2MEWA

Solution structure of nuse (s10) from thermotoga maritima
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of NusE from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Structural protein
molecule keywords 30S ribosomal protein S10
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mewA00
3JAMU 4JI2J 4LFAJ 4OX9J 4DR6J 4JI7J 2UUAJ 4AQYJ 2ZM6J 4DR7J 1I94J 4DV3J 4X62J 4X64J 4JI4J 2UUCJ 4DR1J 5LM7E 2UU9J 4K0KJ 2VQFJ 4LF7J 4KHPJ 2UXCJ 4JI6J 2UXDJ 4LF6J 4YHHJ 1IBLJ 1N34J 4DV1J 5LMUJ 1XNRJ 4X65J 4DUYJ 4LF5J 4GKKJ 4JI0J 1HNWJ 1N32J 4DV0J 1J5EJ 4DV7J 4KYZA 1HR0J 4JI3J 4B3RJ 1XMQJ 2KVQE 3T1YJ 4DV6J 3J81U 2MQ8A 3T1HJ 3J80U 1N33J 1IBMJ 4JV5J 2VQEJ 4NEZA 3J7AN 5AJ3J 4LF4J 4DR2J 4KY3A 3IMQJ 5IWAJ 4LF9J 2MEWA 1HNXJ 4LFBJ 4LFCJ 4JI1J 2HHHJ 4NXNJ 4V1Ak 1N36J 4GKJJ 4DUZJ 4RJVA 2UXBJ 4JYAJ 1HNZJ 4DR3J 5IT9U 4DV2J 4PWWA 3W1YC 2MTLA 3OTOJ 3R2DJ 1XMOJ 3D3BJ 4NXMJ 3D3CJ 5LMNJ 4X66J 3R2CJ 1IBKJ 2KL8A 5A2QU 4JI8J 1XNQJ 4JI5J 4DV4J 4DV5J 5FLXU 4LF8J 4B3MJ 4YY3J 4DR4J 2E5LJ 4DR5J 4B3SJ 4B3TJ 2UUBJ 4HHUA 4NEYA 5BR8J 1FJGJ 2F4VJ
chains in the Genus database with same CATH superfamily
3R6GB 2MGZA 2DIVA 1PC4A 3PVXA 2J8AA 2UUTA 1V9OA 3MMAB 1VQPS 4OX9J 4P7VA 5LSOA 5IQQA 1NM2A 5L9XA 2XLJA 1Y00A 1OWXA 1SL0A 1FEHA 4KHMA 4FPIA 2AX0A 3L7OA 2V4QA 4WXOA 6FDRA 3EGNA 1R8HA 2DYAA 2E9ZA 2I6WA 1D9FA 1NEEA 2OD6A 3LA0A 4MFBB 3IWXA 4NLDA 4OYXA 3AH6A 4ZP8A 4ZDNA 3KK2B 4LREA 3M8RA 2WVBA 4USTA 3SXLA 2CZ4A 5D4NA 4YR3A 2DGTA 2LQBA 1OY8A 3MAAB 4WFZA 3BBFA 4CO4A 3IGNA 4CNYA 5J1EA 4IOCQ 1JLBB 2FLNA 2UU9J 5CHCB 1OYEA 2C3OA 5KAKA 3K57A 4CLLA 3SV4A 5KG0A 2BJ9A 2DK2A 1N34J 2KXFA 2CJ9A 4EUVA 3ITHB 1CJUA 1NH8A 2CAJA 1JLGB 4O3PA 1EETA 3G6XA 3ZZRA 1U1RA 1FXLA 4DZDA 4OLPA 1WC4A 4YEAA 4J9MA 1OJ4A 2BANB 2FTRA 3IM9A 3HT3A 1FXRA 3QO9B 3P8BB 1FD8A 2HWTA 4OI1A 3LP0B 3ICLA 3JSMB 2F4VF 2FVCA 3D6TB 3DHWC 5CYJA 3KLEA 3VTIA 3UDVA 3MPYA 4DLEA 4Q8EA 2K8GA 4KFBB 1OYDA 1QM9A 4OI6A 2MY7A 2ZE2B 4OYIA 3A3PB 3GLJA 4YOEA 1AUSL 1PJ7A 4Y2CA 1Q4RA 3BO2A 3AXKA 2BJDA 2H1YA 3CSKA 1M1KT 2FZKB 4L3KA 2WAQD 3OTBA 3UVJA 5CYQA 3OUYA 3KJVB 4OMFG 4NYOA 2HK2A 4AXIA 2DKOB 2W4DA 4JI0J 4QW9A 4UQGA 1PJ6A 2GGPB 4WP8A 1NH7A 1N5SA 4L73A 3NXZA 1LWXA 2MSTA 4KY3A 3VVTA 3R5BA 2D3ZA 5GMDA 2YPYA 4JI3F 1LQ9A 3E01B 4NLVA 5IC4B 2CPXA 2HVDA 4DHVA 4QIWD 1M5OC 4DSKA 4DV7F 4J9PA 2WTFA 2K3KA 1JMTA 4PCQA 2OELA 3NNAA 4K2JA 2QTWA 4WZQA 2HG4A 5GMKa 2FC8A 2GAHC 5KG5A 2UV8A 5DZ7A 1KQFB 4TU8A 1HR0F 4DFMA 1NXIA 3PIOQ 3DRSA 2R7TA 1NUEA 3RR7A 4ZPVR 4IOBA 3I0SB 4OYZA 3PNIA 4ECTA 2UXBJ 2ZM6F 4OV6A 4PQUB 4JBCA 3LWLA 3GSIA 1UW9A 2IA6A 1EARA 3V81A 3GWCA 2XLKA 3I0RA 2VF3A 4TQRA 2CVIA 2FD2A 3P3DA 3N6LA 2BEFA 2OFGX 3ZC4A 4NXNF 3ETMA 2X3GA 4DX8H 1GK8A 5DM7Q 2ZZMA 4K0KF 1KVIA 4HACB 1D8YA 1YGYA 2XC9A 5HLFB 4NCGA 4NYPA 1FRMA 2DNGA 3HD2A 5A6PA 2KB2A 3KJFB 5KFCA 2V4RA 4ED8A 1GTHA 3P6YC 5FJ4A 3TVYA 4NL5A 3IFEA 2F8MA 2IM0A 2Z2MA 3MPDA 3SSSA 2V94A 4M5DB 4OYPA 4LMZA 1X4FA 2V8HA 2VG6A 3IP0A 2EFOA 3GSDA 3J80Y 1QY7A 2DGUA 2IJFA 1J27A 5AXLA 4NOHA 4QWEA 5E3QA 2B5JA 3MMBB 1AZSB 2RRAA 2QYCA 2V2KA 3TUIC 3I6PA 4Q2MA 1JNZB 2IA0A 4HHUA 3EVWA 3CJTA 1GMWA 4NEYA 3HM9A 3BQ2A 4DV0F 5ETOA 4CQ1A 3V2UC 2XHCA 2P5VA 2MQLA 2BE7D 3VAGA 1MLAA 5KT7A 3AFGA 3HFVA 5AJ3F 3WHIA 3QGPA 1S48A 2H5EA 1Q8BA 2ACYA 3IG1B 3MM5B 3MMCA 4LRDA 4DDFA 2HHWA 1I94J 3VCDA 4BHQA 1NKBA 2I5JB 4RUHA 2VPYB 3GFYA 4HACA 4AE5A 4X66F 4DG1A 1U1QA 2N7CA 2V2ZA 4UUXA 2UXCJ 2C2ZB 2G0JA 2KN4A 3MUVP 1JJHA 2HAFA 3SQGB 1EP4B 3V5RA 1WELA 2C3YA 3HHDA 4PXBA 2MLXA 4ZCLA 3T9ZA 2OD4A 4FKYA 4ZN1A 2R7WA 1HQ2A 3HK2A 1WOPA 1IWAA 5LMUJ 3G6YA 3NEKA 1LWEB 1SJFA 2QLJB 1AZSA 1O0PA 2AV5A 2A3JA 4QWCA 4LF5J 3KUGA 2ZBIA 5J2QA 4HH0A 5KFFA 1SKRA 4PWDB 1TKXB 3MEDB 4F8RA 4D3HA 3HO1A 1S6QB 4F3QA 4DQSA 5B0EA 2GC8A 4URQU 1RHKB 2JLFA 3S6EA 3AOCA 2YTCA 3A3OB 1U2RA 2WB4A 4OX9F 5EWFA 1M5KC 2ASYA 1X31C 1HR0J 2VOPA 1OQ6A 3L7UA 4U8VA 2LLZA 5I42A 3JB9k 3DRXA 1NO8A 2R2RA 1QLNA 3ENVA 4K4UA 3T1HJ 2BW2A 1JLAB 1XTZA 2CVEA 3M6XA 4ID5A 2NSCA 3LO3A 4LSNB 5C24B 5K20B 1RT2A 1UFLA 3QATA 4ILRA 1XN9A 4P6QA 2XNRA 3OVSA 1OIAA 2GS8A 4DN9A 3J7AN 1YJVA 3D6MB 3G9CA 4CLUA 1S6UA 5JMNA 1X5SA 5F9LA 3HP6A 5G0RA 4RZRA 3H40A 4QU7A 4LUBA 2HHUA 5DM6Q 3PW2A 2FC9A 2YQ0A 3MCMA 2AF6A 2OEJA 1K9MT 1WOSA 1YQHA 2GNKA 5GAGU 3OFFA 5T14A 1JJ2R 5C25B 2XO7A 3MECB 4OHVA 1RBAA 3ENQA 3Q8YA 3PZPA 5C2GA 2DIUA 3PJWA 1TMMA 3OXGA 2KM8B 1WORA 2YWEA 5L39A 4GKJJ 4B9NA 2YKOA 3OHAA 1UVMA 2QC3A 1S57A 4UT4A 3DI6B 2CZVC 4RJVA 2JL9A 5AT1B 3N0VA 1FVSA 1FWPA 4DX7A 1HWLA 2OFHX 1MMLA 2XULA 2LCWA 3I87A 2ZC4A 3M32A 5KFAA 5LXRA 2HZVA 2DO4A 2RILA 2QN6B 4URSA 1U02A 4MIAA 4C3KA 3NS7B 3WZ0A 3GIMA 4M5LA 3BO3A 4C97A 4M5HA 2HBZB 3NGRA 1R6YA 3TAMB 1NSKL 4YP3A 5M2RA 1TKZB 2MZRA 3OJSA 3C16B 1UEKA 3OLAA 1V6HA 2Q43A 3C3LA 3M2VA 3Q23A 3MM6A 1QDUB 2NXCA 4NLUA 3JSMA 2AQ4A 4IG0A 1O51A 3W65A 3PX6A 2QA1A 4B3OB 1R0AB 2HGNA 4DR4J 1FKPB 3DU6A 3RRHA 2NREA 4FF4A 4RR5A 2QLFB 3ZTQA 1WDDA 2F4FA 2I9SA 4TU7A 4E0DA 3EXCX 3UCZP 1ZETA 1N5VA 3M2RA 2OTLS 3QGIA 2R8GA 1LWCB 4KQZA 3ZNUA 2UVWA 4NCBA 1JK9B 3NNHA 1RISA 2Z57B 3EZUA 3O6QA 3W5XA 4F3MA 4WWSA 3MEGB 3PHEA 4DFPA 4C8ZA 3UDLA 4QZVB 5DETA 1OMSA 2HZAA 2VODA 1BHNA 2RIJA 3ET6B 1TL4A 1GMWD 1FKAF 1B64A 4UOGA 4X64J 3EDQB 1IUJA 4KBIA 4EBEA 2GJ2A 1E6VA 1EJ7L 4EO6A 3TVKA 1S1XB 4ID8A 4RNNA 5CYMA 5KFLA 4KIAA 1XQIA 5F3TA 1VK3A 2ZC3A 5F8JA 2D1CA 3NRBA 2PGCA 4A8FA 1IN0A 3BPDA 3H5XA 1HBUB 2KH9A 2APOA 2VJUA 4ZP9A 4I2QB 2LKZA 2ROGA 3MM6B 4U8YA 1I94F 5CZVA 5EX3A 5D3GB 3CJ2A 3ETOA 4Y28C 1QVGR 4DUZF 3TP2A 5LSRA 4PQUA 2D9PA 3DOLA 1QSYA 3TNVA 2XYGB 3QLHA 4GC7A 3G71S 4Q43A 1KQGB 2HQDA 5I3UB 3HJVA 1QD1A 4NLXA 2XEXA 1NJWA 1Y0HA 3TW0A 3SV3A 5L1KA 3N5FA 3GU0A 5D15A 2Z4PA 3PW7A 4NASA 3M8QA 1XR6A 4P2SA 4TU9A 3CMAS 2B9YA 1J5EJ 1DTTA 2POKA 2YKPA 4DV7J 2ZKTA 3TZYA 1SVDA 1KD1T 1RUSA 3X3UA 4OI4A 4WP9A 1DRZA 1CPZA 1RLDA 3U7JA 2MQQA 1U1LA 1KS2A 2A0FB 1TMJA 2D3UA 3DOMB 1ZM4A 4LFBJ 5ETKA 1X5PA 4OZ0A 1X0PA 3DLEA 2CDQA 2OMOA 2Y1LB 4WBFA 4L6V3 2BX6A 1FJEB 5E33A 1AT1B 2HQGA 2B5JB 3A13A 3MMBA 2NR0A 2WSFC 1HKAA 4LF4J 2YNGB 2YWFA 3MDFA 3I4HX 4U9RA 1TK0A 5I3PA 3CIMA 3PEHA 1UW4A 2C2KB 3QYYA 4FYWB 1NKCA 4FXDA 1CG2A 4I2QA 2C3PA 1NSQA 2HIYA 5MAOA 3NBPA 5THWA 3PRBA 4ZP7A 4DN0A 2RKIB 1RWNB 4P52A 3CCES 4ZVHA 2UVUA 2JEIA 2DCLA 1LKZA 1ZPVA 1IWGA 1DBDA 3J81j 3CNQP 1UWAA 1VLYA 3N79A 5HMWA 1KNZA 3GR0A 1TL3A 2KFZA 4K4VA 1N54B 2P9CA 1KLMB 1Q16B 3FFIA 2JC1A 3MCSA 1QAIA 3T19A 2BV3A 2G2YA 3CDAA 2YKQA 2V6AA 1CS4A 2YVSA 5E3CA 1VC5A 3MF5A 2IAJB 5A8RB 3UFCX 2FLLA 1SQFA 1Q0NA 2JVRA 3MOZA 2MQNA 3MM7B 1S49A 1PCAA 2VFSA 5IQ6A 4Q5VA 3Q24A 1KOOA 2RVJA 4HLBA 4EGLA 2H5JB 3BGLA 3EGVA 4Y34A 3NS5A 1DQ8A 3HHLB 1EQMA 2VG7A 3LF0A 1KQSR 2XS7A 3KLFA 3C15B 1LWEA 3LAKA 4KR0B 3VZHA 3CPWR 4YFUA 3HVRA 1Y5IB 3H59A 4OZ5A 2HFOA 4MIWA 1XMBA 1TKXA 3M30A 3MEDA 1CVJA 1K0VA 1F1BB 4ZLJA 2M8HA 5EDWA 1YZ6A 3DLGA 4J37A 1PILA 3DDKA 2KJVA 2M5YA 4DBQA 3IRXB 1YTYA 3DM2B 3BZQA 2JHEA 3IS9A 1S1VA 1SUQB 1Z1ZA 2KHDA 4UUWA 4ILMA 3HVTA 1CULB 2NQPA 1FD2A 3MR7A 2BJEA 2O67A 1RK8A 2CQ3A 3FGVA 3UN2A 4DCJB 4ZJQA 1VI7A 5LL6d 5KT2A 1RE1B 1YJNS 1FFSB 1WNEA 4NLWA 4OJHA 4ID5B 4LSNA 3IR5B 4TN2A 4ZOSA 5C24A 2MQPA 3MR6A 5LXYA 2HMIB 4KGKA 1FVQA 4DL7A 1OSCA 2WVCA 3O1LA 4RBTA 4AQYJ 2C2DA 2DR7A 4C8YA 2UUWA 3TA1A 1KBRA 2ZJPQ 3PW5A 4LJMA 1SC6A 5FIIA 3CXCR 2WONA 2YXLA 2V9KA 4J9UE 1IQZA 3CWJA 2VD3A 2ZEJA 4UOHA 3UW1A 4EMDA 4DL2A 3OL8A 3FRZA 2MQOA 2X7IA 4I2PA 4PWUA 3LANA 1RT4A 2CQ2A 3EE3A 5LM7E 2VG7B 3LUYA 5C25A 3I55S 2VIHA 4GMKA 4ECWA 4JI6J 2XYPB 2XMJA 5KFUA 4CP5A 5F8GA 2ACMA 4F4KA 2R7VA 4ED1A 4QW8A 2DPJA 1WDTA 3GYGA 4J91A 4DS4A 4CTAA 1X8DA 3ZTSA 4MAKA 3I96A 5I4MA 4R8UA 1CJTA 1TL1A 2LEAA 4DR1F 1B7FA 4NZ7A 3CJSA 3VAJA 4ED6A 1LV5A 2GQCA 4LQ9A 3CJ0A 5K8MA 2G1DA 4IDKA 3BYRA 1M5SA 4YUDA 2HBYB 5BYSA 4DR7F 1F9HA 4IOAQ 4JV0A 2O5DA 4CO5A 2ADBA 2GCFA 4Z7CA 1S12A 3KHGA 3BSOA 4ZMMA 3TZWA 4DU8A 4I69A 1WEZA 4PABA 4CNZA 4F4AA 4ZCMA 4RNMA 2MKIA 3V6HA 1U6BA 3VWSA 1HW9A 3SBMA 3FBCA 2KM8C 4JI3J 4AL7A 4B3RJ 2ZH3A 3CDWA 1FJCA 4AXJA 4A8WA 2K7KA 3DOKB 5J2MB 4LR8A 1X4HA 1Z4UA 3W2WB 2FYXA 3CCWA 2VQEJ 1TP7A 2ABYA 2DGVA 2YQ1A 3B6BA 4KKOA 3PR5B 2J6UA 1Y11A 3UCGA 5AXMA 1WEYA 2MKHA 4ZN3A 4MFBA 4C6AA 1X9MA 2BJ1A 1XERA 2JFKA 3TQ1A 5IM0A 5DGAA 5B09A 1JLCB 3M2RB 1GT8A 2HQCA 2JDJA 1EIYB 4BWMA 3MGJA 3AT1B 3SSQA 4U7UD 1PYSB 1XJWB 2AHOB 5KFZA 3CCVS 1MU2B 1LFWA 1NPRA 1DTQB 1HFEL 3M6WA 4DFJA 3FBBA 3D1HA 1H7XA 4ZVGA 2ZJRQ 4A8MP 1KLNA 3OTOF 3DLBA 5DGBA 3CGIA 1IJEB 2VFVA 4FP9A 1YLXA 2FQQB 4O23A 4TYAA 3M1VA 5DG8A 3NGDA 3EUNA 3CJRA 1S1WA 3RR8A 4I6AA 1VQ6S 4OFZA 2PMWA 1M1GA 2IJNA 1U1NA 1UWBA 2NUUG 1PBAA 1Y9OA 4OZ3A 3R7NB 2ZVSA 2DH9A 1RTHB 2OMLA 2PT0A 2QMWA 1CC8A 1N4LA 3OL6A 4DR6F 1M0SA 4F04B 1U47A 1FRLA 3JQKA 1HBUA 1JKHB 2R8JA 1SCJB 1KFDA 1CQNA 4DOZA 4ZHRA 3AA9A 1DAXA 4Q45A 5T7LB 5CAAA 3CJQA 4M5KA 1GXTA 3JQJA 3T6JA 2FHKA 1SKWA 1VQ8S 2GGPA 3RW6A 3CO9A 1XNQJ 2HWHA 3MFIA 1W2IA 4ENOA 1RABB 5IV3A 3PJ9A 1C1CB 2ZWPA 1FE4A 4ZCIA 3GIJA 4KRWA 3NGKA 1YX2A 2VUGA 5CYQB 1KHVA 2WRMA 1N0VC 3M9OB 4OLOA 1ROFA 3VGUA 4NCAA 2V8VA 4I6WA 4B3SJ 1S6OA 4LSLA 3SDEA 4QR0A 1UPPA 1Y4ZB 1S77D 3B78A 3LGMA 4PG6A 2E1AA 4TNOA 4CLKA 2H54B 1S72S 1AB8A 4H4MA 2RB7A 3OJUA 1RTJB 2DHSA 1NRKA 2YH0A 3WC0A 1WD6A 4W92B 1RZMA 3VQSA 1XR7A 4FBTA 2L48A 2C2EA 2NYHA 2KFYA 1YSJA 1QTNB 2CJXB 5IT0A 3MCOA 2ADCA 3I0SA 1SH2A 4IG3A 3S1TA 1F0XA 1FRJA 2B4VA 1UZHA 3O2IA 1T7PA 1W25A 4ZHRB 4F0HA 1S5ZA 3UE2A 1F5BA 2H65B 3AD9C 4RW6A 4HI1A 4CH0S 3MEEA 3VAHA 2YKNA 2ZHBA 3TANA 1JX4A 1UFKA 2PO4A 1PKUA 3ZZOA 1RAFB 4YHHF 4ETXA 1RHUB 4DV2F 2QL9B 1CBKA 1TV6B 4F4YA 3HSZA 2BRKA 3HT0A 3US5A 5HQLA 4P9SA 1HHSA 1ZAXA 4ECYA 5F8IA 5MLCV 3D54A 1K47A 2A6MA 1XNRJ 2AYBA 3R5JB 1G1XA 3QRPA 3JSYA 2BVZA 3KLHB 2BE9B 2VFTA 4C0OC 2LVWA 2MMYA 2N4CA 5ETRA 4X65F 1FRHA 4N8OA 4P73A 1ACMB 2GMHA 4QBUA 1N32J 5KG2A 1IJFB 3DMJA 2MB0B 4ZJOA 1RWXB 4ZPWR 3TEGA 3HLUA 1H7WA 4NA3A 4C11B 4PEOA 3OVAA 3QFWA 2GIRA 1NBEB 3KLFB 1TKDA 1TKTA 4OX8A 4X84A 2HRTA 2HNYA 2CG8A 2KJWA 2FIUA 1MMNA 1UVNA 1IR1A 1HBMA 3J80U 3CCZA 9RUBA 3R8YA 4X62F 1IBMJ 5ITHA 2NXEA 3C14A 2XS2A 3DRRA 5HROA 2B8PA 1RAIB 4OI0A 1I3OB 4Y3CA 5BYQA 1NSPA 2JOQA 3CULA 2VICA 2BYCA 2DNMA 2BMBA 2A2DA 2V69A 2CKWA 2DHAA 3N4WA 1ZZNA 4DR2J 3QNWB 3IBFB 1YG0A 1U2FA 1S1UB 3OPKA 4IYQA 4RBVA 1RHQB 2VG5B 5KFIA 3THPA 4RNOA 2XM3A 3PR4A 2X1AA 2P6TA 4TYBA 3T1HF 3MMAA 4DG1B 3HXMA 1U1KA 1S76D 5ETSA 5KFRA 4JI1J 2NXUA 3DGPB 3KG0A 4ATNA 4DR5F 3PXGa 