF B;  1NU4 A;  4DR3 J;  4IKA A;  3AJ1 A;  4F7V A;  4PYA A;  1JLQ B;  2NSB A;  1T03 A;  2LQB A;  2BMB A;  3M8S A;  5GAD I;  2Z4P A;  3GMG A;  4M5N A;  1WC4 A;  1L3S A;  3DOL A;  3K89 A;  4NMX A;  2HBZ B;  3VAK A;  1FRI A;  2NXN A;  5L9X A;  1R89 A;  5E3A A;  3ADA C;  3QT8 A;  2AQ4 A;  3C19 A;  1WOS A;  5SZT A;  2DRB A;  1Y00 A;  3DU6 A;  4KAI A;  4NLY A;  5AXK A;  3D67 A;  3TJ9 A;  1FEH A;  1QJH A;  4ZIV A;  2GJF A;  1JK9 B;  1HBN B;  1OYE A;  3CJ3 A;  1S4E A;  3GR1 A;  4BHQ A;  1UVM A;  1KKH A;  1TL4 A;  4RNH A;  2P9G A;  4DCP B;  3NS6 A;  2NSC A;  3DRY A;  5F8H A;  3IWX A;  3OFG A;  1WEZ A;  4PPZ A;  5EWG A;  2ZE2 A;  4MFB A;  5DDP C;  5J2P A;  2G4B A;  1RWN B;  4GKK F;  3CTR A;  3HFV A;  3HD1 A;  4WFX A;  2C2E A;  2BV3 A;  2GX8 A;  3ENQ A;  4LJM A;  4OMF G;  2UUT A;  3NXZ A;  1JKH A;  2E5I A;  4RPF A;  1V3Z A;  5D4L A;  5KFS A;  3EPI A;  4WWS A;  4DV6 F;  3M6V A;  3N9U C;  5EHH A;  1WSV A;  2QRR A;  4DPX A;  3ZNU A;  3TZZ A;  1FRX A;  2WVC A;  3HD2 A;  1CJV B;  2E1C A;  3TR5 A;  3BZQ A;  3QQC D;  5K9F A;  2DEJ A;  3I4P A;  5CD4 A;  1RKI A;  3GCX P;  1B0T A;  1KFD A;  1ZM4 A;  2IM1 A;  3F56 A;  4KPC A;  4ZPD A;  3PXG a;  4MTP A;  4ZJO A;  3UDV A;  5RUB A;  2MJN A;  2NLW A;  4X65 F;  3NNA A;  4AD6 A;  1F5A A;  5D0H A;  1SC1 B;  1VQ6 S;  2W25 A;  1YJN S;  1S1V A;  5F3Z A;  1QDU B;  2F65 A;  3VF0 B;  4CLU A;  4P72 A;  2IVY A;  3QIP B;  3H2U B;  2R8G A;  4AQY F;  1N48 A;  3AD9 C;  1Y5I B;  3HKW A;  3QO9 B;  4V1A k;  1RTI B;  3ZZP A;  2Z8Q A;  1PO6 A;  5F0W A;  1IM4 A;  3PCO B;  4NE9 C;  4A48 A;  3CJ8 A;  3FGV A;  2GZO A;  4U8Y A;  2MEW A;  1VFJ A;  4LF2 A;  2KYZ A;  2FVR A;  2Y0B B;  3AB4 B;  3HVW A;  2W7A A;  3ENW A;  1C4C A;  1OJ4 A;  5B0A A;  5KFD A;  2DR7 A;  2ZBC A;  1JLC A;  2YNI B;  1P6T A;  3DOK A;  5HVG A;  2IVM A;  1WTF A;  4CM2 A;  4N7T A;  1LOU A;  2D1C A;  2X1G A;  1ELO A;  3BV8 A;  5B0B A;  1VDH A;  2L3M A;  4ETX A;  1G7C B;  3ZFV A;  2YKQ A;  1S1V B;  3KWM A;  1MWZ A;  1H3D A;  2EFG A;  3MZI A;  3ZZU A;  5DG8 A;  4IR1 A;  2HAI A;  4I7F B;  2ADB A;  1XEZ A;  2W4P A;  4KPY A;  1RWU A;  3AD7 C;  4Y34 A;  3H5X A;  2ZC4 A;  4CTA B;  1U0S A;  2IMW P;  4P2M A;  1LWC B;  2CPX A;  3KLV A;  2RRN A;  1X8D A;  1XR6 A;  2UUB J;  3DLE B;  4CNY A;  3HK2 A;  5ETQ A;  1B7Y B;  3M6X A;  4ETZ A;  4D3G A;  2R7R A;  3M8Q B;  1TFY A;  1HWK A;  3IBC B;  1IKV A;  3IP0 A;  4J9V A;  1UWA A;  4IG0 A;  4Q8F A;  2BJ9 A;  2FJE B;  5GAG I;  1U1R A;  4ZVE A;  2UP1 A;  3FDS A;  2X7I A;  2VKR A;  3R5D A;  4USU A;  2RDJ A;  3KLG B;  3K0J A;  3MMA B;  2UU9 F;  2XGQ A;  2BM0 A;  2ZWP A;  5DDR C;  4NLS A;  2J6T A;  2EC0 A;  1RHM B;  3R97 A;  4JI8 J;  2YY3 A;  4WBF A;  2Z2Y B;  4M5H A;  2ZOF A;  1S9F A;  2LFV A;  1IBL F;  2Y8W A;  1G3O A;  2XY5 A;  3H98 A;  3M8Y A;  4DR6 J;  2HAF A;  3SQG A;  4DL6 A;  3AXK A;  2DVI A;  2BKN A;  5ETV A;  4CTA A;  2ZH5 A;  1K1Q A;  5F9N A;  3K58 A;  2EK1 A;  1ZS6 A;  2BE7 D;  4WP8 A;  5HQL A;  2BAN B;  5IWA J;  2BR0 A;  5A8W A;  4M5D B;  2HHV A;  2HWI A;  3PEJ A;  1R8P A;  2H5J B;  4WTO B;  2J9D A;  3HVA A;  4Y2C A;  3C16 B;  1TTH B;  2IJN A;  1RT7 A;  3MM7 A;  4PPD A;  3DRP B;  3WX4 A;  6FD1 A;  1FJ7 A;  1LK5 A;  1Y0H A;  3EWG A;  4RKU C;  3OR1 A;  2Q43 A;  3V6D A;  5F9L A;  2ZHA A;  3GFY A;  2B3T B;  4URQ U;  2C2D A;  2B43 A;  2KU7 A;  2OEL A;  1VIS A;  1CJK B;  2KG1 A;  2YXL A;  1NSQ A;  1UEK A;  4EWT A;  1N4L A;  1TK8 A;  2C2M B;  2JNJ A;  1WWH A;  5IC4 B;  4JI0 J;  3CJ4 A;  2CPI A;  2BJ8 A;  4WFY A;  4Y00 A;  4M5K A;  4C48 A;  1WKK A;  3HKZ D;  1PG5 B;  3BB5 A;  5D4O A;  2MKH A;  2V8D A;  2AYM A;  3ISN D;  3CWJ A;  