3P49B 3A12A 1GMVA 4DUYF 3W64A 1VS3A 1WHWA 1XWLA 1ZZFA 3BDEA 4M5IA 4UW2A 3F73A 4DUZJ 2H9ZA 5J2NB 1RAAB 1WKJA 3BSAA 2G4BA 3V6DB 3Q0AA 1SJQA 3DLJA 2QO3A 4I2PB 3Q8RB 4UZBA 5HMYA 5J1EB 1HNZJ 3D5MA 1XC9A 4BDPA 1SV5B 2DH7A 1GFWB 4N76A 3S7RA 3CO0P 4PWWA 3KK2A 2E9TA 3U27A 2W7OA 2H48B 2HVEA 1DARA 1S9GB 3EVMA 2ATLA 1JLAA 3CVKA 2HLUA 4OQJA 5F3ZA 1CLFA 3AB2B 4RPFA 1EKRA 2DHHA 3SSRA 4WFAQ 2W9CB 4J9QA 2BQUA 2FJVA 3CB4A 2W7PA 3EPIA 3TOQA 1MROA 1OY6A 3QO9A 3BBCA 3Q2SC 5DLGA 2E29A 4AQYF 4OL8A 1JLQB 2EC2A 3R6LB 5AE3A 4M95A 1H74A 1VIXA 1F9EB 3FBEA 2Q1LA 5K14B 3AY0A 1C2PA 3D67A 3KLIB 4R0JA 3RTVA 2CJQA 1E6YB 4ZPTR 1S9EB 5L9NA 4I56A 5D0EA 2W2OP 4DPTA 2KZZA 2Q79A 4ZIVA 5DQGA 4RUAA 3OFGA 2ZD1B 3M2UB 3OT9A 1IQTA 1T05A 1R0BG 4ZJLA 3K17A 3JAMU 1ZM2A 3AQPA 4KAIA 2FY8A 4XDDA 5AXKA 3W2WA 4DR4F 4DL5A 4LSZB 1ZM9A 3AB4B 2J6SA 1LWFA 2IC3B 4Y0FA 2HVHA 2CQ1A 1SB6A 3SFGA 5IV4A 1G6BA 2BQRA 3IWNC 1PAEX 2MKCA 4G65A 4KT0C 2HNZB 3KJVA 1VIOA 2B43A 1U48A 2QA4S 4DFKA 2OO4A 5B7WA 3JTPA 2W9CA 2CYYA 3M32B 3UD5A 2UZAA 1DTQA 1JQGA 3EGWB 1L3UA 2Y8WA 1DY3A 2P6SA 4FVCA 5F8MA 2G2OA 1L3TA 4PPDA 4YB5A 2DISA 2HQ3A 2RRBA 4HDGA 3VVUA 4ALZA 1T9WA 2YX4A 4J9SA 4ECRA 2D3O1 2AYGA 4B3OA 1KHWA 4H4OB 3CJKB 2DVIA 3NMAA 2MJUA 3HPOA 5H9EJ 2UUCF 1A6LA 4K2XA 2IVFB 3DRSB 2AEJA 2ALYB 3GV8B 1Q1KA 1N36F 2W4PA 3HJFA 3I0RB 4QCLA 5KOXA 3QSYB 1VQ5S 5DJBA 4DZ6A 3DU5A 2V63A 1TL7A 2M7SA 4C3LA 1YI2S 5JXSA 1WC3A 2UXDF 2B9EA 2YPZA 1T9VA 3VQTA 4RU2A 4C48A 1S1TA 3E2EA 5IT9Y 1C1BB 2E5GA 3J7Z5 1FNMA 1RU1A 4CLWA 2XCPA 2HHVA 2OJ3A 4OYMA 5BR8F 3N5BA 3OW2R 4OZJA 2CPDA 1KTVA 1B0PA 2OSQA 1BQNB 1U0HB 3LQVA 3NWRA 4LVOP 3W5ZA 5K8PA 3BREA 5F0WA 3ILJA 4EWTA 3C6TA 4JV5F 3CMQA 4Y2AA 3TJ9A 1M5PC 2FPHX 2NPFA 3WQPA 4RW7A 2DHXA 1K1QA 2OGUA 1X4CA 2BKNA 1L3VA 4MK7A 4XDCA 2OPRB 5A8WB 3H42A 1RT7A 2C3UA 3HDSA 1S0NA 4B17A 1YKWA 3PRDA 3HHLD 3RAQA 2E1CA 3GQCA 2CIMA 2UVVA 1GNKA 2PSZA 1X5OA 3IG1A 1HPZA 2B9WA 4C0BA 1P8GA 1N36J 4AL5A 3KUEA 3PW4A 3PEJA 2JJ4D 2VJVA 1IKXA 1N5YA 1KRPA 2JC0A 2ZOMA 2VA3A 2U2FA 5CA5A 4WYLA 1IBCB 2Y1IA 4G6VB 2RUGA 3LPEA 5LOQA 4DV1F 4DXLA 4EBCA 2CZ9A 1HQUB 1RAGB 5L46A 4NLYA 3AQOA 4P74A 2EFVA 4CLTA 3R2DJ 4C4WA 1F60B 1A9NB 1LW2A 4O3NA 1CJVB 2GHVC 2W25A 3JSRA 1WHYA 1T95A 3KTQA 2G0IA 2GVDB 4IR9A 1VBXA 3GYNA 3DYAB 3RAXA 2LA6A 4IRCA 2JZ5A 2YNGA 5ETTA 3D4JA 3Q8PB 3RB4A 3X1LB 2D3OR 4XIUA 1ZYQA 3KLGA 2VFUA 1C4CA 3Q8UA 1U09A 1NLKL 2BOAA 5KG4A 1S6QA 2YKMB 2JLGA 3DNCA 2H5IB 3KK1B 1HWKA 2RDDA 1VQLS 3HF5A 4NLSA 3U02A 7AT1B 2HFUA 3IR6B 4ECUA 3TARA 1WG1A 4UOFA 2E5HA 3G86A 2HNYB 3H98A 1FKOA 1QAYA 1FA0A 2R2SA 1WACA 2EWHA 4OHWA 5A8KB 4DR6J 2BOPA 2IYGA 4YN3B 1AYEA 3HZEA 2JNJA 3SCKE 3J7A1 1RWUA 2B4PA 2IAJA 3UCUP 2OLWA 1YITS 4C8KA 1PAUB 1RA7A 1T9TA 2B8QA 2HK3A 2OPPB 2XI3A 4O4GB 2W8LA 2DD8S 1S1UA 1T8EA 3FFIB 4LF2A 2M88A 2DR9A 2H3EB 2K1RB 2LU1A 3CD5A 2MKKA 3VALA 4C8LA 1JIHA 2N4DA 2GVDA 4I4BA 4LF7J 3A8KA 4HHJA 1N52B 2DGSA 1OY9A 2M9KA 3BO4A 3DGPA 4O0IA 4ELVA 1RT3B 3CCRS 1S59A 1SKUB 3BV8A 1RAJA 1DQ9A 3M30B 4V19X 3K0JA 4WFYA 1WC6A 2XB2D 4DV1J 1P27B 2L08A 2CPEA 4OHYA 4NA1A 4A8SA 5M2UA 2D69A 2LP4A 5D4OA 3RBZA 2HFVA 2V9WA 4BC7A 1RAEB 4F0MA 4K5RA 3TUJC 3IS9B 4RUBA 4G1IA 4L76A 3TA2A 4KC5A 3T6BA 3RB6A 3TUPA 1MMDA 6FD1A 2RRNA 3GJQB 5F9NA 3SQOP 2IYIA 3DLGB 1TU0B 4P2FA 1B70B 3DI6A 4W4MA 1TQLA 1RWVB 2ZBPA 3B4DA 3GILA 2PDAA 3F41A 2HIQA 4MH8A 3IN5A 3M8SA 1Q7YT 4LFAF 3KJQB 3BR9A 1U1MA 3NCPA 2DNLA 4FKXA 3THVA 3C16A 4CLFA 2KTQA 3H5YA 1XMQJ 1A0OB 2VBWA 3M2VB 2OPPA 4HR2A 4DV6J 4MK8A 3AOBA 5HATA 3RZAA 3RBDA 5SZTA 4P10A 4JI5F 2YX1A 1TAUA 1RT1B 3P4UB 2OPQB 1F6TA 5A0YB 2JEFA 3BDPA 4KH1B 4UQTA 3NOGA 4GC6A 5DLFA 2CPHA 2NXJA 3QT7A 1RWMB 1TK5A 5CD4H 3K5LA 2CPFA 3A3NB 3GYXB 5IWAJ 4G3IA 1XNQF 2F4VJ 1BC6A 5E5NA 2VQEF 2J6TA 4M5GA 2JLEA 4OI2A 3QZ8A 4ED0A 2PEHA 2EKYA 3QT6A 4OYAA 2CPZA 3N6NA 3VV2B 2IRYA 3DXBA 3RRGA 1LWFB 2IC3A 2DXFA 4IH5A 2VKZG 3CC7S 4X4QA 4ECSA 3CCJS 1I5OB 2D41A 3W63A 4V1Ak 3PV8A 1X4GA 3QT5A 4MYUA 1HI0P 2AGQA 5D0RA 3W60A 1ITPA 4M94A 2MXYA 2DITA 3M8WA 5K5MA 1NJYA 2NZ4A 3W66A 3MUMP 2KT2A 2GX8A 2EBGA 3HCXA 4OX6A 3G82B 4KSEB 4WK1A 2HVIA 3NGSA 2F8EX 1WI6A 5HAOA 4CT9A 4DR3J 5IT9U 2ZZTA 3H5UA 5HQMA 1RTDB 3QGGA 5KFQA 3KOAA 2OI2A 1WTBA 3J7ZT 2BQ3A 2XS5A 3D3BJ 3F44A 1R43A 1RCXB 1RA6A 4X66J 3ZTOA 4RWWA 2Y1RI 4TY8B 4QR1A 1GX6A 5B0GA 4B08A 2OPQA 5A0YA 4O3OA 1ZM3A 2BA9A 2ZE2A 4F36A 1LW0A 2F7VA 2FHJA 3UD3P 4X4OA 1HLWA 4AL6A 1RT5A 1J5OB 3CD0A 3F56A 4RW4A 1QSLA 5J2MA 1RYSA 2Y9HA 2GZOA 2MLZA 2RQKA 4DV5J 1B4SA 2ZH4A 4OYWA 3EJMA 6AT1B 3P96A 1Q79A 3OTEA 3HULA 3IGVA 1LK5A 2F1FA 5DO2A 4JI7F 2BKOA 5D3GA 1JLEA 2PD1A 1DTTB 2KYZA 5CD4A 2RJZA 1C1BA 2LMIA 2NSBA 3ZFVA 1Y3JA 3P45B 1ZPWX 1SJ1A 2XMWA 1V5VA 1Q8KA 2BJ7A 1SJ3P 2J9CA 1WTFA 3P5TL 3LW5C 3PFEA 3HHNB 3DOMA 3DKDA 4RW8B 5KFHA 3TO8A 2ZDOA 5ETMA 4A8YA 5KFWA 5KFKA 1VQSA 3FCWA 3L3CA 1N48A 1NAQA 3CCTA 4NPOA 5ETPA 1REVA 4L72B 3DLLQ 2WVFA 4X2BA 3KWMA 4ZVRB 3IR7B 1EQ0A 4X62J 1FT8A 3FNNA 3QIPB 4DV3J 1LXNA 2CQ4A 2ZUAA 3G2XA 1YIJS 3RB0A 2Y8YA 2YWWA 4DR1J 1HBNA 2YWGA 3NG8A 5T7LA 2BM0A 2BRLA 2CQPA 1RHJB 3FC9A 4NLQA 4ZVPB 1JXLA 3KHLA 3N9UC 2VPWB 1N5TA 1R7IA 4UTGA 4IFVB 5U47A 1BMQB 2DNZA 3L4BC 1KEKA 1NNDA 1UCNA 1TL3B 3DGVA 1IKXB 4HDHA 1Q78A 1UJ5A 2B4UA 3Q89A 4J9VA 4NI2A 1I51B 4DUYJ 1FNOA 1XR5A 2V4JA 3LP1A 4WKYA 3TQEA 4GKKJ 1NHVA 3UR3C 1IVZA 2XSJB 2VG6B 2EI5A 4OJ3A 5E41A 1LW2B 1AXQA 1DLOB 4KV8A 5CXTA 2AT1B 3N01A 4OJ1A 1DFDA 1PJ5A 1WWHA 1Y10A 3CC2S 3CUNA 2E66A 1HL6A 1YJUA 3BBBA 3BPSP 3NGTA 1NZ8A 5K8OA 3M7VA 4UY85 3EXYA 3T1AA 3TZXA 1UVJA 3OTDA 4DPUA 5EWGA 2Z8QA 2FVQA 3QT8A 2RT3A 2JH3A 3MEKA 3WX4A 2YKNB 5B08A 3KK1A 4JI1F 4IO1A 3TWZA 4QPXA 5H1SV 4FS2A 2RS8A 2R9LA 2GQ2A 1U6FA 1TV6A 4UY8T 2HSEB 4XPEA 4F2RA 2ILZA 4CH1A 3RRKA 4X4SA 4RW6B 1X0FA 4O3QA 3CW2C 3IRXA 2UUBF 3JYTB 4M8LA 1S1VB 3VF0B 2HMIA 1CULA 4Q0BA 1Y5NB 1LOUA 1Y3KA 5GAEI 2R7UA 3QWUA 2V67A 1F2HA 1MWQA 1WOOA 2BACA 4NWBA 4G1QA 4OHXA 2P2CB 3FMBA 5B0BA 2ZH8A 4ELTA 5D4PA 2W8KA 4IRKA 1TFWA 4V19J 2RQ4A 2W24A 2LXUA 4P75A 4O0NA 1MN7A 1URRA 4JI8F 4NMLA 4C11A 3BSCA 1OQ3A 3EDRB 3LPYA 1NK8A 2CRLA 2MYFA 1VC0A 4ZVFA 1S0VA 4Z7YA 4IQMA 5H9FK 3N6MA 2DB1A 2BKPA 2GVZB 3BS9A 3PX4A 1WKLA 3U1NA 3R2CJ 2DNPA 3H2UB 3BYPA 2ASLA 1LNQA 3T5LA 2J76E 2Z2LA 1RKIA 2HW3A 4ZVQB 2OIHA 2XMUA 3W9HA 4JI8J 3AODA 1R8BA 2HURA 2C28A 1VRTB 4E8UA 1M5HA 2V0NA 4PXCA 2FUG9 3ZNJ1 1FESA 2XZDB 5FLXU 3C14B 5D77A 2YNFA 3MTKA 4K7QA 3HKZD 3DRYA 2Y3YA 5DRKA 4YY3J 5KFEA 3KG1A 1W26A 3VGSA 2PE8A 1P1LA 4EBDA 4QYZJ 1L3SA 1R8CA 1RCOB 2XI2A 3NWGA 4ITSA 2HFNA 2CJAA 4KGMA 4BCAA 3T5HA 1XMQF 1VQ4S 1HIYA 4K59A 1CEZA 1B3TA 2CJBA 2IY5B 2R7SA 1QVFR 3KLEB 1BGXT 4G1QB 4LFAJ 4DPXA 1FTRA 1RP5A 2VBYA 1H98A 1APSA 4O4RA 4KFBA 4N77A 4A4JA 4JI7J 3PRVA 2E7VA 1NDPA 4AYBD 2M0GB 2EK1A 2IM1A 2G0CA 3W2VA 1NJXA 2M52A 1WUUA 1RLCL 2HS0A 2XWYA 3PYGA 4ZVOB 2AGPA 1JLCA 4C8OA 2E7XA 2N82B 4O44A 5J2NA 1S9GA 1VISA 4GKJF 3MHYA 3CJ3A 1ZA2B 4W98A 2UUCJ 2MSSA 1TELA 3KHRA 1WC5A 2BXJA 2F9DA 3ELHA 2ZH6A 3AOAA 4OYBA 2VQFJ 1BQMA 1TVRA 2HKEA 3FEZA 3HFKA 4A8QA 4KHPJ 4FYDA 1BWEA 3W8GA 2XMKA 5E3AA 4BWJA 2L3MA 2Z56B 4HTIA 5IM0B 2JEGA 1N5QA 3RW7A 3RG6A 1HWIA 2V34A 4QWBA 5K14A 1WG5A 4WFBQ 2CQGA 3KXDA 1MU2A 4BC9A 1C4AA 2OHDA 2CXEA 2DO0A 1VYAA 1RTIA 4LBIA 4WCEQ 4MMOA 4X4UA 4N8NA 5ETNA 2OUGA 5IS2A 3BQ1A 2B56A 1FDAA 3K5MA 1S1WB 2FHMA 2EG2A 2ZJQQ 2KXHA 3H90A 1PC5A 2IM2A 1U1OA 2EC0A 1IM4A 2ZNYA 1VQMS 3H2VE 4FZVA 4NLTA 4JI6F 4KYZA 3HMJG 4RW9B 4ZPBA 4J9LA 4PUOB 4KPYA 1NHKL 4K50A 3IBCB 3KG4A 3T1YJ 3Q8SB 3POTA 3WC2A 4ZVTB 3RBEA 1UZDA 5IT4A 2WCXA 1JJ4A 3HKWA 4JI0F 4C2MA 2HNZA 2GQQA 3MAAA 3MEGA 4HH1A 3CCSS 5E3RA 4K5SA 5HQ8A 1KONA 2V8PA 2BJ8A 3MM9B 3SYZA 3OXFA 3FDSA 2F8HA 3OR1A 4OJGA 4RLEA 4ZVEA 5HVGA 5D6GA 2X3DA 5DDRC 4N5SA 3KK3B 2ZH9A 1VQ9S 4FF3A 2ROPA 1MNEA 1RAOA 1PO6A 3T41A 4J90A 2QV6A 3ZZPA 1FX4A 5IXUA 5L38A 3UR0A 2CWKA 2CA9A 2PFFB 3LP2A 5IOLA 4C9DA 3PDNA 4KGZB 2B51A 4CI0B 2R4FA 3KUHA 2HGMA 3FZBA 2FGCA 3BQ0A 5D0HA 1REVB 1SL2A 2J9DA 3LP0A 3F0NA 4YQWA 3G6VA 1T94A 1NDLA 3KDOA 4DV5F 5C2CA 1MW7A 4ED2A 3AD8C 2HVZA 2V8GA 1NHUA 3DOLB 4DL6A 3MR5A 1NK0A 1S1TB 3IM8A 2GO9A 3OR2A 1Q7LB 1D3WA 1NCLA 2KU7A 3C2PA 4PUOA 4IG3B 3RU0A 4RWXA 1VGYA 3VR1A 1YVFA 1NK9A 2LQ5A 5LMNJ 4FF2A 3D6HB 4HTJA 4USUA 3L7PA 1HNXF 3MEEB 2G1HA 3BEGB 2FJWA 4MJKA 3SIPB 4J9KA 1IR2A 2DR6A 2YKAA 1HYSA 4USHA 2XLIA 2CQIA 3SFUA 4JI5J 1FK9B 1RWKB 1TAQA 4WIIA 2R8KA 4I1TA 2QL7B 5E0OA 2B3TB 3DLEB 3DMJB 3NS6A 5F8LA 3QRQA 3FEXB 1RT7B 3OD2A 4MKAA 1DZ5A 3C6TB 4IKAA 2C2RA 4U7UK 1VJWA 3DDIA 4K4XA 3KLHA 4MTPA 2A6OA 2VFRA 5GADU 4B3TJ 2XG8A 2GIQA 2I2YA 3R1LA 1HNVA 3MM8B 3T9NA 4Q7AA 1B7YB 1Q5YA 2ZH5A 2QT7A 5A2QY 2ZH2A 1R8PA 1Y5LB 3H8YA 2J8SA 2DGWA 2RU9A 2CQBA 2V2VA 3FQKA 4PXDA 1UVKA 4RUCA 5HMXA 4LF4F 3ILOA 4K4TA 1U0SA 1KFSA 1ZAWA 3LALA 5C42B 2ZM6J 4TQSA 4XTTA 4CIOA 3KLVA 2AKWB 4LRFA 2R7OA 1R3NA 2C2OB 5CZXA 5HMZA 2C42A 2AD9A 4DV6F 4NMXA 1U49A 3B8HA 4ECQA 1CS4B 1DQAA 3W7BA 2XCAA 1N8RT 1K44A 3ZZZA 2PI4A 4DWIA 3MAHA 5KFXA 1FEEA 2RSQA 2DY9A 2IM3A 3PYEA 1T02A 4ANDA 5AE2A 2FY1A 4YHHJ 2DRDA 4CT8A 2W01A 5H9FJ 2CPJA 5DZ6A 3DLKB 3OQ2A 4BS2A 3MECA 4YR2A 3ZZ0A 1ZBTA 3C15A 2W2QP 5E2QA 5KFBA 5C7PA 3TAPA 4MKVA 1KP6A 4UZCA 4QIFA 2KFNA 4U95A 3QAEA 2PMZD 4JOUA 5KFOA 3H2LA 2UVRA 5HK4A 3ISND 2MPUA 1D8ZA 3ILIA 2HWIA 3NCRA 5HANA 4A48A 3ULHA 2DEJA 2QIFA 2LQ8A 4EYIB 1VQNS 2C1EB 1Y7PA 1FJ7A 4I64A 1UTAA 5J2PA 2K06A 3U1MA 2KG1A 2QRRA 4HEA9 4CO1A 1CQMA 1GX5A 1WEXA 3KDNA 3SI8A 3BR8A 4QWAA 2W2PP 1KTQA 2QG9B 4YY3F 2XMTA 2XSFA 3AA8A 4DR2F 1QSSA 4LFBF 1S9EA 2LDYA 3R5AA 4EK2A 2W9BB 3H25A 2E7WA 1F3VA 1MWYA 3QPIA 3U1LA 2BR0A 3QRRA 2DJWA 1B99A 1VRUB 1BLUA 2HHPA 1K0TA 4WXWA 1PGZA 2ZVIA 3SQGA 5KT3A 1JLQA 1U8SA 4U6PA 1T05B 3BN4A 1JWWA 4IG0B 4C8MA 2WK4A 2Q66A 1K8AT 2H4WB 2MEWA 1HNXJ 1LFPA 2IVYA 5CCMA 8AT1B 1PSDA 4FNIA 1P9QC 1WJ9A 1HA1A 3MZIA 7FDRA 5FLXY 2HQIA 5DS7A 2HNDB 3IA0A 1H73A 2OAUA 2LQJA 1RACB 2DCUB 3D6FB 4LF1A 2C3MA 4U7CA 2XTJP 5J2QB 4X4VA 2V50A 1IKWB 4GO7X 2QMXA 4E98A 5HO4A 3AJ1A 3V6JA 2WHOA 1OPIA 1YK9A 2VDHA 4Y6IA 2JSXA 1OO0B 4JYAJ 2K7JA 4EZ6A 3OFHA 4DF8A 1H38A 3W3SA 1GXLA 5HP1B 2PN6A 3D0IE 1U4BA 3GCWP 1S0MA 2I0XA 1OS5A 1SIWB 2VOOA 2NLWA 3RB3A 2IRUA 3D1OA 1XMOJ 4NXMJ 3D1QA 5HBMA 3A8EA 5BXIA 3QAUA 2JWNA 3BSNA 4YDXA 3Q2TC 1J2VA 4YB7A 2GJIA 5KT4A 3B82A 2DTJA 2KL8A 2YBVA 4FXVA 4F02A 3FCVA 2VONA 1RTIB 2MY8A 2YY3A 5EHHA 5L1JA 4FBUA 8RUCA 2EFNA 2PA3A 3L95X 3GV7B 4DSIA 4LF8J 4IFYA 2ZHOA 4B3MJ 5HN0A 2CADA 2CNLB 4GVBB 1H2VZ 