3TZX A;  4YR3 A;  4DF8 A;  3FEZ A;  4WXO A;  3BSN A;  1CEZ A;  1HNV A;  1NSP A;  4OYW A;  1J5E J;  1DHM A;  1P8G A;  2LDI A;  3OPK A;  2FVS A;  1A7G E;  2GA7 A;  2VBY A;  4ZCM A;  5KT7 A;  2HSE B;  2YX4 A;  4DR3 F;  2AU0 A;  1PC4 A;  4X4O A;  1D9D A;  3H4B A;  1RT4 A;  4X66 J;  4EBE A;  3C16 A;  3DKD A;  3NLC A;  3KHL A;  1N5Q A;  1ZA2 B;  2Y1J A;  2LQ5 A;  5CAA A;  1YWX A;  3MAA B;  1NK9 A;  3KOA A;  3Q8P B;  4OZ3 A;  2QO3 A;  4ES3 A;  1RT5 A;  4NCB A;  2XTJ P;  1SKW A;  2RE1 A;  2L41 A;  3CJT A;  4KYZ A;  1X9M A;  2OSQ A;  2CJX B;  2NCK L;  2C42 A;  2PSZ A;  5IXU A;  3V6J A;  2JRS A;  3K5P A;  3NAH A;  3DDN A;  2RS8 A;  2K7J A;  4X66 F;  3EGW B;  3CDA A;  2JVO A;  5BYQ A;  4ZLJ A;  3KLI A;  3PYF A;  4LR8 A;  1VQO S;  3TAM A;  2QSF A;  4OHV A;  1D9A A;  4NCG B;  4DPO A;  4USH A;  1EIY B;  4DV6 J;  1VQ8 S;  2HZV A;  1S57 A;  4CLS A;  1PAE X;  4LSN B;  4XPE A;  2K7K A;  3HHL A;  2B7C B;  3IMQ J;  4DUZ J;  3U1M A;  1CUL A;  2OSR A;  2NYI A;  2WVB A;  1UFW A;  2XCP A;  1WHY A;  4I1T A;  5L1J A;  2C22 A;  1YJW S;  2E9Z A;  3BKU A;  5KG2 A;  4FYY B;  1OPI A;  1HPZ A;  4X64 F;  4UZB A;  2BYC A;  4FVM A;  1R27 B;  3D5M A;  3R5G A;  4QR2 A;  3PX0 A;  1RT6 A;  3LUY A;  4ICL A;  2IAJ B;  3L3C A;  2DNN A;  1BWV A;  4J9L A;  3MPV A;  1WKJ A;  2P9C A;  1VHF A;  5KT3 A;  5EWF A;  2HS0 A;  7FDR A;  1T7P A;  3KNA A;  2FGO A;  4LSL B;  3TNV A;  4ZVH A;  3SI8 A;  5HAO A;  3TP2 A;  2GMJ A;  2VPW B;  3B82 A;  3MD3 A;  2W7P A;  1UA0 A;  1N5Y B;  1KR4 A;  3MM9 A;  1GMU A;  2QMU B;  1CUL B;  4NA3 A;  4PWW A;  5I3Q A;  2VQF F;  2J5A A;  1TK0 A;  2GC8 A;  3HHD A;  3UVJ A;  4AT1 B;  1EQM A;  5ADZ A;  3GII A;  4ILR A;  2MLZ A;  3QSI A;  4OI1 A;  3IWN C;  4JI1 J;  4GKJ J;  5FJ4 A;  5ETO A;  3IBF B;  2DNG A;  2GGP A;  3I0R A;  1QTN B;  1RTH A;  2OUG A;  4K2X A;  4O4G A;  4BDP A;  4ZMM A;  2GQ2 A;  1CJU A;  1NO8 A;  4HI2 A;  4NLD A;  1JJ2 R;  2PD1 A;  2MYF A;  4H4M B;  2NPI A;  4F50 A;  2HRY A;  3A12 A;  3ETO A;  4DXL A;  5A0Y A;  3R5C A;  1HD0 A;  4USV A;  3Q0A A;  1EET B;  1FVQ A;  2CNN B;  5LXY A;  2XGP A;  3DHW C;  3LGM A;  4I0W A;  3BN4 A;  1RWW B;  4K4V A;  1PIL A;  3C15 B;  3HT0 A;  2XHW A;  1LW2 B;  4KHM A;  4F25 A;  1MN9 A;  2UUC F;  2VQF J;  2VDH A;  2GS8 A;  4N8N A;  5CYM A;  5ETK A;  4LT6 A;  1KQF B;  3ZZ0 A;  3GP9 A;  1HWI A;  1WEX A;  2Z2L A;  3CCW A;  3N6M A;  4B9L A;  1KOO A;  3RAX A;  4JI4 J;  1RDR A;  2ZVS A;  3CCZ A;  4TXS A;  3IGV A;  4PR6 A;  1S7H A;  3OLA A;  2ZE2 B;  3KG0 A;  4OHX A;  3MMB B;  2F7V A;  1N6Q A;  1KON A;  1S9E A;  5KFU A;  4JI6 J;  2EG1 A;  3SSR A;  4DV3 F;  1FXL A;  3R3T A;  1DUR A;  5A76 A;  2KG0 A;  2G1D A;  4HI1 A;  1YBA A;  2ZH6 A;  2XC9 A;  1FVS A;  3MM8 B;  2QJ3 A;  3I87 A;  4MKY A;  2GML A;  3W65 A;  3MED A;  2K1R A;  2D9O A;  3OT9 A;  3R7B B;  3O6Q A;  3CDE A;  4NEY A;  3EXY A;  1R8H A;  1XMO J;  1NK6 A;  3E2E A;  5HN0 A;  4DL4 A;  5HRO A;  2C2O B;  1NSK L;  1REV B;  1WF0 A;  3G6V A;  4C8K A;  1V6H A;  3AT1 B;  3HPO A;  2AD9 A;  1H74 A;  3LWL A;  4KGK A;  3NS5 A;  5E0O A;  4QBU A;  5J2N A;  4HKQ A;  5KFO A;  1VQY A;  2MXY A;  1RHJ B;  4ZVG A;  1F9H A;  3Q22 A;  3FRY A;  1NJZ A;  2WVE A;  1UKU A;  1VK3 A;  2IRX A;  2N3O A;  2DH9 A;  3ZTQ A;  4AQY J;  1KBR A;  4ZA1 A;  5L1I A;  2J76 E;  1RT3 A;  2OGU A;  1T05 A;  4Y3C A;  3NNH A;  1T3N A;  2K1R B;  3N6L A;  4CH7 A;  4DU7 A;  5KFN A;  3KLE B;  4G65 A;  2RF2 B;  2BM1 A;  2VKZ G;  4GRS A;  3UDE A;  1FEE A;  1Q79 A;  4OZ0 A;  1GX5 A;  2ZBP A;  1R0A A;  1SC3 B;  3KMQ A;  5U47 A;  3U1L A;  3UD4 P;  1GNK A;  2W01 A;  2IM0 A;  2XS2 A;  2CQ1 A;  1RWP B;  1X4B A;  3EGV A;  1U8W A;  3LGH A;  2NPF A;  1KVK A;  1VLY A;  5HK4 A;  3SCK E;  3OVS A;  4EBC A;  2ZJR Q;  5J1E B;  2E5H A;  2XO7 A;  3CCV S;  1BQM B;  4UZC A;  5GAE I;  2K8G A;  1PAU B;  5HMY A;  2V5H G;  4RNN A;  1WTB A;  1UVL A;  2OD4 A;  1LXJ A;  4HH0 A;  2APO A;  5BR8 F;  2PFF B;  3EUN A;  3LP2 B;  5HMW A;  2QMX A;  4DSL A;  2PGC A;  3A1Y G;  1A6L A;  4ZLN A;  2N4D A;  3DRS A;  5HLF A;  3M2R A;  2E5L J;  2VUG A;  3IRX B;  4HLB A;  5DGA A;  1S6P B;  4O4R A;  2H65 B;  5EX3 A;  1FO1 A;  2A10 A;  3CED A;  2Y8Y A;  1TL3 B;  3RYL A;  1R7I A;  5KFC A;  2DGQ A;  4J9U E;  3CPW R;  1HQE B;  2VPZ B;  1Q7L B;  2CNK B;  2UU9 J;  1QUP A;  3TUZ C;  3LAK A;  2AIR B;  2DBB A;  4S0M A;  2OPR B;  2OJ3 A;  2ZD1 B;  3V81 A;  3FVY A;  1OS5 A;  1XMB A;  3VAM A;  3QO9 A;  3ICL A;  4XDC A;  1S59 A;  4J9P A;  1C2P A;  3LP2 A;  3EGZ A;  5A8W B;  1VBY A;  3OL7 A;  2VL1 A;  3DN9 A;  1HW8 A;  2IDL A;  2BVZ A;  2F4F A;  2BZ2 A;  1RYS A;  4UY8 5;  5HLF B;  3SBM A;  1NDP A;  2RDD A;  2LVW A;  3N01 A;  3IRW P;  3DRP A;  4WPA A;  1S0O A;  1VQN S;  4RO0 A;  4LFB J;  1TR0 A;  4N5S A;  5JUM A;  3CC4 S;  1G1X A;  1T8E A;  1TL5 A;  3J7Z T;  4X4U A;  2KFN A;  2D41 A;  4F26 A;  3NWR A;  3TA2 A;  3W62 A;  2DR9 A;  1UTA A;  2HHH F;  1GH8 A;  2MTL A;  5FDL B;  4LIR A;  3LTO A;  1LWE B;  1DQ9 A;  4HT5 A;  4LFC F;  2PMH A;  5KFJ A;  2FGC A;  2E7V A;  3ET6 B;  5CYJ A;  2N4C A;  2ZD1 A;  3V81 B;  2YTC A;  3MTK A;  2YQ0 A;  1FDB A;  3GJR B;  5T41 A;  4F4W A;  3TJ8 A;  2HZC A;  2B4P A;  1Q16 B;  2HGL A;  4NEZ A;  5A6W A;  5DM6 Q;  3BYR A;  2WZ1 A;  1VQP S;  4DFM A;  2W2Q P;  4HDH A;  4IG3 B;  5F3T A;  2R8J A;  3MR6 A;  1VC6 A;  3J7A 1;  2FY8 A;  2XQC A;  2CWK A;  2YVS A;  3DGP A;  2BE2 B;  3HHK A;  2QL9 B;  5E3R A;  2VOD A;  3V4I B;  4YY3 J;  4H54 A;  2IC3 B;  3JSR A;  4LVN P;  4NI2 A;  1VCT A;  3NCR A;  3ZNJ 1;  2AEJ A;  3DXS X;  4QWC A;  3DLK B;  1N32 J;  2IYI A;  4PUO B;  3ETM A;  4DUT A;  1HMV B;  1P1L A;  3ET6 A;  1PSD A;  3ILI A;  3H5Y A;  3TEG A;  3MUR P;  4PXB A;  3HP6 A;  1K73 T;  1HBM A;  2B8P A;  3FC9 A;  4RR5 A;  3DRR A;  3KLH B;  3H5S A;  1HI8 A;  3LP1 B;  4X65 J;  3HF5 A;  4ES1 A;  2EC2 A;  2B7B B;  2FD2 A;  4DV7 F;  2V68 A;  2Y9H A;  4O44 B;  3GSD A;  4DL2 A;  2OKQ A;  2HFV A;  4IG3 A;  2RRA A;  5SUH A;  5B08 A;  2ADC A;  4N76 A;  1OQ3 A;  4LSN A;  2I8E A;  4ELT A;  5KFY A;  2ROG A;  2K3K A;  2AX0 A;  5ETS A;  2R7V A;  2V2Z A;  3QWU A;  4FKY A;  1VI7 A;  4TU7 A;  4RW6 B;  1N32 F;  3PEH A;  4I2P A;  2DY9 A;  3T1Y J;  3QRQ A;  2JL9 A;  1W7W A;  1RP5 A;  2GIR A;  2I1R A;  3AOD A;  4P7V A;  5EX0 A;  3ZC4 A;  4C0H A;  4XDD A;  3GWC A;  3CCJ S;  1N5V A;  3OW2 R;  4LF5 J;  4O3Q A;  4PAB A;  2VF3 A;  3ENA A;  3TA0 A;  3TW0 A;  4YDD B;  3PW7 A;  2BW7 A;  1TK5 A;  3E3X A;  1YJ9 S;  5F8M A;  1ROF A;  1RA7 A;  2G2Y A;  3DYA A;  4WIQ A;  5CAB A;  1C4A A;  3I6P A;  3KJN B;  2H51 B;  5L8R C;  1CSJ A;  3VGU A;  1E6V B;  5K8O A;  2XO6 A;  2ZOM A;  3TAQ A;  2HS4 A;  1KDN A;  2H4W B;  3FEY B;  3IM9 A;  4QZV B;  2C2Z B;  2HZA A;  3ILO A;  2R2T A;  5KT4 A;  3RRK A;  2CAJ A;  1K0V A;  2XYP B;  3ENV A;  2PEB A;  3UFC X;  3PVX A;  1SIZ A;  2AP6 A;  5M2U A;  5HBM A;  4NWB A;  3QLH A;  1OY8 A;  1XNR J;  4W92 B;  1U49 A;  4X4P A;  3FSI A;  3DCA A;  5AE2 A;  1U09 A;  1AT1 B;  1X60 A;  2XG8 A;  1I94 F;  5HMZ A;  4FS2 A;  3C6U A;  4B02 A;  2FHO B;  1SH3 A;  2CAD A;  3Q86 A;  2NRE A;  4CH1 A;  3VVT A;  2BAB A;  2PA3 A;  5F8G A;  3H5U A;  3EVO A;  4JI8 F;  3I0S A;  4ZP9 A;  4NCA A;  2ILZ A;  4OYZ A;  5H1S V;  3H90 A;  1I3O B;  1HW9 A;  1ZET A;  3OL8 A;  2CZ4 A;  2H4Y B;  2MQM A;  2XWX A;  2IYG