1S6PB 4KKOB 1DJ0A 1Z2LA 1JLFA 2ZOFA 3OXLA 2CPIA 2C2NA 3I5AA 2G2ZA 4LBHA 3M9MB 1FF2A 2DH8A 2CUYA 1K1SA 4TKTA 1ZS6A 3LGNA 3IBWA 3THTA 4CM0A 4DI6A 4J9OA 3PJXA 1BWVA 2NYIA 1EX8A 2MHEA 4DSJA 4R5PA 4GVLA 2W7AA 4HVZA 5GAEU 4DQRA 1VQOS 3O3LA 4B3MF 1T9XA 2B7BB 2MZTA 4LT6A 1WC0A 3SZ2A 1HHQA 2HHSA 2KI2A 1VFJA 3TYTA 3UD4P 3E8OA 1F2GA 4RW7B 2DNYA 1FERA 1RTDA 1SXLA 2BE2B 3RBXA 3MR3A 1YJWS 3E01A 1X9WA 5A8WA 2DR5A 2X1GA 2KHCA 1XNRF 5KFDA 2IIHA 4QWDA 1Q81T 2D74B 4P2XA 1IKVA 2ZH1A 1T0TV 4N7TA 1RTHA 4EEYA 4ELUA 1X4AA 1PBUA 1RT5B 2AIRB 3ILLA 5C5JA 4P2MA 2UXDJ 3LOUA 1NJIT 1SQGA 3DN9A 1YBTA 1MSWD 1UFWA 4PXEA 2X1FA 4FVMA 1TTHB 2F65A 5CH7B 9ATCB 1UL3A 3IC1A 1J5OA 1NB2A 2Y0BB 2XMAA 3KNAA 1KVJA 2JVOA 2IMOA 2JRSA 3GZ7A 4ZLLA 4L74A 1C1CA 3K2YA 4RBUA 1Q8LA 1ZOTA 3MWBA 4ED4A 3CC4S 5EN1A 5KG3A 4DL0C 3N28A 1KOHA 3GG1A 4R5PB 2G13A 1I6JA 1AFJA 1HI1A 1WC1A 3K89A 3LAMA 2ZFHA 3R3TA 5KFPA 1GEHA 3E51A 3NOCA 3QQCD 4QU6A 1MG7A 3G87A 2DNKA 4TLRA 1WHVA 3UI3A 2HFSA 3VZIA 4JI2F 4ZIWA 3GFHA 5BR8J 1V5IB 2KVQE 2VKRA 1HYSB 3CT9A 3O44A 3QSIA 1FK9A 5JVHQ 2RD5C 2LYVA 2BE2A 1RT6A 2XNQA 3OV7A 4JV5J 2VV5A 5HVHA 3C46A 2XY6A 1HNWF 3JTOA 3A1YG 2DR8A 2GIFA 3GJSB 4IR1A 1IKVB 1IKYA 1JXVA 2HLTA 5AJ3J 2YH1A 1NMEB 3CE8A 1L3KA 2NZCA 2Y0SD 4ZP6A 1SC3B 3GG0A 1IXKA 4MT1A 4OHZA 3CMES 3QBCA 5KFNA 1SH3A 4OI3A 1HBNB 3EX7B 1GH8A 4NI2B 4K4WA 4QIGA 1X4BA 2RF2B 2ROEA 1N88A 3FSYA 4B3RF 4FS1A 4OZLA 1VJQA 3NLCA 3VAFA 2DNQA 2EFPA 2V4JB 3LP1B 1C0TA 1U45A 5E3PA 5ADZA 4RNHA 2HHHJ 3SEOA 3SCJE 2AEFA 3AHPA 5D78A 4ZA1A 3WDOA 3WX8A 1HHTP 4HI2A 3M8QB 3FSIA 4JV2A 4OZ1A 2DNOA 1RB0A 3B4MA 4XAKA 2KO1A 1HWUA 5ETLA 2J0QD 2FLOA 4FPRA 1T9UA 3MXHP 2K2PA 3QGHA 2A2CA 4USMA 2VB6A 2MTLA 4O4GA 4YB1P 2QE5A 2E9RX 1RT3A 1X4EA 3GCXP 1EP4A 1C0UB 5DDQC 1LEOA 5BYRA 1UEVA 5E7OB 1WF1A 4F7VA 2L9WA 4WFXA 4NX9A 3PO5A 3MPUB 2QLWA 2AJQA 4FYVB 3Q8VA 5HI7A 1KWMA 1X4DA 4CWBA 5A2QU 5T41A 2DGXA 2UP1A 4CYUB 4PWDA 3I31A 4CTAB 2WOMA 3MAQA 2QA4G 3V6KA 3VGTA 2FVRA 1O5JA 2BUNA 4YS2A 1VK8A 2J7WA 4K4YA 5D0GA 3NBPB 3BGRB 3IO1A 1TFYA 4I6YA 4ED5A 2WVDA 1VHIA 5IC6B 1UPMB 2RF2A 3ZXWA 3JYTA 3D28A 3PY8A 1FJGF 2I1RA 1RHMB 2GO8A 3D0HE 1C0TB 3M05A 1XEZA 2GHWA 3JAMY 1TUVA 1IR0A 4Y2MA 1WSRA 1KSPA 4IQXA 3K7RA 4FXWA 4I0WA 2CWXA 1RSCA 1R31A 1BD6A 2WW4A 4QR2A 3ZTPA 2UV8G 1FX2A 3FRYA 2WZ1A 3SCLE 1YHQS 1VRUA 5F8HA 4B9LA 2FHOB 2MKJA 4DL3A 3DLHA 4B9TA 4JI4J 2F9JA 5A6WA 5BJRA 2J0SD 2A1BA 2AX1A 2MLYA 3BH7B 2LXFA 4NYZA 1CJKA 2B0GA 3FSXA 3MURP 1VR6A 2XYHB 1AUDA 3SMZA 1YRUA 2LQ9A 1UA0A 2M8DB 2LA4A 1OPZA 1VHFA 4I7FB 1NB7A 1RWOB 4ZPCA 3FZ2A 2LU2A 1UMJA 3TX0A 1TUWA 5HL7Q 3VGVA 2RDJA 2M4MA 1YJ9S 1HBOB 3AD7C 1L5UA 3GPAA 4KHPF 1VRTA 4TVAB 3D9BA 4ED7A 2IDLA 1RGVA 3OL7A 2RQCA 3GB0A 1EAYC 4CLYA 2EPIA 3CIZA 3M1VB 4OIXA 4DPOA 1BE4A 2GAGC 4YMEA 1V3ZA 5GADI 4PR6A 4EZ9A 3FJ2A 3EWGA 1YRXA 2VC1A 4DQQA 4XK8C 1GXUA 3TI0A 2FZCB 1UWBB 2B9XA 2BJ3A 2CG4A 1ELOA 2KRRA 3G82A 4UF4A 3ZZUA 2XGQA 5L1LA 1TKZA 4F4XA 4DF4A 3OSPA 2A18A 3R7BB 5KT5A 1G3OA 3R5DA 5IFMA 2WONB 3UN3A 4HL9A 1AROP 3FK4A 2AJ2A 4RO0A 2OEKA 4CH7A 2CPYA 3QWPA 4USIA 5J1PA 1GAOA 3G6ES 4DS5A 1RKJA 1AW0A 4X4PA 1FKPA 1HWJA 1RBLA 3I82A 2ZHAA 4L3NA 2DPIA 1LK7A 1BQMB 2DEIA 3NNCA 1FO1A 1D9AA 3PW0A 3ISNC 4Y2IA 4R0EA 3QJJA 4MKYA 3DXSX 1G4CA 1R27B 2P9GA 2I38A 1VQKS 1FXDA 1EETB 3UN5A 3TRGA 2NUHA 4AT1B 3KMSA 2WSEC 3HVAA 1T03B 3NCQA 1FE0A 2BANA 2AYMA 4A8KA 4FYXB 1SI9A 1NK5A 1REGX 3Q22A 3HD1A 3TZZA 1CJUB 2HRUA 3W61A 2HS3A 3KJNB 3QIPA 2O01C 3PCOB 4RW8A 3DCAA 2GFFA 1BUXA 1NDCA 5HVFA 3GTYX 5HJXA 2OKQA 1EZZB 4C98A 4DX6A 5LT5A 1NPPA 2VA2A 1BQXA 1S7IA 2HEKA 4F2SA 4NXMF 2OTJS 5D8HB 3PFOA 4DV2J 1KC8T 2MKSA 2HHHF 1Q95G 2R8IA 1S4FA 2UU9F 2M2BA 4ZVSB 3NAHA 1Q53A 1KKHA 4RNFA 2DRBA 4Z2XA 1VBKA 3W9IA 1F5AA 1RJJA 1U6ZA 1HNIB 1H0HB 2DNNA 1KVKA 2QLXA 2VL1A 1WHXA 4FNHA 4S0MA 1W2BR 4K4SA 2ZBQA 3BKTA 3POTB 4KB7A 1EB0A 1TL5A 3QMQA 2V2QA 3NKYA 4PYDA 3R7SB 3UVJB 4B9VA 2Z2YB 1S79A 3B54A 2X1BA 3CCLS 5SUHA 2FGOA 2RU3A 3M8PB 2UUBJ 3KFWX 4NLRA 4CO3A 3VAIA 2F5GA 1ICEB 2XSJA 2OPRA 4NRUA 3EZ5A 4ZCKA 2D9OA 3G4SS 4KJIA 2E44A 3C6UB 2FLPA 1YWXA 4ECVA 4CLZA 1XBWA 1XK8A 3HHLC 4JV1A 1I1GA 3MR2A 1UKUA 2WBMA 1VC6A 2V8DA 4HHHA 5B0AA 4IRDA 2RUSA 1FRKA 2ZOGA 3M8ZA 4M5MA 2HRYA 2DNRA 2RQMA 3IXQA 3PG9A 1N6QB 1H2UX 2FJDB 3DRRB 4DEZA 5HROB 4NA2A 5HLFA 2KVIA 3D7SB 5KFJA 2ZWOA 1QUVA 5JUMA 2QEXS 2Z30B 3FMWA 3ONQA 4BLGA 3EYZA 3V81B 1MN9A 1PIEA 3GIIA 3K5PA 4ES3A 1VCTA 3G8TA 4M5DA 2VG5A 2EW9A 4LF7F 4USKA 2DXEA 2P9EA 4NCGB 4OZNA 5LSLA 4ER8A 2R42A 4X4NA 2COLA 2ZDPA 3EM1A 3DYAA 2W9AA 2FVSA 4D3GA 4A46A 3QIDA 3NL0A 1RADB 1DURA 2Z58B 5GMEA 3QJLA 4FYYB 3H4BA 2AMCB 4MKBA 5L1IA 1HMVA 1P1TA 2YKMA 3LH2S 4UOCA 4EFAC 2FZGB 4DQPA 2QJ3A 3V6DA 7FD1A 2GHPA 4IUFA 4ES1A 2AWZA 2J0XA 8ATCB 3KHHA 5DQHA 1UA1A 1SV5A 2QSFA 3AJDA 1NSAA 2WVEA 4M1KA 3MOJB 1FFWB 3DC2A 5IWAF 4ANEA 3MM5A 2EVZA 4FDFA 3A8JA 1NK7A 1VRQC 2IHR1 3HI9A 3PYFA 5EUHA 3S8SA 2GVZA 4FN5A 3T5JA 1N6QA 1LXJA 2IVMA 4XO0A 4NEZA 4J9NA 4EI2A 4F4WA 2MQMA 2FVPA 1U1PA 2ZUGA 3HZGA 1PYTA 4XPCA 4LIWA 1SUQA 5C42A 2K3IA 2IBOA 3H20A 3HVTB 2BM1A 2MJNA 3EICA 3UPFA 1QUPA 4N41A 4USWA 3ZTRA 3I32A 1VBZA 5KOWA 2YQ3A 5DG7A 5KFVA 2K1RA 1V3RA 4M5JA 5M2PA 2D7SA 4LFCJ 3V4IA 4ZLPA 1VLOA 4NE9C 3NMRA 2LECA 4NXNJ 1SBRA 3W2VB 1WKKA 1HMVB 3W8PA 5GAHU 2J9EA 2E5JA 5GAHI 1D9DA 4HT7A 3TJ8A 2R2UA 4H54A 2N7YA 3DDNA 4WZMA 5AXNA 4WTOB 2VBXA 1RT4B 3NAIA 3PTWA 2GV1A 4H4KC 3MMJA 4R25A 3EMTA 1TKTB 3I5BA 4DPYA 3W1YC 4ZLNA 2R7RA 3JSBA 4G1PA 2CJYB 3H5SA 3RYLA 1RQ0A 2J0WA 2EK6A 1HBMB 2P8IA 3PYDA 1RTZA 3D3CJ 4X4RA 1BXNA 3ITHA 1CJTB 1TL1B 2UUAF 1JLBA 4IH7A 1X60A 2E1MC 2VZ9A 3R5GA 1ZAVA 4DR3F 3GFZA 3BF4A 2W9BA 2XY7A 3TR5A 3UDCA 3K58A 3BGFA 2BDPA 3UNYA 2ATCB 4KHRA 5K8NA 2BBEA 3FKBA 3I9ZA 3VAMA 1GMUA 4WPAA 2F40A 1JLGA 2VASA 4H4OA 3CJKA 3BB5A 3BGUA 2HHQA 1WF2A 1UVLA 3AJ2A 3CD6S 1CC7A 1WG4A 4CDIA 3PHTA 4DQIA 3CCQS 5G0RB 2J5AA 4QOTA 4TY9A 3K5OA 1CSJA 4I67A 1SPBP 4PZVA 5LMNF 2OH2A 1FJGJ 3BGOP 3H4DA 1HQEB 4LF9F 1IKWA 1TL7B 4LRBA 1FNXH 1AA1B 5EWEA 4RX6A 2KT5A 5KG1A 4JI4F 2KG0A 2RDIA 3M4XA 4ZITA 1K73T 2C22A 4ZKAA 3MM9A 2QFJA 2EEYA 2NXNA 1IBLF 1XIQA 4AD6A 3KK3A 2NCKL 3O8WA 1EKSA 2ZBRA 2J7UA 4DCPB 3OUYB 3M8YA 5HBMB 5LMUF 2HYIB 2XQCA 1B0VA 4PG8A 2EKNA 3TAMA 1M5VC 1WF0A 5FD1A 3LP2B 4E2FB 1N0UA 1RAHB 2XMMA 2F3JA 3ENAA 3OR1B 5B0CA 5KG7A 5GAGI 4HYKA 1N56A 5FDLA 4KH0B 4OYOA 2M70A 5KG6A 4PPZA 2A10A 1U26A 2PIIA 3KLIA 3MPVA 4GO5X 1R0AA 3G8SA 1LW0B 3KKFA 2LFVA 4TXSA 3Q83A 1MWZA 3LGHA 3J7YU 3CCMS 3PX0A 2ZD1A 3M2UA 2XBPA 2Z2ZA 1F9FA 3W9JA 3G96A 2VHGA 1AFIA 2EFQA 4ANCA 1HQEA 2N3LA 2DHGA 2ZKUA 3V4MA 2I8EA 5A76A 4X4TA 1JLEB 4YB6A 4PG7A 1SIZA 3C19A 3TEHB 3UNGC 4NRTA 4CO2A 1HQUA 3BH6B 1RDRA 1HNIA 5LJ5Y 4YR0A 4EYHB 4KPCA 4YDDB 4LF8F 2ASJA 5ETVA 2OEMA 4QIEA 1CJVA 1HD0A 2Q6CA 1NKEA 1PG5B 3EZOA 4M63A 4RL1A 4AFFA 5KFSA 2HBRB 1SKSA 2AJ1A 4N56A 1RYRA 4CRJA 1YDLA 5CABA 3M8PA 2MZ1A 4LF6J 2Q6BA 3TJAA 1T9YA 3KLGB 3D68A 1HNVB 3MM8A 1S10A 5FDLB 1RI7A 3TVZA 2DNHA 2HZCA 4NZ0A 1UEUA 3P5BP 4QJVA 4Q8FA 3FUYA 5DDPC 3I5CA 3IAM9 2H4YB 5GVQA 4PYAA 2CQHA 2Y1JA 1Q82T 1TZ0A 2IMWP 2AJ0A 1B0TA 4KE5A 2GMLA 1GTEA 1FRXA 2LXIA 3CDBA 4J5OA 3WIVA 1FFGB 3QZ7A 1X7VA 3GV5B 2VC0A 1T3NA 4LR7A 2W2NP 2L9NA 3HSJA 3ENWA 4ICLB 2JFDA 4I68A 1RWWB 4RU9A 4LIRA 3Q8QB 3FVYA 3ISZA 2CNOB 3DHXA 3ZZYA 2VDIA 1TR0A 4USJC 2BABA 4QYZK 3MMCB 2FJAB 2W4CA 3FBFA 4CLPA 5I3UA 2ALZA 5CQGA 3CJ4A 4CO0A 1RU2A 3OTOJ 4IO9Q 3GIRA 3TAQA 3KMQA 3GP9A 4P72A 4QPTA 5G4DA 4LFCF 2DGOA 1NK4A 1Z2ZA 4F25A 2KT3A 2R3VA 4ILLA 2AU0A 4OX7A 1PYOB 4WU2A 3CD7A 1H6KX 2XWXA 1TUGB 4J7CA 5D4LA 3RJMB 2RS2A 2CJKA 4WFNQ 2ASDA 1QAJA 4JYAF 2HBQB 2VH7A 4DV4J 3FQLA 1WSVA 1U25A 4LQ3A 4DUTA 3K59A 1KR4A 2X51A 3DLKA 4U96A 4NZ6A 4Y00A 2FJBB 2YNHB 3E3XA 3EGZA 4MYTA 2RKIA 1Q86T 4DPWA 2R8HA 4WK3A 1FWKA 4WJBA 3GMGA 2QA2A 1O6XA 4KO0B 3TX8A 3W5YA 4LRCA 1U24A 2HS4A 3HX9A 3L9ZA 5CCLA 5KFTA 1X9SA 2GJFA 5AE1A 1N5YB 5HJYA 1H3DA 1G2EA 1RXOB 1JB0C 2AZ1A 3K8VA 4M5NA 1BY9A 1SL1A 2AEMA 2VBZA 3CTRA 3GR1A 2XGPA 2UUAJ 2ZITA 3BKUA 3OHBA 3BN7A 3CDEA 3PO4A 5B0FA 5I42B 1QAXA 2C2MB 1VQ7S 1N34F 4KGVB 4KGXB 1IM6A 3T5KA 4DR7J 2AYEA 2MDAA 4A8OA 1DHMA 4B9UA 1FWLA 1YZ7A 3GJTB 2CNKB 2ZH7A 1RT2B 1URNA 4AUKA 1RT1A 3H0PA 4FF1A 3HSGA 3O5TB 2RAQA 1NU4A 1ULRA 1UP1A 1Q8IA 3HHLA 4ZPDA 1YJTA 4DL4A 1XMOF 3QFHA 1SJ4P 4B02A 4K0KJ 2PEBA 3MM7A 1SJRA 1IBKF 3UWTA 3HFZB 2IDEA 3M6VA 1C0UA 2J7KA 1IBLJ 2VQFF 1FTCA 3MUTP 5DDOC 1ZA1B 1T3OA 1RWPB 2EBEA 2E1RA 3UDEA 1HNZF 2M3DA 4EO8A 2XY5A 4TLQA 4PG5A 2E5IA 3Q86A 4Z37A 1FCAA 2FJEB 2NPIA 3TA0A 4URGA 3OL9A 2JEJA 2HNDA 3FCHA 2KKHA 2DXDA 5KFMA 5HP1A 2XMVA 4CYUA 2LEBA 1NK6A 4WTYA 2IRXA 3GFXA 1UJ4A 2ZZNA 2XZWA 3PIPQ 4DV0J 2YNFB 1YJ7A 4PRFA 1VOMA 4NLOA 1YBUA 4B3TF 4LBPA 2FDNA 3D2WA 2FJXA 3IAS9 2QMUB 5F41A 2PI5A 3R5CA 2MKYA 4ZPAA 1MROB 3MPWA 3NGUA 4DJBA 4J9RA 2MQ8A 3FEYB 4LRAA 1QTMA 2WW8A 3C66A 3IRWP 1N33J 4DSLA 1KDNA 2AP6A 3CCUS 4IFYB 4TY8A 4Q44A 2KYXA 3T3FA 2RNEA 4O3SA 4PG4A 4GKKF 1S6PA 2V5HG 1E6YA 1JLFB 4PKDB 1FDDA 3A4TA 1CJKB 3WBZA 4NLGA 2YWHA 2DRAA 1H2TZ 2WB1D 4EU0A 4JP8A 1WI8A 2CDRB 4DSFA 4O44B 2L41A 3D66A 2EFGA 4F4ZA 4DLGA 4I7FA 4LF9J 4GVBA 3WIUA 2AZ3A 2WSCC 1G7CB 2G9OA 2IFXA 3A8IA 3OVBA 4A47A 1TVRB 3MTJA 5HSPA 3LTOA 5KTQA 3CJ5A 1ZH5A 1JJCB 1JXEA 2MZQA 2YNIB 4IDKB 1N32F 2HHTA 1QJHA 1U8WA 2AJFE 3ET6A 4PAAA 3BJYA 2JX2A 4LF5F 1LWCA 4O3RA 1SH0A 3HHKA 1S99A 4R8UB 1RBOB 1O8BA 1SC1B 4JUZA 1KN6A 1P9YA 4JB8B 2V68A 4A8XA 1HBOA 2IBKA 1S1XA 3KYLA 1UETA 2EXUA 4ERDA 2LDIA 3JXOA 2MZSA 4QIVA 3G8QA 4P7TA 3AXMA 2R7XA 3ADAC 2QL5B 1YBAA 3MI7X 2DY1A 4PQAA 3MFHA 2UXCF 2HHXA 4CCHA 2BW7A 1UVIA 5L8RC 2GA7A 4C8NA 3K8WA 3R97A 1D09B 1E6VB 2CFXA 1VDHA 1SC4B 2CQCA 2QGFB 3HVWA 5CYMB 4GRSA 3CF5Q 4MIBA 4RW9A 2IPOB 3CJ8A 4WE1A 1ZTWA 4LVNP 2KDOA 3QLHB 3DOKA 3R27A 4ZK7M 4HKQA 2W2MP 2O66A 2UXBF 4F67A 1P6TA 1NZAA 2CQDA 2KZMA 3K5NA 5JJBA 4DCOB 3PKMA 2VPZB 3D0GE 4DX5A 4DV3F 2HFZA 2GW8A 5KFGA 4C3MA 2E5LJ 4DR5J 1JNRB 2B7CB 2FB0A 3CDUA 5I3QA 3TUZC 2ZBCA 4ED3A 2QLBB 2QX0A 2YNIA 1S9FA 4N47A 4W90B 3CEDA 4Q2LA 4JI2J 4K4ZA 1DLOA 1GQEA 4KV8B 3ZO7A 1RT6B 2KRBA 4K8RA 1BQNA 1U0HA 4F3OA 2OPSB 2MZJA 2VPXB 1TK8A 2AW0A 4HT5A 2ZNZA 3HHEA 3OSNA 2FHJD 4NLPA 1T03A 5EX0A 5F0UA 3BKFA 2QFIA 2AJ4A 4ETZA 2ERRA 3OLBA 2J9DE 4Y65A 4USVA 2Q3PA 3IWLA 1OSDA 1FI4A 2HAIA 3J7YI 4QYRA 3T1YF 1X5TA 1RHRB 3UQSA 2CQ0A 2E1PA 2HGLA 2VU5A 5LJ3Y 1NPKA 5J1NA 1IKYB 3OR2B 4WE1B 1ZTTA 2EG1A 2Z0GA 4RW4B 3LWMA 1JKHA 1HPZB 2R2TA 2HPUA 2QYGA 3R9LA 5EGYA 1H72C 2XZTB 3QJPA 4L75A 4ICLA 3OBIA 1M1HA 4C7QA 5ETQA 1D1UA 4X65J 1T11A 2XHWA 3RUBL 3J81Y 3SDEB 2ILYA 4LSLB 4OV1A 3SCIE 5A8RA 1R89A 5DG9A 5KT6A 1HNWJ 2RE1A 2L9DA 3EVOA 4H4MB 3R1HA 1FHTA 3I9V9 3PKYA 3RGIA 4OZ2A 1KLMA 1R6VA 2R7QA 5F8NA 4WYWA 5RUBA 1YRTA 2OPSA 1R0CB 1QE1A 4B3SF 4P71A 2NS1B 3MD3A 2U1AA 3GIKA 2DBBA 3HSDA 4RKUC 2CNNB 2B6AB 2YWKA 2DT9A 3I56S 1RTJA 2WBRA 3NY0A 4ECXA 4WKRA 3J81U 1EHWA 4ES2A 3C6UA 1HD1A 2WOMB 1M90T 2E5LF 4DSEA 2OP5A 1KQKA 2RMLA 2SXLA 4QQBA 5H9EK 3BGRA 3BM7A 1IBMF 2YNHA 3DFEA 4LR9A 2OSRA 3JQMA 2PFDA 4BBYA 3JTNA 3RAMA 1FDBA 4H4KA 4IFVA 3M6UA 4KO0A 2IJRA 2O3DA 2RHSB 1HI8A 3H7HB 3IMQJ 3OTCA 1VQYA 1FRIA 2I5JA 1S0OA 1FKOB 2DGQA 3EPGA 3DRPA 4IH6A 1S97A 1U2CA 1N33F 3C8YA 4ZVUB 3MCNA 5KFYA 2W1BA 2MHNA 2F63A 2BZ2A 4Y2KA 5A8KA 1F3FA 5DQIA 3DM2A 2XO6A 4DU7A 3MD1A 3VHQA 4Q0BB 4ECZA 3GONA 1A7GE 3ZZTA 3S01A 2PA8D 4ZS6A 4F26A 2GMJA 2AGOA 2H51B 2MGZB 1S4EA 1J5EF 1R8AA 2LEPA 1UAWA 1W7WA 5B0DA 3PM9A 1NDKA 1QE1B 2RH3A 4MK9A 3UO0A 2KXNB 4LF6F 4WF9Q 1F5CA 2B6AA 4WIQA 4CZCA 1FDNA 4F50A 1UJ6A 2B4OA 4DMZA 3L09A 3AAWB 3GE9A 3W62A 3PACA 2QZ8A 2QSWA 1IBKJ 5JVGQ 3OFEA 2N3OA 5J2PB 4B9MA 3GJRB 4C0HA 3VAKA 1HW8A 1V3SA 3M9NB 2HQFA 5IZHA 2O1PA 1Q5VA 4WU3A 3I4PA 4B9SA 4X64F 2PC6A 3DRPB 1HARA 3KNGA 4F0KA 4DV4F 1VBYA 2RHQB 2YX7A 4WP3A 1NJZA 1U7LA 3JS9A 3V4IB 5K9FA 4CLSA 1YJRA 4KTQA 1D0EA 1SQEA 1S7HA 4U67Q 2PMHA 4CM2A 3NP5A 1VMBA