A;  1HWJ A;  4O3P A;  4K50 A;  3GE9 A;  4UY8 T;  5IWA F;  3RW6 A;  3MAH A;  3BGR B;  2ILY A;  3M30 B;  4CI0 B;  1IJF B;  2KHC A;  4JI4 F;  2HBQ B;  2ZH3 A;  1TFW A;  4Q44 A;  3OJS A;  4ZLP A;  4DV0 J;  5A2Q Y;  5LJ5 Y;  3HHN B;  1DTQ A;  3D68 A;  2YKO A;  4DR5 J;  3MCM A;  4OIX A;  4UUW A;  5A8K A;  4B3T J;  3P4U B;  4R5P B;  3GPA A;  1S0M A;  4AL5 A;  4CT8 A;  2R7T A;  4L73 A;  3H8Y A;  4ZK7 M;  4TU9 A;  2ACY A;  2FJX A;  3LQV A;  1R0B G;  3OFE A;  1IBK J;  2CFX A;  3KK3 B;  3DMJ B;  2DXE A;  3IS9 A;  1OYD A;  2R4F A;  1O0P A;  1HI1 A;  2DNY A;  3CIZ A;  3QMQ A;  4WK3 A;  4JI2 J;  1PBA A;  1TUW A;  4A8S A;  5AJ3 F;  2FPH X;  2XYG B;  4GMK A;  4DL0 C;  5J2N B;  5E3Q A;  4DDF A;  1ICE B;  3I56 S;  3AD8 C;  1URN A;  3PW5 A;  2AF6 A;  1Y7P A;  1UVK A;  3MTJ A;  4RWX A;  2BW2 A;  1RSC A;  3C6T A;  1SH2 A;  3Q8R B;  2GO8 A;  4HHH A;  5F8J A;  3GZ7 A;  5GME A;  1FT8 A;  1KHW A;  2MZT A;  4YN3 B;  1X4E A;  3JYT A;  1NM2 A;  5CCM A;  5D4N A;  4PWD A;  3T9N A;  3C14 A;  3MEG A;  3V6K A;  2VA2 A;  2NUU G;  2QN6 B;  2MQQ A;  1RTZ A;  5KT6 A;  2M4M A;  2O66 A;  2FHM A;  2XZD B;  1HR0 J;  2CJB A;  4WZQ A;  2H9Z A;  5C24 A;  3GIL A;  3TQ1 A;  3HSD A;  4FYW B;  5L38 A;  4QIW D;  1LW2 A;  2B9E A;  2FVC A;  2ROE A;  2JLF A;  3W66 A;  1WHV A;  1RK8 A;  2RUG A;  4LRD A;  4URG A;  4EZ9 A;  3T1H F;  4WU2 A;  4QWB A;  4ES2 A;  1GX6 A;  2YWF A;  1VC5 A;  3TX8 A;  2H1Y A;  2CQB A;  2AYE A;  1NHK L;  1RAJ A;  1U2R A;  1MNE A;  4WXW A;  5ETP A;  2UXD F;  4JYA J;  5HJY A;  1BQM A;  4EMD A;  4Y0F A;  1QAX A;  1RAG B;  1S9E B;  3FMB A;  2AJ4 A;  3QZ8 A;  1NKB A;  4KTQ A;  1L3U A;  4HTJ A;  3BR8 A;  3OUY B;  1MML A;  2ASJ A;  2U1A A;  2XSJ A;  5HI7 A;  4CO1 A;  2FLL A;  3QNW B;  4DN0 A;  4DUZ F;  1LEO A;  1KFS A;  4TQR A;  2Z2Z A;  5E7O B;  2XLJ A;  3KXD A;  4ANC A;  2FLP A;  4B9U A;  1OWX A;  2W9C A;  4OJG A;  4X4S A;  3RRH A;  2E5L F;  4IH5 A;  2CQ4 A;  4C97 A;  4J7C A;  2YNI A;  4Z7Y A;  4U6P A;  4LUB A;  1FRH A;  5I3P A;  2WW4 A;  2DR8 A;  2PO4 A;  4JYA F;  2GHW A;  4WE1 A;  2F1F A;  1VQ5 S;  1D3W A;  1C0U B;  3OVA A;  4P9S A;  1PYT A;  1QUV A;  1VYA A;  4RL1 A;  2B4U A;  4LF4 J;  2CJ9 A;  1JKH B;  3J80 Y;  2XMK A;  4OJ1 A;  4QW9 A;  3D2W A;  5MLC V;  3OTE A;  2GCF A;  1IM6 A;  2N3L A;  4CLP A;  3S8S A;  2J0Q D;  2IY5 B;  5KOX A;  2HNY B;  1UWB B;  4HL9 A;  1JLA B;  3S1T A;  3ZTR A;  5C42 A;  1FNO A;  3M8Q A;  1JJH A;  3KLE A;  2LLZ A;  5D3G A;  2P9E A;  1X9S A;  2UVV A;  1N56 A;  1GK8 A;  2B6A B;  2BEF A;  2IPO B;  3SV3 A;  1NHV A;  4QWE A;  1G2E A;  1FKP A;  3M2V A;  2BA9 A;  3O5T B;  4DCJ B;  3FSY A;  3IN5 A;  1IJE B;  2ZVI A;  2BQR A;  2DTJ A;  2EFQ A;  4MYT A;  3A3O B;  4R0J A;  3QWP A;  2K06 A;  1PJ7 A;  4UUX A;  5D0E A;  4CO2 A;  4NLX A;  5LSL A;  2OTJ S;  2DIT A;  3L09 A;  3AA9 A;  4PXE A;  3UN5 A;  1H2U X;  4MIB A;  4N47 A;  2ATC B;  3MDF A;  4ZN3 A;  2EFP A;  5BYS A;  1U25 A;  3RBE A;  4IRD A;  2XMT A;  2XMJ A;  2Z30 B;  1M5K C;  4F67 A;  1X4G A;  1S6Q A;  3HM9 A;  1WG4 A;  1YHQ S;  2F8M A;  1QSY A;  1BQN A;  4C3M A;  4F3Q A;  5DQG A;  1WC3 A;  5D3G B;  4ED3 A;  2FJB B;  4OYO A;  4DPY A;  4A4J A;  2ZNY A;  4RU9 A;  2V63 A;  1S0N A;  2BQ3 A;  4B9N A;  1JLG B;  1S1X A;  3M2V B;  4HEA 9;  3N28 A;  3KG1 A;  1NSA A;  4NYZ A;  3V4I A;  3RB0 A;  2NXE A;  1N5T A;  1Q4R A;  4YY3 F;  1RGV A;  1B64 A;  3KMS A;  1TMJ A;  2DB1 A;  4DFJ A;  5M2P A;  2W7O A;  4PUO A;  2OPR A;  2HLT A;  3H20 A;  3AJ2 A;  4ECW A;  4OZL A;  1K44 A;  3OV7 A;  3DRR B;  4LBP A;  5AXN A;  3MR5 A;  2R9L A;  1QAY A;  5DJB A;  3RAQ A;  3JSY A;  4I64 A;  5B7W A;  4OZ5 A;  2QFI A;  