chains in the Genus database with same CATH topology
3JAMU 4JI2J 4LFAJ 4OX9J 4DR6J 4JI7J 2UUAJ 4AQYJ 2ZM6J 4DR7J 1I94J 4DV3J 4X62J 4X64J 4JI4J 2UUCJ 4DR1J 5LM7E 2UU9J 4K0KJ 2VQFJ 4LF7J 4KHPJ 2UXCJ 4JI6J 2UXDJ 4LF6J 4YHHJ 1IBLJ 1N34J 4DV1J 5LMUJ 1XNRJ 4X65J 4DUYJ 4LF5J 4GKKJ 4JI0J 1HNWJ 1N32J 4DV0J 1J5EJ 4DV7J 4KYZA 1HR0J 4JI3J 4B3RJ 1XMQJ 2KVQE 3T1YJ 4DV6J 3J81U 2MQ8A 3T1HJ 3J80U 1N33J 1IBMJ 4JV5J 2VQEJ 4NEZA 3J7AN 5AJ3J 4LF4J 4DR2J 4KY3A 3IMQJ 5IWAJ 4LF9J 2MEWA 1HNXJ 4LFBJ 4LFCJ 4JI1J 2HHHJ 4NXNJ 4V1Ak 1N36J 4GKJJ 4DUZJ 4RJVA 2UXBJ 4JYAJ 1HNZJ 4DR3J 5IT9U 4DV2J 4PWWA 3W1YC 2MTLA 3OTOJ 3R2DJ 1XMOJ 3D3BJ 4NXMJ 3D3CJ 5LMNJ 4X66J 3R2CJ 1IBKJ 2KL8A 5A2QU 4JI8J 1XNQJ 4JI5J 4DV4J 4DV5J 5FLXU 4LF8J 4B3MJ 4YY3J 4DR4J 2E5LJ 4DR5J 4B3SJ 4B3TJ 2UUBJ 4HHUA 4NEYA 5BR8J 1FJGJ 2F4VJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM U;  4JI2 J;  4LFA J;  4OX9 J;  4DR6 J;  4JI7 J;  2UUA J;  4AQY J;  2ZM6 J;  4DR7 J;  1I94 J;  4DV3 J;  4X62 J;  4X64 J;  4JI4 J;  2UUC J;  4DR1 J;  5LM7 E;  2UU9 J;  4K0K J;  2VQF J;  4LF7 J;  4KHP J;  2UXC J;  4JI6 J;  2UXD J;  4LF6 J;  4YHH J;  1IBL J;  1N34 J;  4DV1 J;  5LMU J;  1XNR J;  4X65 J;  4DUY J;  4LF5 J;  4GKK J;  4JI0 J;  1HNW J;  1N32 J;  4DV0 J;  1J5E J;  4DV7 J;  4KYZ A;  1HR0 J;  4JI3 J;  4B3R J;  1XMQ J;  2KVQ E;  3T1Y J;  4DV6 J;  3J81 U;  2MQ8 A;  3T1H J;  3J80 U;  1N33 J;  1IBM J;  4JV5 J;  2VQE J;  4NEZ A;  3J7A N;  5AJ3 J;  4LF4 J;  4DR2 J;  4KY3 A;  3IMQ J;  5IWA J;  4LF9 J;  2MEW A;  1HNX J;  4LFB J;  4LFC J;  4JI1 J;  2HHH J;  4NXN J;  4V1A k;  1N36 J;  4GKJ J;  4DUZ J;  4RJV A;  2UXB J;  4JYA J;  1HNZ J;  4DR3 J;  5IT9 U;  4DV2 J;  4PWW A;  3W1Y C;  2MTL A;  3OTO J;  3R2D J;  1XMO J;  3D3B J;  4NXM J;  3D3C J;  5LMN J;  4X66 J;  3R2C J;  1IBK J;  2KL8 A;  5A2Q U;  4JI8 J;  1XNQ J;  4JI5 J;  4DV4 J;  4DV5 J;  5FLX U;  4LF8 J;  4B3M J;  4YY3 J;  4DR4 J;  2E5L J;  4DR5 J;  4B3S J;  4B3T J;  2UUB J;  4HHU A;  4NEY A;  5BR8 J;  1FJG J;  2F4V J; 
#chains in the Genus database with same CATH topology
 3R6G B;  2MGZ A;  2DIV A;  1PC4 A;  3PVX A;  2J8A A;  2UUT A;  1V9O A;  3MMA B;  1VQP S;  4OX9 J;  4P7V A;  5LSO A;  5IQQ A;  1NM2 A;  5L9X A;  2XLJ A;  1Y00 A;  1OWX A;  1SL0 A;  1FEH A;  4KHM A;  4FPI A;  2AX0 A;  3L7O A;  2V4Q A;  4WXO A;  6FDR A;  3EGN A;  1R8H A;  2DYA A;  2E9Z A;  2I6W A;  1D9F A;  1NEE A;  2OD6 A;  3LA0 A;  4MFB B;  3IWX A;  4NLD A;  4OYX A;  3AH6 A;  4ZP8 A;  4ZDN A;  3KK2 B;  4LRE A;  3M8R A;  2WVB A;  4UST A;  3SXL A;  2CZ4 A;  5D4N A;  4YR3 A;  2DGT A;  2LQB A;  1OY8 A;  3MAA B;  4WFZ A;  3BBF A;  4CO4 A;  3IGN A;  4CNY A;  5J1E A;  4IOC Q;  1JLB B;  2FLN A;  2UU9 J;  5CHC B;  1OYE A;  2C3O A;  5KAK A;  3K57 A;  4CLL A;  3SV4 A;  5KG0 A;  2BJ9 A;  2DK2 A;  1N34 J;  2KXF A;  2CJ9 A;  4EUV A;  3ITH B;  1CJU A;  1NH8 A;  2CAJ A;  1JLG B;  4O3P A;  1EET A;  3G6X A;  3ZZR A;  1U1R A;  1FXL A;  4DZD A;  4OLP A;  1WC4 A;  4YEA A;  4J9M A;  1OJ4 A;  2BAN B;  2FTR A;  3IM9 A;  3HT3 A;  1FXR A;  3QO9 B;  3P8B B;  1FD8 A;  2HWT A;  4OI1 A;  3LP0 B;  3ICL A;  3JSM B;  2F4V F;  2FVC A;  3D6T B;  3DHW C;  5CYJ A;  3KLE A;  3VTI A;  3UDV A;  3MPY A;  4DLE A;  4Q8E A;  2K8G A;  4KFB B;  1OYD A;  1QM9 A;  4OI6 A;  2MY7 A;  2ZE2 B;  4OYI A;  3A3P B;  3GLJ A;  4YOE A;  1AUS L;  1PJ7 A;  4Y2C A;  1Q4R A;  3BO2 A;  3AXK A;  2BJD A;  2H1Y A;  3CSK A;  1M1K T;  2FZK B;  4L3K A;  2WAQ D;  3OTB A;  3UVJ A;  5CYQ A;  3OUY A;  3KJV B;  4OMF G;  4NYO A;  2HK2 A;  4AXI A;  2DKO B;  2W4D A;  4JI0 J;  4QW9 A;  4UQG A;  1PJ6 A;  2GGP B;  4WP8 A;  1NH7 A;  1N5S A;  4L73 A;  3NXZ A;  1LWX A;  2MST A;  4KY3 A;  3VVT A;  3R5B A;  2D3Z A;  5GMD A;  2YPY A;  4JI3 F;  1LQ9 A;  3E01 B;  4NLV A;  5IC4 B;  2CPX A;  2HVD A;  4DHV A;  4QIW D;  1M5O C;  4DSK A;  4DV7 F;  4J9P A;  2WTF A;  2K3K A;  1JMT A;  4PCQ A;  2OEL A;  3NNA A;  4K2J A;  2QTW A;  4WZQ A;  2HG4 A;  5GMK a;  2FC8 A;  2GAH C;  5KG5 A;  2UV8 A;  5DZ7 A;  1KQF B;  4TU8 A;  1HR0 F;  4DFM A;  1NXI A;  3PIO Q;  3DRS A;  2R7T A;  1NUE A;  3RR7 A;  4ZPV R;  4IOB A;  3I0S B;  4OYZ A;  3PNI A;  4ECT A;  2UXB J;  2ZM6 F;  4OV6 A;  4PQU B;  4JBC A;  3LWL A;  3GSI A;  1UW9 A;  2IA6 A;  1EAR A;  3V81 A;  3GWC A;  2XLK A;  3I0R A;  2VF3 A;  4TQR A;  2CVI A;  2FD2 A;  3P3D A;  3N6L A;  2BEF A;  2OFG X;  3ZC4 A;  4NXN F;  3ETM A;  2X3G A;  4DX8 H;  1GK8 A;  5DM7 Q;  2ZZM A;  4K0K F;  1KVI A;  4HAC B;  1D8Y A;  1YGY A;  2XC9 A;  5HLF B;  4NCG A;  4NYP A;  1FRM A;  2DNG A;  3HD2 A;  5A6P A;  2KB2 A;  3KJF B;  5KFC A;  2V4R A;  4ED8 A;  1GTH A;  3P6Y C;  5FJ4 A;  3TVY A;  4NL5 A;  3IFE A;  2F8M A;  2IM0 A;  2Z2M A;  3MPD A;  3SSS A;  2V94 A;  4M5D B;  4OYP A;  4LMZ A;  1X4F A;  2V8H A;  2VG6 A;  3IP0 A;  2EFO A;  3GSD A;  3J80 Y;  1QY7 A;  2DGU A;  2IJF A;  1J27 A;  5AXL A;  4NOH A;  4QWE A;  5E3Q A;  2B5J A;  3MMB B;  1AZS B;  2RRA A;  2QYC A;  2V2K A;  3TUI C;  3I6P A;  4Q2M A;  1JNZ B;  2IA0 A;  4HHU A;  3EVW A;  3CJT A;  1GMW A;  4NEY A;  3HM9 A;  3BQ2 A;  4DV0 F;  5ETO A;  4CQ1 A;  3V2U C;  2XHC A;  2P5V A;  2MQL A;  2BE7 D;  3VAG A;  1MLA A;  5KT7 A;  3AFG A;  3HFV A;  5AJ3 F;  3WHI A;  3QGP A;  1S48 A;  2H5E A;  1Q8B A;  2ACY A;  3IG1 B;  3MM5 B;  3MMC A;  4LRD A;  4DDF A;  2HHW A;  1I94 J;  3VCD A;  4BHQ A;  1NKB A;  2I5J B;  4RUH A;  2VPY B;  3GFY A;  4HAC A;  4AE5 A;  4X66 F;  4DG1 A;  1U1Q A;  2N7C A;  2V2Z A;  4UUX A;  2UXC J;  2C2Z B;  2G0J A;  2KN4 A;  3MUV P;  1JJH A;  2HAF A;  3SQG B;  1EP4 B;  3V5R A;  1WEL A;  2C3Y A;  3HHD A;  4PXB A;  2MLX A;  4ZCL A;  3T9Z A;  2OD4 A;  4FKY A;  4ZN1 A;  2R7W A;  1HQ2 A;  3HK2 A;  1WOP A;  1IWA A;  5LMU J;  3G6Y A;  3NEK A;  1LWE B;  1SJF A;  2QLJ B;  1AZS A;  1O0P A;  2AV5 A;  2A3J A;  4QWC A;  4LF5 J;  3KUG A;  2ZBI A;  5J2Q A;  4HH0 A;  5KFF A;  1SKR A;  4PWD B;  1TKX B;  3MED B;  4F8R A;  4D3H A;  3HO1 A;  1S6Q B;  4F3Q A;  4DQS A;  5B0E A;  2GC8 A;  4URQ U;  1RHK B;  2JLF A;  3S6E A;  3AOC A;  2YTC A;  3A3O B;  1U2R A;  2WB4 A;  4OX9 F;  5EWF A;  1M5K C;  2ASY A;  1X31 C;  1HR0 J;  2VOP A;  1OQ6 A;  3L7U A;  4U8V A;  2LLZ A;  5I42 A;  3JB9 k;  3DRX A;  1NO8 A;  2R2R A;  1QLN A;  3ENV A;  4K4U A;  3T1H J;  2BW2 A;  1JLA B;  1XTZ A;  2CVE A;  3M6X A;  4ID5 A;  2NSC A;  3LO3 A;  4LSN B;  5C24 B;  5K20 B;  1RT2 A;  1UFL A;  3QAT A;  4ILR A;  1XN9 A;  4P6Q A;  2XNR A;  3OVS A;  1OIA A;  2GS8 A;  4DN9 A;  3J7A N;  1YJV A;  3D6M B;  3G9C A;  4CLU A;  1S6U A;  5JMN A;  1X5S A;  5F9L A;  3HP6 A;  5G0R A;  4RZR A;  3H40 A;  4QU7 A;  4LUB A;  2HHU A;  5DM6 Q;  3PW2 A;  2FC9 A;  2YQ0 A;  3MCM A;  2AF6 A;  2OEJ A;  1K9M T;  1WOS A;  1YQH A;  2GNK A;  5GAG U;  3OFF A;  5T14 A;  1JJ2 R;  5C25 B;  2XO7 A;  3MEC B;  4OHV A;  1RBA A;  3ENQ A;  3Q8Y A;  3PZP A;  5C2G A;  2DIU A;  3PJW A;  1TMM A;  3OXG A;  2KM8 B;  1WOR A;  2YWE A;  5L39 A;  4GKJ J;  4B9N A;  2YKO A;  3OHA A;  1UVM A;  2QC3 A;  1S57 A;  4UT4 A;  3DI6 B;  2CZV C;  4RJV A;  2JL9 A;  5AT1 B;  3N0V A;  1FVS A;  1FWP A;  4DX7 A;  1HWL A;  2OFH X;  1MML A;  2XUL A;  2LCW A;  3I87 A;  2ZC4 A;  3M32 A;  5KFA A;  5LXR A;  2HZV A;  2DO4 A;  2RIL A;  2QN6 B;  4URS A;  1U02 A;  4MIA A;  4C3K A;  3NS7 B;  3WZ0 A;  3GIM A;  4M5L A;  3BO3 A;  4C97 A;  4M5H A;  2HBZ B;  3NGR A;  1R6Y A;  3TAM B;  1NSK L;  4YP3 A;  5M2R A;  1TKZ B;  2MZR A;  3OJS A;  3C16 B;  1UEK A;  3OLA A;  1V6H A;  2Q43 A;  3C3L A;  3M2V A;  3Q23 A;  3MM6 A;  1QDU B;  2NXC A;  4NLU A;  3JSM A;  2AQ4 A;  4IG0 A;  1O51 A;  3W65 A;  3PX6 A;  2QA1 A;  4B3O B;  1R0A B;  2HGN A;  4DR4 J;  1FKP B;  3DU6 A;  3RRH A;  2NRE A;  4FF4 A;  4RR5 A;  2QLF B;  3ZTQ A;  1WDD A;  2F4F A;  2I9S A;  4TU7 A;  4E0D A;  3EXC X;  3UCZ P;  1ZET A;  1N5V A;  3M2R A;  2OTL S;  3QGI A;  2R8G A;  1LWC B;  4KQZ A;  3ZNU A;  2UVW A;  4NCB A;  1JK9 B;  3NNH A;  1RIS A;  2Z57 B;  3EZU A;  3O6Q A;  3W5X A;  4F3M A;  4WWS A;  3MEG B;  3PHE A;  4DFP A;  4C8Z A;  3UDL A;  4QZV B;  5DET A;  1OMS A;  2HZA A;  2VOD A;  1BHN A;  2RIJ A;  3ET6 B;  1TL4 A;  1GMW D;  1FKA F;  1B64 A;  4UOG A;  4X64 J;  3EDQ B;  1IUJ A;  4KBI A;  4EBE A;  2GJ2 A;  1E6V A;  1EJ7 L;  4EO6 A;  3TVK A;  1S1X B;  4ID8 A;  4RNN A;  5CYM A;  5KFL A;  4KIA A;  1XQI A;  5F3T A;  1VK3 A;  2ZC3 A;  5F8J A;  2D1C A;  3NRB A;  2PGC A;  4A8F A;  1IN0 A;  3BPD A;  3H5X A;  1HBU B;  2KH9 A;  2APO A;  2VJU A;  4ZP9 A;  4I2Q B;  2LKZ A;  2ROG A;  3MM6 B;  4U8Y A;  1I94 F;  5CZV A;  5EX3 A;  5D3G B;  3CJ2 A;  3ETO A;  4Y28 C;  1QVG R;  4DUZ F;  3TP2 A;  5LSR A;  4PQU A;  2D9P A;  3DOL A;  1QSY A;  3TNV A;  2XYG B;  3QLH A;  4GC7 A;  3G71 S;  4Q43 A;  1KQG B;  2HQD A;  5I3U B;  3HJV A;  1QD1 A;  4NLX A;  2XEX A;  1NJW A;  1Y0H A;  3TW0 A;  3SV3 A;  5L1K A;  3N5F A;  3GU0 A;  5D15 A;  2Z4P A;  3PW7 A;  4NAS A;  3M8Q A;  1XR6 A;  4P2S A;  4TU9 A;  3CMA S;  2B9Y A;  1J5E J;  1DTT A;  2POK A;  2YKP A;  4DV7 J;  2ZKT A;  3TZY A;  1SVD A;  1KD1 T;  1RUS A;  3X3U A;  4OI4 A;  4WP9 A;  1DRZ A;  1CPZ A;  1RLD A;  3U7J A;  2MQQ A;  1U1L A;  1KS2 A;  2A0F B;  1TMJ A;  2D3U A;  3DOM B;  1ZM4 A;  4LFB J;  5ETK A;  1X5P A;  4OZ0 A;  1X0P A;  3DLE A;  2CDQ A;  2OMO A;  2Y1L B;  4WBF A;  4L6V 3;  2BX6 A;  1FJE B;  5E33 A;  1AT1 B;  2HQG A;  2B5J B;  3A13 A;  3MMB A;  2NR0 A;  2WSF C;  1HKA A;  4LF4 J;  2YNG B;  2YWF A;  3MDF A;  3I4H X;  4U9R A;  1TK0 A;  5I3P A;  3CIM A;  3PEH A;  1UW4 A;  2C2K B;  3QYY A;  4FYW B;  1NKC A;  4FXD A;  1CG2 A;  4I2Q A;  2C3P A;  1NSQ A;  2HIY A;  5MAO A;  3NBP A;  5THW A;  3PRB A;  4ZP7 A;  4DN0 A;  2RKI B;  1RWN B;  4P52 A;  3CCE S;  4ZVH A;  2UVU A;  2JEI A;  2DCL A;  1LKZ A;  1ZPV A;  1IWG A;  1DBD A;  3J81 j;  3CNQ P;  1UWA A;  1VLY A;  3N79 A;  5HMW A;  1KNZ A;  3GR0 A;  1TL3 A;  2KFZ A;  4K4V A;  1N54 B;  2P9C A;  1KLM B;  1Q16 B;  3FFI A;  2JC1 A;  3MCS A;  1QAI A;  3T19 A;  2BV3 A;  2G2Y A;  3CDA A;  2YKQ A;  2V6A A;  1CS4 A;  2YVS A;  5E3C A;  1VC5 A;  3MF5 A;  2IAJ B;  5A8R B;  3UFC X;  2FLL A;  1SQF A;  1Q0N A;  2JVR A;  3MOZ A;  2MQN A;  3MM7 B;  1S49 A;  1PCA A;  2VFS A;  5IQ6 A;  4Q5V A;  3Q24 A;  1KOO A;  2RVJ A;  4HLB A;  4EGL A;  2H5J B;  3BGL A;  3EGV A;  4Y34 A;  3NS5 A;  1DQ8 A;  3HHL B;  1EQM A;  2VG7 A;  3LF0 A;  1KQS R;  2XS7 A;  3KLF A;  3C15 B;  1LWE A;  3LAK A;  4KR0 B;  3VZH A;  3CPW R;  4YFU A;  3HVR A;  1Y5I B;  3H59 A;  4OZ5 A;  2HFO A;  4MIW A;  1XMB A;  1TKX A;  3M30 A;  3MED A;  1CVJ A;  1K0V A;  1F1B B;  4ZLJ A;  2M8H A;  5EDW A;  1YZ6 A;  3DLG A;  4J37 A;  1PIL A;  3DDK A;  2KJV A;  2M5Y A;  4DBQ A;  3IRX B;  1YTY A;  3DM2 B;  3BZQ A;  2JHE A;  3IS9 A;  1S1V A;  1SUQ B;  1Z1Z A;  2KHD A;  4UUW A;  4ILM A;  3HVT A;  1CUL B;  2NQP A;  1FD2 A;  3MR7 A;  2BJE A;  2O67 A;  1RK8 A;  2CQ3 A;  3FGV A;  3UN2 A;  4DCJ B;  4ZJQ A;  1VI7 A;  5LL6 d;  5KT2 A;  1RE1 B;  1YJN S;  1FFS B;  1WNE A;  4NLW A;  4OJH A;  4ID5 B;  4LSN A;  3IR5 B;  4TN2 A;  4ZOS A;  5C24 A;  2MQP A;  3MR6 A;  5LXY A;  2HMI B;  4KGK A;  1FVQ A;  4DL7 A;  1OSC A;  2WVC A;  3O1L A;  4RBT A;  4AQY J;  2C2D A;  2DR7 A;  4C8Y A;  2UUW A;  3TA1 A;  1KBR A;  2ZJP Q;  3PW5 A;  4LJM A;  1SC6 A;  5FII A;  3CXC R;  2WON A;  2YXL A;  2V9K A;  4J9U E;  1IQZ A;  3CWJ A;  2VD3 A;  2ZEJ A;  4UOH A;  3UW1 A;  4EMD A;  4DL2 A;  3OL8 A;  3FRZ A;  2MQO A;  2X7I A;  4I2P A;  4PWU A;  3LAN A;  1RT4 A;  2CQ2 A;  3EE3 A;  5LM7 E;  2VG7 B;  3LUY A;  5C25 A;  3I55 S;  2VIH A;  4GMK A;  4ECW A;  4JI6 J;  2XYP B;  2XMJ A;  5KFU A;  4CP5 A;  5F8G A;  2ACM A;  4F4K A;  2R7V A;  4ED1 A;  4QW8 A;  2DPJ A;  1WDT A;  3GYG A;  4J91 A;  4DS4 A;  4CTA A;  1X8D A;  3ZTS A;  4MAK A;  3I96 A;  5I4M A;  4R8U A;  1CJT A;  1TL1 A;  2LEA A;  4DR1 F;  1B7F A;  4NZ7 A;  3CJS A;  3VAJ A;  4ED6 A;  1LV5 A;  2GQC A;  4LQ9 A;  3CJ0 A;  5K8M A;  2G1D A;  4IDK A;  3BYR A;  1M5S A;  4YUD A;  2HBY B;  5BYS A;  4DR7 F;  1F9H A;  4IOA Q;  4JV0 A;  2O5D A;  4CO5 A;  2ADB A;  2GCF A;  4Z7C A;  1S12 A;  3KHG A;  3BSO A;  4ZMM A;  3TZW A;  4DU8 A;  4I69 A;  1WEZ A;  4PAB A;  4CNZ A;  4F4A A;  4ZCM A;  4RNM A;  2MKI A;  3V6H A;  1U6B A;  3VWS A;  1HW9 A;  3SBM A;  3FBC A;  2KM8 C;  4JI3 J;  4AL7 A;  4B3R J;  2ZH3 A;  3CDW A;  1FJC A;  4AXJ A;  4A8W A;  2K7K A;  3DOK B;  5J2M B;  4LR8 A;  1X4H A;  1Z4U A;  3W2W B;  2FYX A;  3CCW A;  2VQE J;  1TP7 A;  2ABY A;  2DGV A;  2YQ1 A;  3B6B A;  4KKO A;  3PR5 B;  2J6U A;  1Y11 A;  3UCG A;  5AXM A;  1WEY A;  2MKH A;  4ZN3 A;  4MFB A;  4C6A A;  1X9M A;  2BJ1 A;  1XER A;  2JFK A;  3TQ1 A;  5IM0 A;  5DGA A;  5B09 A;  1JLC B;  3M2R B;  1GT8 A;  2HQC A;  2JDJ A;  1EIY B;  4BWM A;  3MGJ A;  3AT1 B;  3SSQ A;  4U7U D;  1PYS B;  1XJW B;  2AHO B;  5KFZ A;  3CCV S;  1MU2 B;  1LFW A;  1NPR A;  1DTQ B;  1HFE L;  3M6W A;  4DFJ A;  3FBB A;  3D1H A;  1H7X A;  4ZVG A;  2ZJR Q;  4A8M P;  1KLN A;  3OTO F;  3DLB A;  5DGB A;  3CGI A;  1IJE B;  2VFV A;  4FP9 A;  1YLX A;  2FQQ B;  4O23 A;  4TYA A;  3M1V A;  5DG8 A;  3NGD A;  3EUN A;  3CJR A;  1S1W A;  3RR8 A;  4I6A A;  1VQ6 S;  4OFZ A;  2PMW A;  1M1G A;  2IJN A;  1U1N A;  1UWB A;  2NUU G;  1PBA A;  1Y9O A;  4OZ3 A;  3R7N B;  2ZVS A;  2DH9 A;  1RTH B;  2OML A;  2PT0 A;  2QMW A;  1CC8 A;  1N4L A;  3OL6 A;  4DR6 F;  1M0S A;  4F04 B;  1U47 A;  1FRL A;  3JQK A;  1HBU A;  1JKH B;  2R8J A;  1SCJ B;  1KFD A;  1CQN A;  4DOZ A;  4ZHR A;  3AA9 A;  1DAX A;  4Q45 A;  5T7L B;  5CAA A;  3CJQ A;  4M5K A;  1GXT A;  3JQJ A;  3T6J A;  2FHK A;  1SKW A;  1VQ8 S;  2GGP A;  3RW6 A;  3CO9 A;  1XNQ J;  2HWH A;  3MFI A;  1W2I A;  4ENO A;  1RAB B;  5IV3 A;  3PJ9 A;  1C1C B;  2ZWP A;  1FE4 A;  4ZCI A;  3GIJ A;  4KRW A;  3NGK A;  1YX2 A;  2VUG A;  5CYQ B;  1KHV A;  2WRM A;  1N0V C;  3M9O B;  4OLO A;  1ROF A;  3VGU A;  4NCA A;  2V8V A;  4I6W A;  4B3S J;  1S6O A;  4LSL A;  3SDE A;  4QR0 A;  1UPP A;  1Y4Z B;  1S77 D;  3B78 A;  3LGM A;  4PG6 A;  2E1A A;  4TNO A;  4CLK A;  2H54 B;  1S72 S;  1AB8 A;  4H4M A;  2RB7 A;  3OJU A;  1RTJ B;  2DHS A;  1NRK A;  2YH0 A;  3WC0 A;  1WD6 A;  4W92 B;  1RZM A;  3VQS A;  1XR7 A;  4FBT A;  2L48 A;  2C2E A;  2NYH A;  2KFY A;  1YSJ A;  1QTN B;  2CJX B;  5IT0 A;  3MCO A;  2ADC A;  3I0S A;  1SH2 A;  4IG3 A;  3S1T A;  1F0X A;  1FRJ A;  2B4V A;  1UZH A;  3O2I A;  1T7P A;  1W25 A;  4ZHR B;  4F0H A;  1S5Z A;  3UE2 A;  1F5B A;  2H65 B;  3AD9 C;  4RW6 A;  4HI1 A;  4CH0 S;  3MEE A;  3VAH A;  2YKN A;  2ZHB A;  3TAN A;  1JX4 A;  1UFK A;  2PO4 A;  1PKU A;  3ZZO A;  1RAF B;  4YHH F;  4ETX A;  1RHU B;  4DV2 F;  2QL9 B;  1CBK A;  1TV6 B;  4F4Y A;  3HSZ A;  2BRK A;  3HT0 A;  3US5 A;  5HQL A;  4P9S A;  1HHS A;  1ZAX A;  4ECY A;  5F8I A;  5MLC V;  3D54 A;  1K47 A;  2A6M A;  1XNR J;  2AYB A;  3R5J B;  1G1X A;  3QRP A;  3JSY A;  2BVZ A;  3KLH B;  2BE9 B;  2VFT A;  4C0O C;  2LVW A;  2MMY A;  2N4C A;  5ETR A;  4X65 F;  1FRH A;  4N8O A;  4P73 A;  1ACM B;  2GMH A;  4QBU A;  1N32 J;  5KG2 A;  1IJF B;  3DMJ A;  2MB0 B;  4ZJO A;  1RWX B;  4ZPW R;  3TEG A;  3HLU A;  1H7W A;  4NA3 A;  4C11 B;  4PEO A;  3OVA A;  3QFW A;  2GIR A;  1NBE B;  3KLF B;  1TKD A;  1TKT A;  4OX8 A;  4X84 A;  2HRT A;  2HNY A;  2CG8 A;  2KJW A;  2FIU A;  1MMN A;  1UVN A;  1IR1 A;  1HBM A;  3J80 U;  3CCZ A;  9RUB A;  3R8Y A;  4X62 F;  1IBM J;  5ITH A;  2NXE A;  3C14 A;  2XS2 A;  3DRR A;  5HRO A;  2B8P A;  1RAI B;  4OI0 A;  1I3O B;  4Y3C A;  5BYQ A;  1NSP A;  2JOQ A;  3CUL A;  2VIC A;  2BYC A;  2DNM A;  2BMB A;  2A2D A;  2V69 A;  2CKW A;  2DHA A;  3N4W A;  1ZZN A;  4DR2 J;  3QNW B;  3IBF B;  1YG0 A;  1U2F A;  1S1U B;  3OPK A;  4IYQ A;  4RBV A;  1RHQ B;  2VG5 B;  5KFI A;  3THP A;  4RNO A;  2XM3 A;  3PR4 A;  2X1A A;  2P6T A;  4TYB A;  3T1H F;  3MMA A;  4DG1 B;  3HXM A;  1U1K A;  1S76 D;  5ETS A;  5KFR A;  4JI1 J;  2NXU A;  3DGP B;  3KG0 A;  4ATN A;  4DR5 F;  3PXG a;  3P49 B;  3A12 A;  1GMV A;  4DUY F;  3W64 A;  1VS3 A;  1WHW A;  1XWL A;  1ZZF A;  3BDE A;  4M5I A;  4UW2 A;  3F73 A;  4DUZ J;  2H9Z A;  5J2N B;  1RAA B;  1WKJ A;  3BSA A;  2G4B A;  3V6D B;  3Q0A A;  1SJQ A;  3DLJ A;  2QO3 A;  4I2P B;  3Q8R B;  4UZB A;  5HMY A;  5J1E B;  1HNZ J;  3D5M A;  1XC9 A;  4BDP A;  1SV5 B;  2DH7 A;  1GFW B;  4N76 A;  3S7R A;  3CO0 P;  4PWW A;  3KK2 A;  2E9T A;  3U27 A;  2W7O A;  2H48 B;  2HVE A;  1DAR A;  1S9G B;  3EVM A;  2ATL A;  1JLA A;  3CVK A;  2HLU A;  4OQJ A;  5F3Z A;  1CLF A;  3AB2 B;  4RPF A;  1EKR A;  2DHH A;  3SSR A;  4WFA Q;  2W9C B;  4J9Q A;  2BQU A;  2FJV A;  3CB4 A;  2W7P A;  3EPI A;  3TOQ A;  1MRO A;  1OY6 A;  3QO9 A;  3BBC A;  3Q2S C;  5DLG A;  2E29 A;  4AQY F;  4OL8 A;  1JLQ B;  2EC2 A;  3R6L B;  5AE3 A;  4M95 A;  1H74 A;  1VIX A;  1F9E B;  3FBE A;  2Q1L A;  5K14 B;  3AY0 A;  1C2P A;  3D67 A;  3KLI B;  4R0J A;  3RTV A;  2CJQ A;  1E6Y B;  4ZPT R;  1S9E B;  5L9N A;  4I56 A;  5D0E A;  2W2O P;  4DPT A;  2KZZ A;  2Q79 A;  4ZIV A;  5DQG A;  4RUA A;  3OFG A;  2ZD1 B;  3M2U B;  3OT9 A;  1IQT A;  1T05 A;  1R0B G;  4ZJL A;  3K17 A;  3JAM U;  1ZM2 A;  3AQP A;  4KAI A;  2FY8 A;  4XDD A;  5AXK A;  3W2W A;  4DR4 F;  4DL5 A;  4LSZ B;  1ZM9 A;  3AB4 B;  2J6S A;  1LWF A;  2IC3 B;  4Y0F A;  2HVH A;  2CQ1 A;  1SB6 A;  3SFG A;  5IV4 A;  1G6B A;  2BQR A;  3IWN C;  1PAE X;  2MKC A;  4G65 A;  4KT0 C;  2HNZ B;  3KJV A;  1VIO A;  2B43 A;  1U48 A;  2QA4 S;  4DFK A;  2OO4 A;  5B7W A;  3JTP A;  2W9C A;  2CYY A;  3M32 B;  3UD5 A;  2UZA A;  1DTQ A;  1JQG A;  3EGW B;  1L3U A;  2Y8W A;  1DY3 A;  2P6S A;  4FVC A;  5F8M A;  2G2O A;  1L3T A;  4PPD A;  4YB5 A;  2DIS A;  2HQ3 A;  2RRB A;  4HDG A;  3VVU A;  4ALZ A;  1T9W A;  2YX4 A;  4J9S A;  4ECR A;  2D3O 1;  2AYG A;  4B3O A;  1KHW A;  4H4O B;  3CJK B;  2DVI A;  3NMA A;  2MJU A;  3HPO A;  5H9E J;  2UUC F;  1A6L A;  4K2X A;  2IVF B;  3DRS B;  2AEJ A;  2ALY B;  3GV8 B;  1Q1K A;  1N36 F;  2W4P A;  3HJF A;  3I0R B;  4QCL A;  5KOX A;  3QSY B;  1VQ5 S;  5DJB A;  4DZ6 A;  3DU5 A;  2V63 A;  1TL7 A;  2M7S A;  4C3L A;  1YI2 S;  5JXS A;  1WC3 A;  2UXD F;  2B9E A;  2YPZ A;  1T9V A;  3VQT A;  4RU2 A;  4C48 A;  1S1T A;  3E2E A;  5IT9 Y;  1C1B B;  2E5G A;  3J7Z 5;  1FNM A;  1RU1 A;  4CLW A;  2XCP A;  2HHV A;  2OJ3 A;  4OYM A;  5BR8 F;  3N5B A;  3OW2 R;  4OZJ A;  2CPD A;  1KTV A;  1B0P A;  2OSQ A;  1BQN B;  1U0H B;  3LQV A;  3NWR A;  4LVO P;  3W5Z A;  5K8P A;  3BRE A;  5F0W A;  3ILJ A;  4EWT A;  3C6T A;  4JV5 F;  3CMQ A;  4Y2A A;  3TJ9 A;  1M5P C;  2FPH X;  2NPF A;  3WQP A;  4RW7 A;  2DHX A;  1K1Q A;  2OGU A;  1X4C A;  2BKN A;  1L3V A;  4MK7 A;  4XDC A;  2OPR B;  5A8W B;  3H42 A;  1RT7 A;  2C3U A;  3HDS A;  1S0N A;  4B17 A;  1YKW A;  3PRD A;  3HHL D;  3RAQ A;  2E1C A;  3GQC A;  2CIM A;  2UVV A;  1GNK A;  2PSZ A;  1X5O A;  3IG1 A;  1HPZ A;  2B9W A;  4C0B A;  1P8G A;  1N36 J;  4AL5 A;  3KUE A;  3PW4 A;  3PEJ A;  2JJ4 D;  2VJV A;  1IKX A;  1N5Y A;  1KRP A;  2JC0 A;  2ZOM A;  2VA3 A;  2U2F A;  5CA5 A;  4WYL A;  1IBC B;  2Y1I A;  4G6V B;  2RUG A;  3LPE A;  5LOQ A;  4DV1 F;  4DXL A;  4EBC A;  2CZ9 A;  1HQU B;  1RAG B;  5L46 A;  4NLY A;  3AQO A;  4P74 A;  2EFV A;  4CLT A;  3R2D J;  4C4W A;  1F60 B;  1A9N B;  1LW2 A;  4O3N A;  1CJV B;  2GHV C;  2W25 A;  3JSR A;  1WHY A;  1T95 A;  3KTQ A;  2G0I A;  2GVD B;  4IR9 A;  1VBX A;  3GYN A;  