4DR2 J;  4WFZ A;  3V2U C;  3RTV A;  4DV4 J;  4B9M A;  2I6W A;  4G1Q B;  1IKV B;  2RKI A;  1M1K T;  3QAU A;  4MIW A;  4C3K A;  1X9W A;  1PGZ A;  4GKK J;  5KAK A;  2J8S A;  4F4Y A;  1QVG R;  3OFH A;  4P6Q A;  4OZ2 A;  3BGU A;  2QLX A;  4LIW A;  2FTR A;  4Q8E A;  2VON A;  1JMT A;  4WK1 A;  1GT8 A;  1RT1 A;  2XY7 A;  4RW6 A;  2C28 A;  3M05 A;  3LP0 B;  3MD1 A;  3POT B;  4DUY J;  1OSC A;  1WC5 A;  2AGQ A;  2DCU B;  4CLW A;  2UXC F;  2OO4 A;  4ID8 A;  1CJT B;  1PIE A;  2JEF A;  5B0G A;  3SDE B;  1RHU B;  1KHV A;  2HK2 A;  1H7W A;  4OZJ A;  4ZPC A;  2MKI A;  4DR2 F;  1NPP A;  1DFD A;  2FHK A;  2FZG B;  4P73 A;  1Q81 T;  2YX1 A;  4BC9 A;  2KM8 B;  1U8S A;  3LAL A;  2JFK A;  4OV1 A;  3CCE S;  1WC0 A;  4DLE A;  1SL2 A;  4O23 A;  4OI3 A;  1D8Y A;  1E6V A;  2EXU A;  2P6S A;  4MMO A;  3HHL B;  1QY7 A;  4KHR A;  3KG4 A;  2V8V A;  3EGN A;  5JJB A;  1FK9 A;  1T3O A;  1CC7 A;  1WAC A;  1RT1 B;  1CJK A;  4OJ3 A;  4YOE A;  3K5N A;  1U47 A;  2NS1 B;  2KT3 A;  1NKC A;  3RG6 A;  1VQM S;  2UUA F;  2F3J A;  1TL1 A;  2DNH A;  2HMI A;  2PMW A;  4C9D A;  2Y1R I;  2WW8 A;  4B17 A;  3BJY A;  2LQ8 A;  3N4W A;  2P8I A;  3MMC B;  3TAR A;  3C6U B;  3RB3 A;  1KVJ A;  4UOF A;  1H7X A;  4DJB A;  3CJS A;  2K2P A;  4DSF A;  1K47 A;  1PCA A;  1KEK A;  2M8H A;  2KI2 A;  3M9O B;  4ZJQ A;  4Q5V A;  3OVB A;  2EEY A;  3C8Y A;  1VJQ A;  2QYG A;  2V8P A;  2HQI A;  3DLG A;  1CVJ A;  2C3O A;  3IR7 B;  3NCP A;  4ED0 A;  3BYP A;  4FKX A;  1WG5 A;  1RZM A;  4N41 A;  3WX8 A;  2HQD A;  3KHH A;  2DPI A;  3D54 A;  1LNQ A;  1RTH B;  3CB4 A;  2W2N P;  1YJU A;  4OYA A;  3DLJ A;  1NCL A;  4USJ C;  4WP9 A;  3VAG A;  5DQH A;  3H2L A;  4F3M A;  4QW8 A;  1JXL A;  3GG0 A;  1TKX A;  3H7H B;  4WF9 Q;  1EAY C;  1RUS A;  2E66 A;  2O1P A;  4LF1 A;  4RUH A;  2HRT A;  2A0F B;  3JXO A;  4LF4 F;  2Z56 B;  2JEI A;  1MMD A;  1TAQ A;  1EB0 A;  4CO4 A;  1WD6 A;  2B5J A;  2PA8 D;  1FJG F;  4YHH F;  4B3R J;  1EHW A;  2NXU A;  3HFK A;  3IS9 B;  5IT4 A;  1X4H A;  1VBK A;  3F0N A;  2YBV A;  4IDK A;  3MCN A;  2BE9 B;  2M70 A;  1S7I A;  2OMO A;  2P6T A;  2LP4 A;  2V0N A;  2WVF A;  2YNG B;  4JI2 F;  3TWZ A;  3PR4 A;  2W8L A;  4FF1 A;  1U6B A;  4NPO A;  4ZCL A;  4KIA A;  2OML A;  2DGV A;  1QD1 A;  1ZPW X;  3IAM 9;  3DM2 A;  3K7R A;  3KUH A;  4FPR A;  1U0H A;  1WHX A;  2J0X A;  3MEE B;  4DSK A;  4Y28 C;  2DO4 A;  2CPE A;  3EIC A;  4IFY A;  1TZ0 A;  1IKY B;  2KB2 A;  4IQM A;  4PXC A;  4ZVU B;  4LF7 J;  3OQ2 A;  1FKO A;  3ZXW A;  4ZOS A;  5AXM A;  5L46 A;  2DRD A;  5K8P A;  5CHC B;  5A6P A;  3HVR A;  1YSJ A;  1S99 A;  4TN2 A;  4CWB A;  4MK7 A;  4DQS A;  3SFG A;  3OBI A;  1JLE B;  2E7W A;  1DZ5 A;  4QYR A;  2IBO A;  2VFR A;  3NMA A;  2HBY B;  4OQJ A;  3WQP A;  5EWE A;  2XSF A;  2MQL A;  2LQJ A;  1MW7 A;  4L75 A;  1Y5L B;  3UCG A;  1KLM B;  4OYX A;  1S1T A;  3IR6 B;  3BPS P;  4K59 A;  2GGP B;  2N7C A;  5DM7 Q;  4C3L A;  3EX7 B;  2KT2 A;  3IG1 B;  3OTB A;  2KDO A;  3M32 A;  3OUY A;  1NHU A;  4QQB A;  3ZTO A;  1E6Y A;  2OPP B;  2JSX A;  5THW A;  4QU7 A;  1TEL A;  2HLU A;  2YWW A;  3CDW A;  1L3K A;  4G1I A;  3FJ2 A;  4FP9 A;  3G9C A;  1EET A;  1YVF A;  3DOM B;  4CH0 S;  1JQG A;  1RWV B;  4XTT A;  3FNN A;  1FWP A;  2WON A;  2YKN B;  2Z2M A;  3GSI A;  1HA1 A;  1LFW A;  1W25 A;  2L48 A;  4QPX A;  1UL3 A;  3BSA A;  1U1L A;  1NJX A;  3PJX A;  3NL0 A;  3KK3 A;  4PG6 A;  2XMA A;  2M7S A;  3LO3 A;  1Q8I A;  2V4R A;  4BCA A;  2GVZ B;  2UXB F;  1FTC A;  4LR7 A;  3RAM A;  3V5R A;  1YIT S;  2OPQ B;  1WEL A;  4I67 A;  1MWQ A;  4AE5 A;  4WFA Q;  3DDI A;  5AE3 A;  2MGZ B;  1T03 B;  4Q0B A;  4RW4 B;  4HH1 A;  3CUL A;  3Q2S C;  4MK9 