3DYA B;  3RAX A;  2LA6 A;  4IRC A;  2JZ5 A;  2YNG A;  5ETT A;  3D4J A;  3Q8P B;  3RB4 A;  3X1L B;  2D3O R;  4XIU A;  1ZYQ A;  3KLG A;  2VFU A;  1C4C A;  3Q8U A;  1U09 A;  1NLK L;  2BOA A;  5KG4 A;  1S6Q A;  2YKM B;  2JLG A;  3DNC A;  2H5I B;  3KK1 B;  1HWK A;  2RDD A;  1VQL S;  3HF5 A;  4NLS A;  3U02 A;  7AT1 B;  2HFU A;  3IR6 B;  4ECU A;  3TAR A;  1WG1 A;  4UOF A;  2E5H A;  3G86 A;  2HNY B;  3H98 A;  1FKO A;  1QAY A;  1FA0 A;  2R2S A;  1WAC A;  2EWH A;  4OHW A;  5A8K B;  4DR6 J;  2BOP A;  2IYG A;  4YN3 B;  1AYE A;  3HZE A;  2JNJ A;  3SCK E;  3J7A 1;  1RWU A;  2B4P A;  2IAJ A;  3UCU P;  2OLW A;  1YIT S;  4C8K A;  1PAU B;  1RA7 A;  1T9T A;  2B8Q A;  2HK3 A;  2OPP B;  2XI3 A;  4O4G B;  2W8L A;  2DD8 S;  1S1U A;  1T8E A;  3FFI B;  4LF2 A;  2M88 A;  2DR9 A;  2H3E B;  2K1R B;  2LU1 A;  3CD5 A;  2MKK A;  3VAL A;  4C8L A;  1JIH A;  2N4D A;  2GVD A;  4I4B A;  4LF7 J;  3A8K A;  4HHJ A;  1N52 B;  2DGS A;  1OY9 A;  2M9K A;  3BO4 A;  3DGP A;  4O0I A;  4ELV A;  1RT3 B;  3CCR S;  1S59 A;  1SKU B;  3BV8 A;  1RAJ A;  1DQ9 A;  3M30 B;  4V19 X;  3K0J A;  4WFY A;  1WC6 A;  2XB2 D;  4DV1 J;  1P27 B;  2L08 A;  2CPE A;  4OHY A;  4NA1 A;  4A8S A;  5M2U A;  2D69 A;  2LP4 A;  5D4O A;  3RBZ A;  2HFV A;  2V9W A;  4BC7 A;  1RAE B;  4F0M A;  4K5R A;  3TUJ C;  3IS9 B;  4RUB A;  4G1I A;  4L76 A;  3TA2 A;  4KC5 A;  3T6B A;  3RB6 A;  3TUP A;  1MMD A;  6FD1 A;  2RRN A;  3GJQ B;  5F9N A;  3SQO P;  2IYI A;  3DLG B;  1TU0 B;  4P2F A;  1B70 B;  3DI6 A;  4W4M A;  1TQL A;  1RWV B;  2ZBP A;  3B4D A;  3GIL A;  2PDA A;  3F41 A;  2HIQ A;  4MH8 A;  3IN5 A;  3M8S A;  1Q7Y T;  4LFA F;  3KJQ B;  3BR9 A;  1U1M A;  3NCP A;  2DNL A;  4FKX A;  3THV A;  3C16 A;  4CLF A;  2KTQ A;  3H5Y A;  1XMQ J;  1A0O B;  2VBW A;  3M2V B;  2OPP A;  4HR2 A;  4DV6 J;  4MK8 A;  3AOB A;  5HAT A;  3RZA A;  3RBD A;  5SZT A;  4P10 A;  4JI5 F;  2YX1 A;  1TAU A;  1RT1 B;  3P4U B;  2OPQ B;  1F6T A;  5A0Y B;  2JEF A;  3BDP A;  4KH1 B;  4UQT A;  3NOG A;  4GC6 A;  5DLF A;  2CPH A;  2NXJ A;  3QT7 A;  1RWM B;  1TK5 A;  5CD4 H;  3K5L A;  2CPF A;  3A3N B;  3GYX B;  5IWA J;  4G3I A;  1XNQ F;  2F4V J;  1BC6 A;  5E5N A;  2VQE F;  2J6T A;  4M5G A;  2JLE A;  4OI2 A;  3QZ8 A;  4ED0 A;  2PEH A;  2EKY A;  3QT6 A;  4OYA A;  2CPZ A;  3N6N A;  3VV2 B;  2IRY A;  3DXB A;  3RRG A;  1LWF B;  2IC3 A;  2DXF A;  4IH5 A;  2VKZ G;  3CC7 S;  4X4Q A;  4ECS A;  3CCJ S;  1I5O B;  2D41 A;  3W63 A;  4V1A k;  3PV8 A;  1X4G A;  3QT5 A;  4MYU A;  1HI0 P;  2AGQ A;  5D0R A;  3W60 A;  1ITP A;  4M94 A;  2MXY A;  2DIT A;  3M8W A;  5K5M A;  1NJY A;  2NZ4 A;  3W66 A;  3MUM P;  2KT2 A;  2GX8 A;  2EBG A;  3HCX A;  4OX6 A;  3G82 B;  4KSE B;  4WK1 A;  2HVI A;  3NGS A;  2F8E X;  1WI6 A;  5HAO A;  4CT9 A;  4DR3 J;  5IT9 U;  2ZZT A;  3H5U A;  5HQM A;  1RTD B;  3QGG A;  5KFQ A;  3KOA A;  2OI2 A;  1WTB A;  3J7Z T;  2BQ3 A;  2XS5 A;  3D3B J;  3F44 A;  1R43 A;  1RCX B;  1RA6 A;  4X66 J;  3ZTO A;  4RWW A;  2Y1R I;  4TY8 B;  4QR1 A;  1GX6 A;  5B0G A;  4B08 A;  2OPQ A;  5A0Y A;  4O3O A;  1ZM3 A;  2BA9 A;  2ZE2 A;  4F36 A;  1LW0 A;  2F7V A;  2FHJ A;  3UD3 P;  4X4O A;  1HLW A;  4AL6 A;  1RT5 A;  1J5O B;  3CD0 A;  3F56 A;  4RW4 A;  1QSL A;  5J2M A;  1RYS A;  2Y9H A;  2GZO A;  2MLZ A;  2RQK A;  4DV5 J;  1B4S A;  2ZH4 A;  4OYW A;  3EJM A;  6AT1 B;  3P96 A;  1Q79 A;  3OTE A;  3HUL A;  3IGV A;  1LK5 A;  2F1F A;  5DO2 A;  4JI7 F;  2BKO A;  5D3G A;  1JLE A;  2PD1 A;  1DTT B;  2KYZ A;  5CD4 A;  2RJZ A;  1C1B A;  2LMI A;  2NSB A;  3ZFV A;  1Y3J A;  3P45 B;  1ZPW X;  1SJ1 A;  2XMW A;  1V5V A;  1Q8K A;  2BJ7 A;  1SJ3 P;  2J9C A;  1WTF A;  3P5T L;  3LW5 C;  3PFE A;  3HHN B;  3DOM A;  3DKD A;  4RW8 B;  5KFH A;  3TO8 A;  2ZDO A;  5ETM A;  4A8Y A;  5KFW A;  5KFK A;  1VQS A;  3FCW A;  3L3C A;  1N48 A;  1NAQ A;  3CCT A;  4NPO A;  5ETP A;  1REV A;  4L72 B;  3DLL Q;  2WVF A;  4X2B A;  3KWM A;  4ZVR B;  3IR7 B;  1EQ0 A;  4X62 J;  1FT8 A;  3FNN A;  3QIP B;  4DV3 J;  1LXN A;  2CQ4 A;  2ZUA A;  3G2X A;  1YIJ S;  3RB0 A;  2Y8Y A;  2YWW A;  4DR1 J;  1HBN A;  2YWG A;  3NG8 A;  5T7L A;  2BM0 A;  2BRL A;  2CQP A;  1RHJ B;  3FC9 A;  4NLQ A;  4ZVP B;  1JXL A;  3KHL A;  3N9U C;  2VPW B;  1N5T A;  1R7I A;  4UTG A;  4IFV B;  5U47 A;  1BMQ B;  2DNZ A;  3L4B C;  1KEK A;  1NND A;  1UCN A;  1TL3 B;  3DGV A;  1IKX B;  4HDH A;  1Q78 A;  1UJ5 A;  2B4U A;  3Q89 A;  4J9V A;  4NI2 A;  1I51 B;  4DUY J;  1FNO A;  1XR5 A;  2V4J A;  3LP1 A;  4WKY A;  3TQE A;  4GKK J;  1NHV A;  3UR3 C;  1IVZ A;  2XSJ B;  2VG6 B;  2EI5 A;  4OJ3 A;  5E41 A;  1LW2 B;  1AXQ A;  1DLO B;  4KV8 A;  5CXT A;  2AT1 B;  3N01 A;  4OJ1 A;  1DFD A;  1PJ5 A;  1WWH A;  1Y10 A;  3CC2 S;  3CUN A;  2E66 A;  1HL6 A;  1YJU A;  3BBB A;  3BPS P;  3NGT A;  1NZ8 A;  5K8O A;  3M7V A;  4UY8 5;  3EXY A;  3T1A A;  3TZX A;  1UVJ A;  3OTD A;  4DPU A;  5EWG A;  2Z8Q A;  2FVQ A;  3QT8 A;  2RT3 A;  2JH3 A;  3MEK A;  3WX4 A;  2YKN B;  5B08 A;  3KK1 A;  4JI1 F;  4IO1 A;  3TWZ A;  4QPX A;  5H1S V;  4FS2 A;  2RS8 A;  2R9L A;  2GQ2 A;  1U6F A;  1TV6 A;  4UY8 T;  2HSE B;  4XPE A;  4F2R A;  2ILZ A;  4CH1 A;  3RRK A;  4X4S A;  4RW6 B;  1X0F A;  4O3Q A;  3CW2 C;  3IRX A;  2UUB F;  3JYT B;  4M8L A;  1S1V B;  3VF0 B;  2HMI A;  1CUL A;  4Q0B A;  1Y5N B;  1LOU A;  1Y3K A;  5GAE I;  2R7U A;  3QWU A;  2V67 A;  1F2H A;  1MWQ A;  1WOO A;  2BAC A;  4NWB A;  4G1Q A;  4OHX A;  2P2C B;  3FMB A;  5B0B A;  2ZH8 A;  4ELT A;  5D4P A;  2W8K A;  4IRK A;  1TFW A;  4V19 J;  2RQ4 A;  2W24 A;  2LXU A;  4P75 A;  4O0N A;  1MN7 A;  1URR A;  4JI8 F;  4NML A;  4C11 A;  3BSC A;  1OQ3 A;  3EDR B;  3LPY A;  1NK8 A;  2CRL A;  2MYF A;  1VC0 A;  4ZVF A;  1S0V A;  4Z7Y A;  4IQM A;  5H9F K;  3N6M A;  2DB1 A;  2BKP A;  2GVZ B;  3BS9 A;  3PX4 A;  1WKL A;  3U1N A;  3R2C J;  2DNP A;  3H2U B;  3BYP A;  2ASL A;  1LNQ A;  3T5L A;  2J76 E;  2Z2L A;  1RKI A;  2HW3 A;  4ZVQ B;  2OIH A;  2XMU A;  3W9H A;  4JI8 J;  3AOD A;  1R8B A;  2HUR A;  2C28 A;  1VRT B;  4E8U A;  1M5H A;  2V0N A;  4PXC A;  2FUG 9;  3ZNJ 1;  1FES A;  2XZD B;  5FLX U;  3C14 B;  5D77 A;  2YNF A;  3MTK A;  4K7Q A;  3HKZ D;  3DRY A;  2Y3Y A;  5DRK A;  4YY3 J;  5KFE A;  3KG1 A;  1W26 A;  3VGS A;  2PE8 A;  1P1L A;  4EBD A;  4QYZ J;  1L3S A;  1R8C A;  1RCO B;  2XI2 A;  3NWG A;  4ITS A;  2HFN A;  2CJA A;  4KGM A;  4BCA A;  3T5H A;  1XMQ F;  1VQ4 S;  1HIY A;  4K59 A;  1CEZ A;  1B3T A;  2CJB A;  2IY5 B;  2R7S A;  1QVF R;  3KLE B;  1BGX T;  4G1Q B;  4LFA J;  4DPX A;  1FTR A;  1RP5 A;  2VBY A;  1H98 A;  1APS A;  4O4R A;  4KFB A;  4N77 A;  4A4J A;  4JI7 J;  3PRV A;  2E7V A;  1NDP A;  4AYB D;  2M0G B;  2EK1 A;  2IM1 A;  2G0C A;  3W2V A;  1NJX A;  2M52 A;  1WUU A;  1RLC L;  2HS0 A;  2XWY A;  3PYG A;  4ZVO B;  2AGP A;  1JLC A;  4C8O A;  2E7X A;  2N82 B;  4O44 A;  5J2N A;  1S9G A;  1VIS A;  4GKJ F;  3MHY A;  3CJ3 A;  1ZA2 B;  4W98 A;  2UUC J;  2MSS A;  1TEL A;  3KHR A;  1WC5 A;  2BXJ A;  2F9D A;  3ELH A;  2ZH6 A;  3AOA A;  4OYB A;  2VQF J;  1BQM A;  1TVR A;  2HKE A;  3FEZ A;  3HFK A;  4A8Q A;  4KHP J;  4FYD A;  1BWE A;  3W8G A;  2XMK A;  5E3A A;  4BWJ A;  2L3M A;  2Z56 B;  4HTI A;  5IM0 B;  2JEG A;  1N5Q A;  3RW7 A;  3RG6 A;  1HWI A;  2V34 A;  4QWB A;  5K14 A;  1WG5 A;  4WFB Q;  2CQG A;  3KXD A;  1MU2 A;  4BC9 A;  1C4A A;  2OHD A;  2CXE A;  2DO0 A;  1VYA A;  1RTI A;  4LBI A;  4WCE Q;  4MMO A;  4X4U A;  4N8N A;  5ETN A;  2OUG A;  5IS2 A;  3BQ1 A;  2B56 A;  1FDA A;  3K5M A;  1S1W B;  2FHM A;  2EG2 A;  2ZJQ Q;  2KXH A;  3H90 A;  1PC5 A;  2IM2 A;  1U1O A;  2EC0 A;  1IM4 A;  2ZNY A;  1VQM S;  3H2V E;  4FZV A;  4NLT A;  4JI6 F;  4KYZ A;  3HMJ G;  4RW9 B;  4ZPB A;  4J9L A;  4PUO B;  4KPY A;  1NHK L;  4K50 A;  3IBC B;  3KG4 A;  3T1Y J;  3Q8S B;  3POT A;  3WC2 A;  4ZVT B;  3RBE A;  1UZD A;  5IT4 A;  2WCX A;  1JJ4 A;  3HKW A;  4JI0 F;  4C2M A;  2HNZ A;  2GQQ A;  3MAA A;  3MEG A;  4HH1 A;  3CCS S;  5E3R A;  4K5S A;  5HQ8 A;  1KON A;  2V8P A;  2BJ8 A;  3MM9 B;  3SYZ A;  3OXF A;  3FDS A;  2F8H A;  3OR1 A;  4OJG A;  4RLE A;  4ZVE A;  5HVG A;  5D6G A;  2X3D A;  5DDR C;  4N5S A;  3KK3 B;  2ZH9 A;  1VQ9 S;  4FF3 A;  2ROP A;  1MNE A;  1RAO A;  1PO6 A;  3T41 A;  4J90 A;  2QV6 A;  3ZZP A;  1FX4 A;  5IXU A;  5L38 A;  3UR0 A;  2CWK A;  2CA9 A;  2PFF B;  3LP2 A;  5IOL A;  4C9D A;  3PDN A;  4KGZ B;  2B51 A;  4CI0 B;  2R4F A;  3KUH A;  2HGM A;  3FZB A;  2FGC A;  3BQ0 A;  5D0H A;  1REV B;  1SL2 A;  2J9D A;  3LP0 A;  3F0N A;  4YQW A;  3G6V A;  1T94 A;  1NDL A;  3KDO A;  4DV5 F;  5C2C A;  1MW7 A;  4ED2 A;  3AD8 C;  2HVZ A;  2V8G A;  1NHU A;  3DOL B;  4DL6 A;  3MR5 A;  1NK0 A;  1S1T B;  3IM8 A;  2GO9 A;  3OR2 A;  1Q7L B;  1D3W A;  1NCL A;  2KU7 A;  3C2P A;  4PUO A;  4IG3 B;  3RU0 A;  4RWX A;  1VGY A;  3VR1 A;  1YVF A;  1NK9 A;  2LQ5 A;  5LMN J;  4FF2 A;  3D6H B;  4HTJ A;  4USU A;  3L7P A;  1HNX F;  3MEE B;  2G1H A;  3BEG B;  2FJW A;  4MJK A;  3SIP B;  4J9K A;  1IR2 A;  2DR6 A;  2YKA A;  1HYS A;  4USH A;  2XLI A;  2CQI A;  3SFU A;  4JI5 J;  1FK9 B;  1RWK B;  1TAQ A;  4WII A;  2R8K A;  4I1T A;  2QL7 B;  5E0O A;  2B3T B;  3DLE B;  3DMJ B;  3NS6 A;  5F8L A;  3QRQ A;  3FEX B;  1RT7 B;  3OD2 A;  4MKA A;  1DZ5 A;  3C6T B;  4IKA A;  2C2R A;  4U7U K;  1VJW A;  3DDI A;  4K4X A;  3KLH A;  4MTP A;  2A6O A;  2VFR A;  5GAD U;  4B3T J;  2XG8 A;  2GIQ A;  2I2Y A;  3R1L A;  1HNV A;  3MM8 B;  3T9N A;  4Q7A A;  1B7Y B;  1Q5Y A;  2ZH5 A;  2QT7 A;  5A2Q Y;  2ZH2 A;  1R8P A;  1Y5L B;  3H8Y A;  2J8S A;  2DGW A;  2RU9 A;  2CQB A;  2V2V A;  3FQK A;  4PXD A;  1UVK A;  4RUC A;  5HMX A;  4LF4 F;  3ILO A;  4K4T A;  1U0S A;  1KFS A;  1ZAW A;  3LAL A;  5C42 B;  2ZM6 J;  4TQS A;  4XTT A;  4CIO A;  3KLV A;  2AKW B;  4LRF A;  2R7O A;  1R3N A;  2C2O B;  5CZX A;  5HMZ A;  2C42 A;  2AD9 A;  4DV6 F;  4NMX A;  1U49 A;  3B8H A;  4ECQ A;  1CS4 B;  1DQA A;  3W7B A;  2XCA A;  1N8R T;  1K44 A;  3ZZZ A;  2PI4 A;  4DWI A;  3MAH A;  5KFX A;  1FEE A;  2RSQ A;  2DY9 A;  2IM3 A;  3PYE A;  1T02 A;  4AND A;  5AE2 A;  2FY1 A;  4YHH J;  2DRD A;  4CT8 A;  2W01 A;  5H9F J;  2CPJ A;  5DZ6 A;  3DLK B;  3OQ2 A;  4BS2 A;  3MEC A;  4YR2 A;  3ZZ0 A;  1ZBT A;  3C15 A;  2W2Q P;  5E2Q A;  5KFB A;  5C7P A;  3TAP A;  4MKV A;  1KP6 A;  4UZC A;  4QIF A;  2KFN A;  4U95 A;  3QAE A;  2PMZ D;  4JOU A;  5KFO A;  3H2L A;  2UVR A;  5HK4 A;  3ISN D;  2MPU A;  