A;  1VR6 A;  1YJT A;  1YZ7 A;  3MEG B;  4DV1 F;  1JLF A;  4PQU B;  4QWD A;  1FD2 A;  2F8E X;  2VV5 A;  4PCQ A;  2DK2 A;  3M2R B;  1HHT P;  3AOB A;  1XC9 A;  1FNX H;  2C3M A;  4L74 A;  4K4Y A;  3GYN A;  3VAI A;  2ZZT A;  3IGN A;  4MAK A;  1M90 T;  3WC0 A;  5LMU J;  2LCW A;  2V8H A;  5DO2 A;  1IR1 A;  3M7V A;  1X5S A;  4UT4 A;  3FSX A;  1XR7 A;  2RQ4 A;  1NXI A;  3S01 A;  4U95 A;  1N33 F;  4U7U K;  1M1G A;  2OPQ A;  3AQP A;  3D6M B;  3TRG A;  1UCN A;  1WF1 A;  4CT9 A;  3X3U A;  1NPR A;  5AE1 A;  3ZZY A;  6AT1 B;  3PO5 A;  3DNC A;  1ZTW A;  2WAQ D;  3W64 A;  4RW8 B;  1NB2 A;  2N7Y A;  2BXJ A;  1RLC L;  4HDG A;  4P2S A;  5HVF A;  3Q89 A;  1T9U A;  1UEU A;  5J2Q A;  1RAH B;  3FKB A;  4O3R A;  2K3I A;  3K59 A;  4FVC A;  1N88 A;  2CDQ A;  4H4O B;  1OPZ A;  4WJB A;  3Q8S B;  3TVY A;  5I3U B;  3H59 A;  3MM5 A;  4PKD B;  4OX9 F;  2J9E A;  3OL9 A;  2HFO A;  1XMQ J;  2V2V A;  5D4P A;  3TAP A;  1R43 A;  3NGR A;  4AYB D;  4B3T F;  2KZZ A;  2PI4 A;  3BGO P;  4EEY A;  1RAE B;  4ED8 A;  2MLX A;  5KG3 A;  4TNO A;  2CQP A;  3SQG B;  1Q8K A;  5KFH A;  2RHQ B;  2VA3 A;  5CH7 B;  1SUQ A;  2WVD A;  3FUY A;  1HWU A;  3A4T A;  4Q43 A;  3NGD A;  3NCQ A;  4K5S A;  2ABY A;  2WSE C;  1U4B A;  3C66 A;  2MZJ A;  4IUF A;  2HNY A;  4X62 J;  2ZH4 A;  3IFE A;  2V67 A;  4Y2A A;  5CCL A;  1RT7 B;  3LAN A;  3MM7 B;  2ZZM A;  1O8B A;  1OQ6 A;  2MQO A;  4DV4 F;  3EJM A;  3G2X A;  1MLA A;  4ENO A;  4DV3 J;  2Q6B A;  1TL3 A;  1MRO A;  2LA6 A;  1U1P A;  1T9Y A;  3OFF A;  3DOK B;  2FJW A;  1JXE A;  4CO0 A;  1HYS A;  3CCT A;  4K2J A;  2XLK A;  2VDI A;  1D9F A;  2IM2 A;  3NWG A;  4DR1 F;  3KJV B;  4U9R A;  3DLK A;  3QT6 A;  4H4K A;  5B0D A;  5DGB A;  3CCU S;  3MF5 A;  1NZ8 A;  1GTH A;  2UZA A;  3SDE A;  4DUY F;  4E8U A;  2VOP A;  3QGI A;  5KT2 A;  3JSM B;  5L1K A;  2Q1L A;  2DIV A;  4R25 A;  2AGP A;  1LWC A;  4DMZ A;  5HQM A;  4PYD A;  2WRM A;  4N77 A;  3W5Y A;  2G2Z A;  1BQN B;  1C0T A;  2DNM A;  4M8L A;  4NL5 A;  2JLE A;  4LBI A;  4UOC A;  4FBU A;  3X1L B;  1SKS A;  4X4N A;  1D09 B;  3KNG A;  2UXD J;  4OLO A;  4PAA A;  2GHV C;  1S1W B;  5CYQ A;  1FK9 B;  2VG5 A;  4A8O A;  4X4R A;  4DR1 J;  1HYS B;  1YX2 A;  2DHA A;  3DDK A;  3GJS B;  3ILL A;  4F04 B;  2HK3 A;  2UVR A;  3AB2 B;  3ITH A;  2YQ3 A;  1TL1 B;  1T9X A;  1QAJ A;  2HMI B;  2M9K A;  2XUL A;  2YNH B;  4USK A;  2FJA B;  1HLW A;  3GIR A;  2GQC A;  2R7U A;  2DNP A;  4USI A;  1ZAW A;  5DDO C;  2GO9 A;  2IDE A;  1QTM A;  4M5D A;  2M0G B;  3N6N A;  3CD6 S;  2I2Y A;  3TOQ A;  3D7S B;  2VQE F;  4C8L A;  2DGS A;  4JI3 F;  1ACM B;  2UV8 A;  2W8K A;  1JLB B;  3AY0 A;  3BDE A;  4EU0 A;  1S1W A;  2KO1 A;  2BE2 A;  2DNQ A;  3RW7 A;  2XM3 A;  2VBW A;  4EK2 A;  3ZO7 A;  1ZAX A;  2R3V A;  2MKC A;  4YR0 A;  1FWK A;  3LWM A;  2FQQ B;  2LEC A;  2EBG A;  4L6V 3;  1DQA A;  5KG6 A;  1FDD A;  1WKL A;  1JNR B;  1VBX A;  3L9Z A;  2J6S A;  4F4A A;  2Y0S D;  4C8Z A;  4U67 Q;  1X4A A;  5D6G A;  2X1A A;  1CJT A;  4AL6 A;  3CC2 S;  3PYD A;  5ETR A;  2V2K A;  4IH7 A;  2VJU A;  1TVR B;  1URR A;  2CQD A;  4DV2 F;  2D7S A;  3FRZ A;  3QRP A;  1RT6 B;  4ICL B;  3GQC A;  2BJ3 A;  5CQG A;  2OLW A;  3I96 A;  4EBD A;  5B0E A;  1O6X A;  3T5J A;  1KS2 A;  1IBM J;  4DSJ A;  4CP5 A;  4FYD A;  2WB4 A;  4ALZ A;  2QTW A;  2WBM A;  3PAC A;  1L3T A;  4OYP A;  5HO4 A;  2DGT A;  1S49 A;  3MR3 A;  1K0T A;  4ITS A;  3CDB A;  4M63 A;  4EO6 A;  4ELU A;  4DV1 J;  4KY3 A;  3HJF A;  2RNE A;  4IDK B;  1FES A;  2DJW A;  3IR5 B;  1GMW A;  1IR0 A;  3CD7 A;  4QOT A;  4U96 A;  1DLO A;  2JOQ A;  2JX2 A;  2VIH A;  1Q8B A;  1RT2 A;  3VAF A;  5H9E K;  1EKS A;  2UVU A;  1Y5N B;  1QLN A;  5I4M A;  2LU2 A;  4WZM A;  2X51 A;  4NRU A;  1F60 B;  4OHZ A;  1GXL A;  4JI1 F;  1UW9 A;  2DNO A;  1RWO B;  2YX7 A;  3L7O A;  2XZW A;  1KOH A;  2BRK A;  1M5H A;  2HBR B;  3M2U A;  1RI7 A;  3OSP A;  1L3V A;  1NH8 A;  3M8P A;  2XI2 A;  3PW2 A;  2VD3 A;  3AQO A;  1JNZ B;  1OIA A;  2WK4 A;  3ZZO A;  3O2I A;  3CD5 A;  3HLU A;  2D3O R;  1TKD A;  4LFC J;  2CQC A;  3MOJ B;  2WTF A;  3ELH A;  3OXF A;  2FB0 A;  4OX8 A;  4DR4 F;  2PMZ D;  2YWE A;  4NXM F;  3K2Y A;  3SCL E;  2IIH A;  2C3P A;  2FVP A;  3SCI E;  4UTG A;  1XNR F;  2W2O P;  4GVL A;  1KLM A;  1SH0 A;  2Y3Y A;  1TKT A;  3R5B A;  2ZM6 J;  3KHR A;  3CJR A;  1I94 J;  2ZBR A;  3QLH B;  1UPP A;  4CIO A;  4WYL A;  3A8K A;  5IM0 A;  1YBU A;  4DR7 J;  3D9B A;  3OR2 A;  1JB0 C;  3W8G A;  2ZOG A;  1WC1 A;  3MM8 A;  8AT1 B;  4DV5 F;  1AB8 A;  1HBU B;  1HBO B;  1TV6 A;  3KDN A;  4JV0 A;  3C3L A;  2I5J B;  2AJQ A;  2V69 A;  1AXQ A;  1Q8L A;  2HVD A;  3A3N B;  1HQU B;  3A8I A;  5E3P A;  1BD6 A;  1H73 A;  2CYY A;  4KQZ A;  4O0I A;  4LSL A;  1HHQ A;  4JV1 A;  3W8P A;  4NXM J;  1HL6 A;  5FLX Y;  2G0C A;  3MM9 B;  4UF4 A;  1B99 A;  4K0K J;  1IR2 A;  2VBZ A;  2YKP A;  2YNG A;  3LAM A;  2ZM6 F;  1F3F A;  3ILJ A;  4K7Q A;  2BQU A;  1PBU A;  1SXL A;  4LF6 J;  1R8A A;  1TKT B;  2GIQ A;  3W9I A;  2DD8 S;  2GJ2 A;  5KFP A;  4I6W A;  1F1B B;  3UR0 A;  3UNY A;  4DV5 J;  3GU0 A;  4MT1 A;  1VOM A;  3QGG A;  1KD1 T;  2D3U A;  1QAI A;  4RW4 A;  2RSQ A;  2PEH A;  3NG8 A;  4P2X A;  1F9E B;  3J7Z 5;  4F8R A;  1YDL A;  3LGN A;  3PV8 A;  4TVA B;  1CBK A;  1YQH A;  3MGJ A;  4DR6 F;  2QYC A;  2R7O A;  2W9C B;  2HG4 A;  1IKW A;  3D6F B;  4GVB B;  1VBZ A;  2B0G A;  1B7F A;  1UET A;  2HWH A;  2XEX A;  3D0H E;  2RU9 A;  3RB6 A;  3CMA S;  1J27 A;  2G13 A;  1ZH5 A;  1XTZ A;  3HSZ A;  4LF6 F;  5HMX A;  1EP4 A;  1TU0 B;  3PO4 A;  1H0H B;  2AWZ A;  1FFS B;  3K8V A;  4DN9 A;  3CJK A;  5IV4 A;  1S76 D;  3KUG A;  1MU2 B;  4ZCK A;  4RUB A;  1LWF B;  4C0O C;  2D3O 1;  4QR0 A;  3D0I E;  1AA1 B;  2RQC A;  1U1K A;  3GFH A;  3UQS A;  1S12 A;  1KP6 A;  3LA0 A;  1BUX A;  3NGK A;  3PHE A;  4TLQ A;  3G82 B;  3MPY A;  4J37 A;  3HCX A;  2CQI A;  4LF9 J;  1KTV A;  2XHC A;  3DU5 A;  4H4O A;  1HNZ J;  1UVJ A;  4CLT A;  5HRO B;  1WOO A;  4OV6 A;  3Q8U A;  5KFF A;  2MQP A;  1FDA A;  1LK7 A;  1XJW B;  4F4K A;  1EJ7 L;  2O5D A;  4K4X A;  4IRC A;  3NY0 A;  1HHS A;  2CNL B;  2A2C A;  1IKX A;  1R31 A;  2BRL A;  4KE5 A;  4LSZ B;  4MIA A;  4ZVR B;  3UD3 P;  3R1H A;  3ZTS A;  2F4V J;  4NX9 A;  2LDY A;  3JTP A;  4P52 A;  3SQO P;  3MUV P;  1C1B B;  4CLF A;  3PFO A;  1LW0 A;  1MG7 A;  1M5S A;  2O67 A;  4W90 B;  4E98 A;  2FJV A;  1SUQ B;  4ED5 A;  4J91 A;  3NMR A;  4B3O B;  1TAU A;  1S6Q B;  2HPU A;  3FBC A;  4TU8 A;  2DO0 A;  2VPY B;  5B0C A;  4ED7 A;  2W9B A;  1HNX J;  3FZ2 A;  2COL A;  2XS5 A;  4PQU A;  1HNZ F;  4ATN A;  5G0R A;  1CJV A;  2RS2 A;  2OEJ A;  3QT7 A;  1BQX A;  4W4M A;  4AL7 A;  2CPH A;  5E2Q A;  2JC1 A;  3TJA A;  3O44 A;  3UD5 A;  4A8F A;  1YRU A;  4DQQ A;  1MRO B;  1MMN A;  3HSG A;  4LRB A;  5I42 B;  3BO4 A;  3MMA A;  1HI0 P;  5HAN A;  2QLB B;  1X31 C;  3OLB A;  1YGY A;  4WE1 B;  3G6E S;  4GC7 A;  2AT1 B;  2QIF A;  4AXI A;  2XMM A;  4LF7 F;  1C0U A;  3K57 A;  2NQP A;  3GG1 A;  4BLG A;  2W4D A;  3F44 A;  3G8S A;  1TL7 B;  8ATC B;  2VHG A;  2KJV A;  1FRK A;  1GMV A;  4Y2I A;  4BWM A;  2EFV A;  2QLJ B;  3GIM A;  1NZA A;  3J81 U;  3GIK A;  1IBK F;  1AFI A;  1KQS R;  3J81 Y;  2ZDP A;  4F0H A;  2X1B A;  4UQG A;  2W9B B;  2J0S D;  3UPF A;  2LA4 A;  4NYO A;  1T94 A;  2C2N A;  1JLA A;  3ULH A;  4FXW A;  5C42 B;  3CSK A;  2ZBI A;  5KFG