1D8Z A;  3ILI A;  2HWI A;  3NCR A;  5HAN A;  4A48 A;  3ULH A;  2DEJ A;  2QIF A;  2LQ8 A;  4EYI B;  1VQN S;  2C1E B;  1Y7P A;  1FJ7 A;  4I64 A;  1UTA A;  5J2P A;  2K06 A;  3U1M A;  2KG1 A;  2QRR A;  4HEA 9;  4CO1 A;  1CQM A;  1GX5 A;  1WEX A;  3KDN A;  3SI8 A;  3BR8 A;  4QWA A;  2W2P P;  1KTQ A;  2QG9 B;  4YY3 F;  2XMT A;  2XSF A;  3AA8 A;  4DR2 F;  1QSS A;  4LFB F;  1S9E A;  2LDY A;  3R5A A;  4EK2 A;  2W9B B;  3H25 A;  2E7W A;  1F3V A;  1MWY A;  3QPI A;  3U1L A;  2BR0 A;  3QRR A;  2DJW A;  1B99 A;  1VRU B;  1BLU A;  2HHP A;  1K0T A;  4WXW A;  1PGZ A;  2ZVI A;  3SQG A;  5KT3 A;  1JLQ A;  1U8S A;  4U6P A;  1T05 B;  3BN4 A;  1JWW A;  4IG0 B;  4C8M A;  2WK4 A;  2Q66 A;  1K8A T;  2H4W B;  2MEW A;  1HNX J;  1LFP A;  2IVY A;  5CCM A;  8AT1 B;  1PSD A;  4FNI A;  1P9Q C;  1WJ9 A;  1HA1 A;  3MZI A;  7FDR A;  5FLX Y;  2HQI A;  5DS7 A;  2HND B;  3IA0 A;  1H73 A;  2OAU A;  2LQJ A;  1RAC B;  2DCU B;  3D6F B;  4LF1 A;  2C3M A;  4U7C A;  2XTJ P;  5J2Q B;  4X4V A;  2V50 A;  1IKW B;  4GO7 X;  2QMX A;  4E98 A;  5HO4 A;  3AJ1 A;  3V6J A;  2WHO A;  1OPI A;  1YK9 A;  2VDH A;  4Y6I A;  2JSX A;  1OO0 B;  4JYA J;  2K7J A;  4EZ6 A;  3OFH A;  4DF8 A;  1H38 A;  3W3S A;  1GXL A;  5HP1 B;  2PN6 A;  3D0I E;  1U4B A;  3GCW P;  1S0M A;  2I0X A;  1OS5 A;  1SIW B;  2VOO A;  2NLW A;  3RB3 A;  2IRU A;  3D1O A;  1XMO J;  4NXM J;  3D1Q A;  5HBM A;  3A8E A;  5BXI A;  3QAU A;  2JWN A;  3BSN A;  4YDX A;  3Q2T C;  1J2V A;  4YB7 A;  2GJI A;  5KT4 A;  3B82 A;  2DTJ A;  2KL8 A;  2YBV A;  4FXV A;  4F02 A;  3FCV A;  2VON A;  1RTI B;  2MY8 A;  2YY3 A;  5EHH A;  5L1J A;  4FBU A;  8RUC A;  2EFN A;  2PA3 A;  3L95 X;  3GV7 B;  4DSI A;  4LF8 J;  4IFY A;  2ZHO A;  4B3M J;  5HN0 A;  2CAD A;  2CNL B;  4GVB B;  1H2V Z;  1S6P B;  4KKO B;  1DJ0 A;  1Z2L A;  1JLF A;  2ZOF A;  3OXL A;  2CPI A;  2C2N A;  3I5A A;  2G2Z A;  4LBH A;  3M9M B;  1FF2 A;  2DH8 A;  2CUY A;  1K1S A;  4TKT A;  1ZS6 A;  3LGN A;  3IBW A;  3THT A;  4CM0 A;  4DI6 A;  4J9O A;  3PJX A;  1BWV A;  2NYI A;  1EX8 A;  2MHE A;  4DSJ A;  4R5P A;  4GVL A;  2W7A A;  4HVZ A;  5GAE U;  4DQR A;  1VQO S;  3O3L A;  4B3M F;  1T9X A;  2B7B B;  2MZT A;  4LT6 A;  1WC0 A;  3SZ2 A;  1HHQ A;  2HHS A;  2KI2 A;  1VFJ A;  3TYT A;  3UD4 P;  3E8O A;  1F2G A;  4RW7 B;  2DNY A;  1FER A;  1RTD A;  1SXL A;  2BE2 B;  3RBX A;  3MR3 A;  1YJW S;  3E01 A;  1X9W A;  5A8W A;  2DR5 A;  2X1G A;  2KHC A;  1XNR F;  5KFD A;  2IIH A;  4QWD A;  1Q81 T;  2D74 B;  4P2X A;  1IKV A;  2ZH1 A;  1T0T V;  4N7T A;  1RTH A;  4EEY A;  4ELU A;  1X4A A;  1PBU A;  1RT5 B;  2AIR B;  3ILL A;  5C5J A;  4P2M A;  2UXD J;  3LOU A;  1NJI T;  1SQG A;  3DN9 A;  1YBT A;  1MSW D;  1UFW A;  4PXE A;  2X1F A;  4FVM A;  1TTH B;  2F65 A;  5CH7 B;  9ATC B;  1UL3 A;  3IC1 A;  1J5O A;  1NB2 A;  2Y0B B;  2XMA A;  3KNA A;  1KVJ A;  2JVO A;  2IMO A;  2JRS A;  3GZ7 A;  4ZLL A;  4L74 A;  1C1C A;  3K2Y A;  4RBU A;  1Q8L A;  1ZOT A;  3MWB A;  4ED4 A;  3CC4 S;  5EN1 A;  5KG3 A;  4DL0 C;  3N28 A;  1KOH A;  3GG1 A;  4R5P B;  2G13 A;  1I6J A;  1AFJ A;  1HI1 A;  1WC1 A;  3K89 A;  3LAM A;  2ZFH A;  3R3T A;  5KFP A;  1GEH A;  3E51 A;  3NOC A;  3QQC D;  4QU6 A;  1MG7 A;  3G87 A;  2DNK A;  4TLR A;  1WHV A;  3UI3 A;  2HFS A;  3VZI A;  4JI2 F;  4ZIW A;  3GFH A;  5BR8 J;  1V5I B;  2KVQ E;  2VKR A;  1HYS B;  3CT9 A;  3O44 A;  3QSI A;  1FK9 A;  5JVH Q;  2RD5 C;  2LYV A;  2BE2 A;  1RT6 A;  2XNQ A;  3OV7 A;  4JV5 J;  2VV5 A;  5HVH A;  3C46 A;  2XY6 A;  1HNW F;  3JTO A;  3A1Y G;  2DR8 A;  2GIF A;  3GJS B;  4IR1 A;  1IKV B;  1IKY A;  1JXV A;  2HLT A;  5AJ3 J;  2YH1 A;  1NME B;  3CE8 A;  1L3K A;  2NZC A;  2Y0S D;  4ZP6 A;  1SC3 B;  3GG0 A;  1IXK A;  4MT1 A;  4OHZ A;  3CME S;  3QBC A;  5KFN A;  1SH3 A;  4OI3 A;  1HBN B;  3EX7 B;  1GH8 A;  4NI2 B;  4K4W A;  4QIG A;  1X4B A;  2RF2 B;  2ROE A;  1N88 A;  3FSY A;  4B3R F;  4FS1 A;  4OZL A;  1VJQ A;  3NLC A;  3VAF A;  2DNQ A;  2EFP A;  2V4J B;  3LP1 B;  1C0T A;  1U45 A;  5E3P A;  5ADZ A;  4RNH A;  2HHH J;  3SEO A;  3SCJ E;  2AEF A;  3AHP A;  5D78 A;  4ZA1 A;  3WDO A;  3WX8 A;  1HHT P;  4HI2 A;  3M8Q B;  3FSI A;  4JV2 A;  4OZ1 A;  2DNO A;  1RB0 A;  3B4M A;  4XAK A;  2KO1 A;  1HWU A;  5ETL A;  2J0Q D;  2FLO A;  4FPR A;  1T9U A;  3MXH P;  2K2P A;  3QGH A;  2A2C A;  4USM A;  2VB6 A;  2MTL A;  4O4G A;  4YB1 P;  2QE5 A;  2E9R X;  1RT3 A;  1X4E A;  3GCX P;  1EP4 A;  1C0U B;  5DDQ C;  1LEO A;  5BYR A;  1UEV A;  5E7O B;  1WF1 A;  4F7V A;  2L9W A;  4WFX A;  4NX9 A;  3PO5 A;  3MPU B;  2QLW A;  2AJQ A;  4FYV B;  3Q8V A;  5HI7 A;  1KWM A;  1X4D A;  4CWB A;  5A2Q U;  5T41 A;  2DGX A;  2UP1 A;  4CYU B;  4PWD A;  3I31 A;  4CTA B;  2WOM A;  3MAQ A;  2QA4 G;  3V6K A;  3VGT A;  2FVR A;  1O5J A;  2BUN A;  4YS2 A;  1VK8 A;  2J7W A;  4K4Y A;  5D0G A;  3NBP B;  3BGR B;  3IO1 A;  1TFY A;  4I6Y A;  4ED5 A;  2WVD A;  1VHI A;  5IC6 B;  1UPM B;  2RF2 A;  3ZXW A;  3JYT A;  3D28 A;  3PY8 A;  1FJG F;  2I1R A;  1RHM B;  2GO8 A;  3D0H E;  1C0T B;  3M05 A;  1XEZ A;  2GHW A;  3JAM Y;  1TUV A;  1IR0 A;  4Y2M A;  1WSR A;  1KSP A;  4IQX A;  3K7R A;  4FXW A;  4I0W A;  2CWX A;  1RSC A;  1R31 A;  1BD6 A;  2WW4 A;  4QR2 A;  3ZTP A;  2UV8 G;  1FX2 A;  3FRY A;  2WZ1 A;  3SCL E;  1YHQ S;  1VRU A;  5F8H A;  4B9L A;  2FHO B;  2MKJ A;  4DL3 A;  3DLH A;  4B9T A;  4JI4 J;  2F9J A;  5A6W A;  5BJR A;  2J0S D;  2A1B A;  2AX1 A;  2MLY A;  3BH7 B;  2LXF A;  4NYZ A;  1CJK A;  2B0G A;  3FSX A;  3MUR P;  1VR6 A;  2XYH B;  1AUD A;  3SMZ A;  1YRU A;  2LQ9 A;  1UA0 A;  2M8D B;  2LA4 A;  1OPZ A;  1VHF A;  4I7F B;  1NB7 A;  1RWO B;  4ZPC A;  3FZ2 A;  2LU2 A;  1UMJ A;  3TX0 A;  1TUW A;  5HL7 Q;  3VGV A;  2RDJ A;  2M4M A;  1YJ9 S;  1HBO B;  3AD7 C;  1L5U A;  3GPA A;  4KHP F;  1VRT A;  4TVA B;  3D9B A;  4ED7 A;  2IDL A;  1RGV A;  3OL7 A;  2RQC A;  3GB0 A;  1EAY C;  4CLY A;  2EPI A;  3CIZ A;  3M1V B;  4OIX A;  4DPO A;  1BE4 A;  2GAG C;  4YME A;  1V3Z A;  5GAD I;  4PR6 A;  4EZ9 A;  3FJ2 A;  3EWG A;  1YRX A;  2VC1 A;  4DQQ A;  4XK8 C;  1GXU A;  3TI0 A;  2FZC B;  1UWB B;  2B9X A;  2BJ3 A;  2CG4 A;  1ELO A;  2KRR A;  3G82 A;  4UF4 A;  3ZZU A;  2XGQ A;  5L1L A;  1TKZ A;  4F4X A;  4DF4 A;  3OSP A;  2A18 A;  3R7B B;  5KT5 A;  1G3O A;  3R5D A;  5IFM A;  2WON B;  3UN3 A;  4HL9 A;  1ARO P;  3FK4 A;  2AJ2 A;  4RO0 A;  2OEK A;  4CH7 A;  2CPY A;  3QWP A;  4USI A;  5J1P A;  1GAO A;  3G6E S;  4DS5 A;  1RKJ A;  1AW0 A;  4X4P A;  1FKP A;  1HWJ A;  1RBL A;  3I82 A;  2ZHA A;  4L3N A;  2DPI A;  1LK7 A;  1BQM B;  2DEI A;  3NNC A;  1FO1 A;  1D9A A;  3PW0 A;  3ISN C;  4Y2I A;  4R0E A;  3QJJ A;  4MKY A;  3DXS X;  1G4C A;  1R27 B;  2P9G A;  2I38 A;  1VQK S;  1FXD A;  1EET B;  3UN5 A;  3TRG A;  2NUH A;  4AT1 B;  3KMS A;  2WSE C;  3HVA A;  1T03 B;  3NCQ A;  1FE0 A;  2BAN A;  2AYM A;  4A8K A;  4FYX B;  1SI9 A;  1NK5 A;  1REG X;  3Q22 A;  3HD1 A;  3TZZ A;  1CJU B;  2HRU A;  3W61 A;  2HS3 A;  3KJN B;  3QIP A;  2O01 C;  3PCO B;  4RW8 A;  3DCA A;  2GFF A;  1BUX A;  1NDC A;  5HVF A;  3GTY X;  5HJX A;  2OKQ A;  1EZZ B;  4C98 A;  4DX6 A;  5LT5 A;  1NPP A;  2VA2 A;  1BQX A;  1S7I A;  2HEK A;  4F2S A;  4NXM F;  2OTJ S;  5D8H B;  3PFO A;  4DV2 J;  1KC8 T;  2MKS A;  2HHH F;  1Q95 G;  2R8I A;  1S4F A;  2UU9 F;  2M2B A;  4ZVS B;  3NAH A;  1Q53 A;  1KKH A;  4RNF A;  2DRB A;  4Z2X A;  1VBK A;  3W9I A;  1F5A A;  1RJJ A;  1U6Z A;  1HNI B;  1H0H B;  2DNN A;  1KVK A;  2QLX A;  2VL1 A;  1WHX A;  4FNH A;  4S0M A;  1W2B R;  4K4S A;  2ZBQ A;  3BKT A;  3POT B;  4KB7 A;  1EB0 A;  1TL5 A;  3QMQ A;  2V2Q A;  3NKY A;  4PYD A;  3R7S B;  3UVJ B;  4B9V A;  2Z2Y B;  1S79 A;  3B54 A;  2X1B A;  3CCL S;  5SUH A;  2FGO A;  2RU3 A;  3M8P B;  2UUB J;  3KFW X;  4NLR A;  4CO3 A;  3VAI A;  2F5G A;  1ICE B;  2XSJ A;  2OPR A;  4NRU A;  3EZ5 A;  4ZCK A;  2D9O A;  3G4S S;  4KJI A;  2E44 A;  3C6U B;  2FLP A;  1YWX A;  4ECV A;  4CLZ A;  1XBW A;  1XK8 A;  3HHL C;  4JV1 A;  1I1G A;  3MR2 A;  1UKU A;  2WBM A;  1VC6 A;  2V8D A;  4HHH A;  5B0A A;  4IRD A;  2RUS A;  1FRK A;  2ZOG A;  3M8Z A;  4M5M A;  2HRY A;  2DNR A;  2RQM A;  3IXQ A;  3PG9 A;  1N6Q B;  1H2U X;  2FJD B;  3DRR B;  4DEZ A;  5HRO B;  4NA2 A;  5HLF A;  2KVI A;  3D7S B;  5KFJ A;  2ZWO A;  1QUV A;  5JUM A;  2QEX S;  2Z30 B;  3FMW A;  3ONQ A;  4BLG A;  3EYZ A;  3V81 B;  1MN9 A;  1PIE A;  3GII A;  3K5P A;  4ES3 A;  1VCT A;  3G8T A;  4M5D A;  2VG5 A;  2EW9 A;  4LF7 F;  4USK A;  2DXE A;  2P9E A;  4NCG B;  4OZN A;  5LSL A;  4ER8 A;  2R42 A;  4X4N A;  2COL A;  2ZDP A;  3EM1 A;  3DYA A;  2W9A A;  2FVS A;  4D3G A;  4A46 A;  3QID A;  3NL0 A;  1RAD B;  1DUR A;  2Z58 B;  5GME A;  3QJL A;  4FYY B;  3H4B A;  2AMC B;  4MKB A;  5L1I A;  1HMV A;  1P1T A;  2YKM A;  3LH2 S;  4UOC A;  4EFA C;  2FZG B;  4DQP A;  2QJ3 A;  3V6D A;  7FD1 A;  2GHP A;  4IUF A;  4ES1 A;  2AWZ A;  2J0X A;  8ATC B;  3KHH A;  5DQH A;  1UA1 A;  1SV5 A;  2QSF A;  3AJD A;  1NSA A;  2WVE A;  4M1K A;  3MOJ B;  1FFW B;  3DC2 A;  5IWA F;  4ANE A;  3MM5 A;  2EVZ A;  4FDF A;  3A8J A;  1NK7 A;  1VRQ C;  2IHR 1;  3HI9 A;  3PYF A;  5EUH A;  3S8S A;  2GVZ A;  4FN5 A;  3T5J A;  1N6Q A;  1LXJ A;  2IVM A;  4XO0 A;  4NEZ A;  4J9N A;  4EI2 A;  4F4W A;  2MQM A;  2FVP A;  1U1P A;  2ZUG A;  3HZG A;  1PYT A;  4XPC A;  4LIW A;  1SUQ A;  5C42 A;  2K3I A;  2IBO A;  3H20 A;  3HVT B;  2BM1 A;  2MJN A;  3EIC A;  3UPF A;  1QUP A;  4N41 A;  4USW A;  3ZTR A;  3I32 A;  1VBZ A;  5KOW A;  2YQ3 A;  5DG7 A;  5KFV A;  2K1R A;  1V3R A;  4M5J A;  5M2P A;  2D7S A;  4LFC J;  3V4I A;  4ZLP A;  1VLO A;  4NE9 C;  3NMR A;  2LEC A;  4NXN J;  1SBR A;  3W2V B;  1WKK A;  1HMV B;  3W8P A;  5GAH U;  2J9E A;  2E5J A;  5GAH I;  1D9D A;  4HT7 A;  3TJ8 A;  2R2U A;  4H54 A;  2N7Y A;  3DDN A;  4WZM A;  5AXN A;  4WTO B;  2VBX A;  1RT4 B;  3NAI A;  3PTW A;  2GV1 A;  4H4K C;  3MMJ A;  4R25 A;  3EMT A;  1TKT B;  3I5B A;  4DPY A;  3W1Y C;  4ZLN A;  2R7R A;  3JSB A;  4G1P A;  2CJY B;  3H5S A;  3RYL A;  1RQ0 A;  2J0W A;  2EK6 A;  1HBM B;  2P8I A;  3PYD A;  1RTZ A;  3D3C J;  4X4R A;  1BXN A;  3ITH A;  1CJT B;  1TL1 B;  2UUA F;  1JLB A;  4IH7 A;  1X60 A;  2E1M C;  2VZ9 A;  3R5G A;  1ZAV A;  4DR3 F;  3GFZ A;  3BF4 A;  2W9B A;  2XY7 A;  3TR5 A;  3UDC A;  3K58 A;  3BGF A;  2BDP A;  3UNY A;  2ATC B;  4KHR A;  5K8N A;  2BBE A;  3FKB A;  3I9Z A;  3VAM A;  1GMU A;  4WPA A;  2F40 