A;  5AJ3 J;  5LMU F;  4WTY A;  3EZ5 A;  4KFB A;  2IRU A;  2VIC A;  2L9N A;  1S5Z A;  3OR1 B;  3HHL D;  3VAH A;  5C5J A;  3MM5 B;  3W9J A;  5FD1 A;  3UCZ P;  2VG5 B;  2M5Y A;  5IC6 B;  1SC4 B;  2V9K A;  2P5V A;  3CMQ A;  1X5T A;  4ZVT B;  3RB4 A;  5J1P A;  4QU6 A;  3SEO A;  3R7S B;  2ZH2 A;  2AHO B;  4RX6 A;  2KH9 A;  5IS2 A;  3POT A;  1T0T V;  1UAW A;  2R7W A;  4F02 A;  1WOR A;  2DY1 A;  1NDK A;  2AKW B;  4LFA J;  4ZPV R;  3BH6 B;  3TA1 A;  1J5O A;  2NXJ A;  4I56 A;  4FXD A;  2AJ0 A;  3QGH A;  3VQS A;  2QSW A;  4CM0 A;  2E1M C;  1ZA1 B;  4Y65 A;  1T11 A;  2ZHO A;  1SVD A;  3DLE A;  2DXF A;  3JTO A;  4DLG A;  3NGU A;  4ECT A;  2QLW A;  2QMW A;  4IR9 A;  3TX0 A;  2UXB J;  4ECQ A;  2J6U A;  1FF2 A;  4DZD A;  1X5P A;  5KG4 A;  4LRE A;  2HQC A;  2LYV A;  4KFB B;  1JLG A;  3PFE A;  3HMJ G;  1BMQ B;  3PX6 A;  3KLG A;  3AFG A;  5L9N A;  2HHS A;  3EVM A;  1FFW B;  5B0F A;  4KH1 B;  2JVR A;  3M1V A;  2AMC B;  4DL3 A;  5IV3 A;  2MKY A;  1IQT A;  3JQK A;  2KN4 A;  3MI7 X;  4CNZ A;  4CYU B;  2QGF B;  3EZU A;  4NZ6 A;  5LT5 A;  3OHA A;  3QSY B;  5CA5 A;  3IA0 A;  4AND A;  1Y3J A;  1B3T A;  2XB2 D;  2DIS A;  3QZ7 A;  4NLV A;  3VR1 A;  1UP1 A;  4ILL A;  2F9J A;  3MEC A;  2OH2 A;  4ERD A;  1F2G A;  3CT9 A;  1ZM3 A;  5C2G A;  2RIJ A;  3CGI A;  3DI6 B;  1RTD A;  2AEM A;  2E44 A;  1RBO B;  1RBA A;  2YPZ A;  4LBH A;  2LEA A;  1CPZ A;  3VGS A;  2CG8 A;  4X4T A;  1UMJ A;  1GQE A;  4KKO A;  4LF8 J;  4CLL A;  2LXI A;  2OFG X;  3SMZ A;  1P1T A;  3NBP B;  3MWB A;  1ULR A;  1OSD A;  1BXN A;  1VC0 A;  4LRC A;  1RT2 B;  1PJ6 A;  4ER8 A;  1SL0 A;  3TAN A;  3CJ0 A;  5H9F K;  3PZP A;  1HPZ B;  1S4F A;  3BGL A;  1N0V C;  3ISN C;  3R7N B;  1HMV A;  3HZE A;  3D3B J;  4QIV A;  3BBF A;  3P5B P;  1IBM F;  4JV2 A;  1X4C A;  5E41 A;  3T9Z A;  3AA8 A;  2B4O A;  5E5N A;  4ZP7 A;  1F2H A;  1XIQ A;  2PN6 A;  2YNF A;  3ZZT A;  4RZR A;  2CQ0 A;  2IVF B;  2MZ1 A;  1FJC A;  2IMO A;  4NLT A;  2X1F A;  4YEA A;  2AJ2 A;  1RU2 A;  3JAM Y;  4IO1 A;  3EPG A;  2EBE A;  2JHE A;  1JJ4 A;  1D8Z A;  2M2B A;  2WB1 D;  3R5A A;  4EI2 A;  4ZKA A;  1NRK A;  4DQR A;  4KKO B;  1APS A;  1Q95 G;  2G1H A;  1FRJ A;  1UFL A;  2XCA A;  1WF2 A;  2ZJP Q;  4TYA A;  1RA6 A;  2GV1 A;  3G71 S;  4L76 A;  1ZZN A;  5CXT A;  4C11 A;  4X62 F;  2RHS B;  1GAO A;  3EVW A;  2F40 A;  4F4X A;  3IXQ A;  5KFR A;  1RIS A;  2QA4 S;  3L4B C; 
#chains in the Genus database with same CATH homology
 1XMQ J;  4KHP J;  2UU9 J;  5BR8 J;  4LFC J;  3J81 U;  4PWW A;  3R2C J;  2UUB J;  5AJ3 J;  4GKJ J;  4X62 J;  4JI1 J;  2MQ8 A;  2ZM6 J;  1I94 J;  4LFB J;  5LMN J;  1N36 J;  5LM7 E;  4DV0 J;  4DR7 J;  4DV3 J;  4DR5 J;  4LF7 J;  4B3T J;  2MTL A;  3J7A N;  4JI8 J;  4YHH J;  4B3R J;  4DR6 J;  4LFA J;  1IBK J;  2UXC J;  3W1Y C;  4NXM J;  2VQF J;  4JI2 J;  3J80 U;  1N34 J;  5IWA J;  2KVQ E;  5LMU J;  4JI4 J;  4K0K J;  4NEZ A;  3T1H J;  3JAM U;  4DR2 J;  4JI6 J;  2UXB J;  4LF6 J;  4DV4 J;  4DR3 J;  4DV7 J;  2UXD J;  4GKK J;  4DV5 J;  2HHH J;  4RJV A;  4B3M J;  4YY3 J;  4DR1 J;  1IBL J;  4NXN J;  1HR0 J;  5IT9 U;  4NEY A;  4DUY J;  4JI0 J;  1XMO J;  1N32 J;  2UUC J;  4B3S J;  1XNQ J;  4HHU A;  1J5E J;  4X65 J;  4DV2 J;  4JYA J;  4X66 J;  1N33 J;  4LF8 J;  4AQY J;  4JI5 J;  1FJG J;  3T1Y J;  4LF9 J;  1HNZ J;  4KYZ A;  3D3C J;  3D3B J;  4X64 J;  4LF5 J;  3OTO J;  4OX9 J;  2VQE J;  4JI3 J;  2F4V J;  1IBM J;  4JI7 J;  2KL8 A;  4LF4 J;  3R2D J;  4DV6 J;  5FLX U;  3IMQ J;  4V1A k;  4KY3 A;  4DUZ J;  4DV1 J;  1HNX J;  2UUA J;  4DR4 J;  2MEW A;  2E5L J;  1HNW J;  1XNR J;  4JV5 J;  5A2Q U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...