A;  1JLG A;  2VAS A;  4H4O A;  3CJK A;  3BB5 A;  3BGU A;  2HHQ A;  1WF2 A;  1UVL A;  3AJ2 A;  3CD6 S;  1CC7 A;  1WG4 A;  4CDI A;  3PHT A;  4DQI A;  3CCQ S;  5G0R B;  2J5A A;  4QOT A;  4TY9 A;  3K5O A;  1CSJ A;  4I67 A;  1SPB P;  4PZV A;  5LMN F;  2OH2 A;  1FJG J;  3BGO P;  3H4D A;  1HQE B;  4LF9 F;  1IKW A;  1TL7 B;  4LRB A;  1FNX H;  1AA1 B;  5EWE A;  4RX6 A;  2KT5 A;  5KG1 A;  4JI4 F;  2KG0 A;  2RDI A;  3M4X A;  4ZIT A;  1K73 T;  2C22 A;  4ZKA A;  3MM9 A;  2QFJ A;  2EEY A;  2NXN A;  1IBL F;  1XIQ A;  4AD6 A;  3KK3 A;  2NCK L;  3O8W A;  1EKS A;  2ZBR A;  2J7U A;  4DCP B;  3OUY B;  3M8Y A;  5HBM B;  5LMU F;  2HYI B;  2XQC A;  1B0V A;  4PG8 A;  2EKN A;  3TAM A;  1M5V C;  1WF0 A;  5FD1 A;  3LP2 B;  4E2F B;  1N0U A;  1RAH B;  2XMM A;  2F3J A;  3ENA A;  3OR1 B;  5B0C A;  5KG7 A;  5GAG I;  4HYK A;  1N56 A;  5FDL A;  4KH0 B;  4OYO A;  2M70 A;  5KG6 A;  4PPZ A;  2A10 A;  1U26 A;  2PII A;  3KLI A;  3MPV A;  4GO5 X;  1R0A A;  3G8S A;  1LW0 B;  3KKF A;  2LFV A;  4TXS A;  3Q83 A;  1MWZ A;  3LGH A;  3J7Y U;  3CCM S;  3PX0 A;  2ZD1 A;  3M2U A;  2XBP A;  2Z2Z A;  1F9F A;  3W9J A;  3G96 A;  2VHG A;  1AFI A;  2EFQ A;  4ANC A;  1HQE A;  2N3L A;  2DHG A;  2ZKU A;  3V4M A;  2I8E A;  5A76 A;  4X4T A;  1JLE B;  4YB6 A;  4PG7 A;  1SIZ A;  3C19 A;  3TEH B;  3UNG C;  4NRT A;  4CO2 A;  1HQU A;  3BH6 B;  1RDR A;  1HNI A;  5LJ5 Y;  4YR0 A;  4EYH B;  4KPC A;  4YDD B;  4LF8 F;  2ASJ A;  5ETV A;  2OEM A;  4QIE A;  1CJV A;  1HD0 A;  2Q6C A;  1NKE A;  1PG5 B;  3EZO A;  4M63 A;  4RL1 A;  4AFF A;  5KFS A;  2HBR B;  1SKS A;  2AJ1 A;  4N56 A;  1RYR A;  4CRJ A;  1YDL A;  5CAB A;  3M8P A;  2MZ1 A;  4LF6 J;  2Q6B A;  3TJA A;  1T9Y A;  3KLG B;  3D68 A;  1HNV B;  3MM8 A;  1S10 A;  5FDL B;  1RI7 A;  3TVZ A;  2DNH A;  2HZC A;  4NZ0 A;  1UEU A;  3P5B P;  4QJV A;  4Q8F A;  3FUY A;  5DDP C;  3I5C A;  3IAM 9;  2H4Y B;  5GVQ A;  4PYA A;  2CQH A;  2Y1J A;  1Q82 T;  1TZ0 A;  2IMW P;  2AJ0 A;  1B0T A;  4KE5 A;  2GML A;  1GTE A;  1FRX A;  2LXI A;  3CDB A;  4J5O A;  3WIV A;  1FFG B;  3QZ7 A;  1X7V A;  3GV5 B;  2VC0 A;  1T3N A;  4LR7 A;  2W2N P;  2L9N A;  3HSJ A;  3ENW A;  4ICL B;  2JFD A;  4I68 A;  1RWW B;  4RU9 A;  4LIR A;  3Q8Q B;  3FVY A;  3ISZ A;  2CNO B;  3DHX A;  3ZZY A;  2VDI A;  1TR0 A;  4USJ C;  2BAB A;  4QYZ K;  3MMC B;  2FJA B;  2W4C A;  3FBF A;  4CLP A;  5I3U A;  2ALZ A;  5CQG A;  3CJ4 A;  4CO0 A;  1RU2 A;  3OTO J;  4IO9 Q;  3GIR A;  3TAQ A;  3KMQ A;  3GP9 A;  4P72 A;  4QPT A;  5G4D A;  4LFC F;  2DGO A;  1NK4 A;  1Z2Z A;  4F25 A;  2KT3 A;  2R3V A;  4ILL A;  2AU0 A;  4OX7 A;  1PYO B;  4WU2 A;  3CD7 A;  1H6K X;  2XWX A;  1TUG B;  4J7C A;  5D4L A;  3RJM B;  2RS2 A;  2CJK A;  4WFN Q;  2ASD A;  1QAJ A;  4JYA F;  2HBQ B;  2VH7 A;  4DV4 J;  3FQL A;  1WSV A;  1U25 A;  4LQ3 A;  4DUT A;  3K59 A;  1KR4 A;  2X51 A;  3DLK A;  4U96 A;  4NZ6 A;  4Y00 A;  2FJB B;  2YNH B;  3E3X A;  3EGZ A;  4MYT A;  2RKI A;  1Q86 T;  4DPW A;  2R8H A;  4WK3 A;  1FWK A;  4WJB A;  3GMG A;  2QA2 A;  1O6X A;  4KO0 B;  3TX8 A;  3W5Y A;  4LRC A;  1U24 A;  2HS4 A;  3HX9 A;  3L9Z A;  5CCL A;  5KFT A;  1X9S A;  2GJF A;  5AE1 A;  1N5Y B;  5HJY A;  1H3D A;  1G2E A;  1RXO B;  1JB0 C;  2AZ1 A;  3K8V A;  4M5N A;  1BY9 A;  1SL1 A;  2AEM A;  2VBZ A;  3CTR A;  3GR1 A;  2XGP A;  2UUA J;  2ZIT A;  3BKU A;  3OHB A;  3BN7 A;  3CDE A;  3PO4 A;  5B0F A;  5I42 B;  1QAX A;  2C2M B;  1VQ7 S;  1N34 F;  4KGV B;  4KGX B;  1IM6 A;  3T5K A;  4DR7 J;  2AYE A;  2MDA A;  4A8O A;  1DHM A;  4B9U A;  1FWL A;  1YZ7 A;  3GJT B;  2CNK B;  2ZH7 A;  1RT2 B;  1URN A;  4AUK A;  1RT1 A;  3H0P A;  4FF1 A;  3HSG A;  3O5T B;  2RAQ A;  1NU4 A;  1ULR A;  1UP1 A;  1Q8I A;  3HHL A;  4ZPD A;  1YJT A;  4DL4 A;  1XMO F;  3QFH A;  1SJ4 P;  4B02 A;  4K0K J;  2PEB A;  3MM7 A;  1SJR A;  1IBK F;  3UWT A;  3HFZ B;  2IDE A;  3M6V A;  1C0U A;  2J7K A;  1IBL J;  2VQF F;  1FTC A;  3MUT P;  5DDO C;  1ZA1 B;  1T3O A;  1RWP B;  2EBE A;  2E1R A;  3UDE A;  1HNZ F;  2M3D A;  4EO8 A;  2XY5 A;  4TLQ A;  4PG5 A;  2E5I A;  3Q86 A;  4Z37 A;  1FCA A;  2FJE B;  2NPI A;  3TA0 A;  4URG A;  3OL9 A;  2JEJ A;  2HND A;  3FCH A;  2KKH A;  2DXD A;  5KFM A;  5HP1 A;  2XMV A;  4CYU A;  2LEB A;  1NK6 A;  4WTY A;  2IRX A;  3GFX A;  1UJ4 A;  2ZZN A;  2XZW A;  3PIP Q;  4DV0 J;  2YNF B;  1YJ7 A;  4PRF A;  1VOM A;  4NLO A;  1YBU A;  4B3T F;  4LBP A;  2FDN A;  3D2W A;  2FJX A;  3IAS 9;  2QMU B;  5F41 A;  2PI5 A;  3R5C A;  2MKY A;  4ZPA A;  1MRO B;  3MPW A;  3NGU A;  4DJB A;  4J9R A;  2MQ8 A;  3FEY B;  4LRA A;  1QTM A;  2WW8 A;  3C66 A;  3IRW P;  1N33 J;  4DSL A;  1KDN A;  2AP6 A;  3CCU S;  4IFY B;  4TY8 A;  4Q44 A;  2KYX A;  3T3F A;  2RNE A;  4O3S A;  4PG4 A;  4GKK F;  1S6P A;  2V5H G;  1E6Y A;  1JLF B;  4PKD B;  1FDD A;  3A4T A;  1CJK B;  3WBZ A;  4NLG A;  2YWH A;  2DRA A;  1H2T Z;  2WB1 D;  4EU0 A;  4JP8 A;  1WI8 A;  2CDR B;  4DSF A;  4O44 B;  2L41 A;  3D66 A;  2EFG A;  4F4Z A;  4DLG A;  4I7F A;  4LF9 J;  4GVB A;  3WIU A;  2AZ3 A;  2WSC C;  1G7C B;  2G9O A;  2IFX A;  3A8I A;  3OVB A;  4A47 A;  1TVR B;  3MTJ A;  5HSP A;  3LTO A;  5KTQ A;  3CJ5 A;  1ZH5 A;  1JJC B;  1JXE A;  2MZQ A;  2YNI B;  4IDK B;  1N32 F;  2HHT A;  1QJH A;  1U8W A;  2AJF E;  3ET6 A;  4PAA A;  3BJY A;  2JX2 A;  4LF5 F;  1LWC A;  4O3R A;  1SH0 A;  3HHK A;  1S99 A;  4R8U B;  1RBO B;  1O8B A;  1SC1 B;  4JUZ A;  1KN6 A;  1P9Y A;  4JB8 B;  2V68 A;  4A8X A;  1HBO A;  2IBK A;  1S1X A;  3KYL A;  1UET A;  2EXU A;  4ERD A;  2LDI A;  3JXO A;  2MZS A;  4QIV A;  3G8Q A;  4P7T A;  3AXM A;  2R7X A;  3ADA C;  2QL5 B;  1YBA A;  3MI7 X;  2DY1 A;  4PQA A;  3MFH A;  2UXC F;  2HHX A;  4CCH A;  2BW7 A;  1UVI A;  5L8R C;  2GA7 A;  4C8N A;  3K8W A;  3R97 A;  1D09 B;  1E6V B;  2CFX A;  1VDH A;  1SC4 B;  2CQC A;  2QGF B;  3HVW A;  5CYM B;  4GRS A;  3CF5 Q;  4MIB A;  4RW9 A;  2IPO B;  3CJ8 A;  4WE1 A;  1ZTW A;  4LVN P;  2KDO A;  3QLH B;  3DOK A;  3R27 A;  4ZK7 M;  4HKQ A;  2W2M P;  2O66 A;  2UXB F;  4F67 A;  1P6T A;  1NZA A;  2CQD A;  2KZM A;  3K5N A;  5JJB A;  4DCO B;  3PKM A;  2VPZ B;  3D0G E;  4DX5 A;  4DV3 F;  2HFZ A;  2GW8 A;  5KFG A;  4C3M A;  2E5L J;  4DR5 J;  1JNR B;  2B7C B;  2FB0 A;  3CDU A;  5I3Q A;  3TUZ C;  2ZBC A;  4ED3 A;  2QLB B;  2QX0 A;  2YNI A;  1S9F A;  4N47 A;  4W90 B;  3CED A;  4Q2L A;  4JI2 J;  4K4Z A;  1DLO A;  1GQE A;  4KV8 B;  3ZO7 A;  1RT6 B;  2KRB A;  4K8R A;  1BQN A;  1U0H A;  4F3O A;  2OPS B;  2MZJ A;  2VPX B;  1TK8 A;  2AW0 A;  4HT5 A;  2ZNZ A;  3HHE A;  3OSN A;  2FHJ D;  4NLP A;  1T03 A;  5EX0 A;  5F0U A;  3BKF A;  2QFI A;  2AJ4 A;  4ETZ A;  2ERR A;  3OLB A;  2J9D E;  4Y65 A;  4USV A;  2Q3P A;  3IWL A;  1OSD A;  1FI4 A;  2HAI A;  3J7Y I;  4QYR A;  3T1Y F;  1X5T A;  1RHR B;  3UQS A;  2CQ0 A;  2E1P A;  2HGL A;  2VU5 A;  5LJ3 Y;  1NPK A;  5J1N A;  1IKY B;  3OR2 B;  4WE1 B;  1ZTT A;  2EG1 A;  2Z0G A;  4RW4 B;  3LWM A;  1JKH A;  1HPZ B;  2R2T A;  2HPU A;  2QYG A;  3R9L A;  5EGY A;  1H72 C;  2XZT B;  3QJP A;  4L75 A;  4ICL A;  3OBI A;  1M1H A;  4C7Q A;  5ETQ A;  1D1U A;  4X65 J;  1T11 A;  2XHW A;  3RUB L;  3J81 Y;  3SDE B;  2ILY A;  4LSL B;  4OV1 A;  3SCI E;  5A8R A;  1R89 A;  5DG9 A;  5KT6 A;  1HNW J;  2RE1 A;  2L9D A;  3EVO A;  4H4M B;  3R1H A;  1FHT A;  3I9V 9;  3PKY A;  3RGI A;  4OZ2 A;  1KLM A;  1R6V A;  2R7Q A;  5F8N A;  4WYW A;  5RUB A;  1YRT A;  2OPS A;  1R0C B;  1QE1 A;  4B3S F;  4P71 A;  2NS1 B;  3MD3 A;  2U1A A;  3GIK A;  2DBB A;  3HSD A;  4RKU C;  2CNN B;  2B6A B;  2YWK A;  2DT9 A;  3I56 S;  1RTJ A;  2WBR A;  3NY0 A;  4ECX A;  4WKR A;  3J81 U;  1EHW A;  4ES2 A;  3C6U A;  1HD1 A;  2WOM B;  1M90 T;  2E5L F;  4DSE A;  2OP5 A;  1KQK A;  2RML A;  2SXL A;  4QQB A;  5H9E K;  3BGR A;  3BM7 A;  1IBM F;  2YNH A;  3DFE A;  4LR9 A;  2OSR A;  3JQM A;  2PFD A;  4BBY A;  3JTN A;  3RAM A;  1FDB A;  4H4K A;  4IFV A;  3M6U A;  4KO0 A;  2IJR A;  2O3D A;  2RHS B;  1HI8 A;  3H7H B;  3IMQ J;  3OTC A;  1VQY A;  1FRI A;  2I5J A;  1S0O A;  1FKO B;  2DGQ A;  3EPG A;  3DRP A;  4IH6 A;  1S97 A;  1U2C A;  1N33 F;  3C8Y A;  4ZVU B;  3MCN A;  5KFY A;  2W1B A;  2MHN A;  2F63 A;  2BZ2 A;  4Y2K A;  5A8K A;  1F3F A;  5DQI A;  3DM2 A;  2XO6 A;  4DU7 A;  3MD1 A;  3VHQ A;  4Q0B B;  4ECZ A;  3GON A;  1A7G E;  3ZZT A;  3S01 A;  2PA8 D;  4ZS6 A;  4F26 A;  2GMJ A;  2AGO A;  2H51 B;  2MGZ B;  1S4E A;  1J5E F;  1R8A A;  2LEP A;  1UAW A;  1W7W A;  5B0D A;  3PM9 A;  1NDK A;  1QE1 B;  2RH3 A;  4MK9 A;  3UO0 A;  2KXN B;  4LF6 F;  4WF9 Q;  1F5C A;  2B6A A;  4WIQ A;  4CZC A;  1FDN A;  4F50 A;  1UJ6 A;  2B4O A;  4DMZ A;  3L09 A;  3AAW B;  3GE9 A;  3W62 A;  3PAC A;  2QZ8 A;  2QSW A;  1IBK J;  5JVG Q;  3OFE A;  2N3O A;  5J2P B;  4B9M A;  3GJR B;  4C0H A;  3VAK A;  1HW8 A;  1V3S A;  3M9N B;  2HQF A;  5IZH A;  2O1P A;  1Q5V A;  4WU3 A;  3I4P A;  4B9S A;  4X64 F;  2PC6 A;  3DRP B;  1HAR A;  3KNG A;  4F0K A;  4DV4 F;  1VBY A;  2RHQ B;  2YX7 A;  4WP3 A;  1NJZ A;  1U7L A;  3JS9 A;  3V4I B;  5K9F A;  4CLS A;  1YJR A;  4KTQ A;  1D0E A;  1SQE A;  1S7H A;  4U67 Q;  2PMH A;  4CM2 A;  3NP5 A;  1VMB A; 
#chains in the Genus database with same CATH homology
 3JAM U;  4JI2 J;  4LFA J;  4OX9 J;  4DR6 J;  4JI7 J;  2UUA J;  4AQY J;  2ZM6 J;  4DR7 J;  1I94 J;  4DV3 J;  4X62 J;  4X64 J;  4JI4 J;  2UUC J;  4DR1 J;  5LM7 E;  2UU9 J;  4K0K J;  2VQF J;  4LF7 J;  4KHP J;  2UXC J;  4JI6 J;  2UXD J;  4LF6 J;  4YHH J;  1IBL J;  1N34 J;  4DV1 J;  5LMU J;  1XNR J;  4X65 J;  4DUY J;  4LF5 J;  4GKK J;  4JI0 J;  1HNW J;  1N32 J;  4DV0 J;  1J5E J;  4DV7 J;  4KYZ A;  1HR0 J;  4JI3 J;  4B3R J;  1XMQ J;  2KVQ E;  3T1Y J;  4DV6 J;  3J81 U;  2MQ8 A;  3T1H J;  3J80 U;  1N33 J;  1IBM J;  4JV5 J;  2VQE J;  4NEZ A;  3J7A N;  5AJ3 J;  4LF4 J;  4DR2 J;  4KY3 A;  3IMQ J;  5IWA J;  4LF9 J;  2MEW A;  1HNX J;  4LFB J;  4LFC J;  4JI1 J;  2HHH J;  4NXN J;  4V1A k;  1N36 J;  4GKJ J;  4DUZ J;  4RJV A;  2UXB J;  4JYA J;  1HNZ J;  4DR3 J;  5IT9 U;  4DV2 J;  4PWW A;  3W1Y C;  2MTL A;  3OTO J;  3R2D J;  1XMO J;  3D3B J;  4NXM J;  3D3C J;  5LMN J;  4X66 J;  3R2C J;  1IBK J;  2KL8 A;  5A2Q U;  4JI8 J;  1XNQ J;  4JI5 J;  4DV4 J;  4DV5 J;  5FLX U;  4LF8 J;  4B3M J;  4YY3 J;  4DR4 J;  2E5L J;  4DR5 J;  4B3S J;  4B3T J;  2UUB J;  4HHU A;  4NEY A;  5BR8 J;  1FJG J;  2F4V J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...