2MEWA

Solution structure of nuse (s10) from thermotoga maritima
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S10
publication title Solution Structure of NusE from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Structural protein
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mewA00
1IBKJ 4JV5J 3R2CJ 1HNWJ 4RJVA 3OTOJ 4V1Ak 4DV6J 4K0KJ 4GKJJ 4NEYA 4JYAJ 4B3SJ 4B3TJ 1N34J 5LMUJ 3R2DJ 4NXMJ 2UXBJ 2HHHJ 3J81U 4OX9J 1XMQJ 4JI6J 4DR1J 4B3MJ 1IBLJ 3JAMU 4YHHJ 5IT9U 4JI5J 4DV4J 4DV0J 2VQEJ 5BR8J 2KL8A 5LMNJ 4NEZA 4B3RJ 1N36J 4DR7J 4YY3J 4DV2J 4JI7J 4JI3J 1J5EJ 2UXCJ 4HHUA 4DV5J 2UUAJ 1N32J 4KHPJ 4KY3A 4X66J 2UXDJ 4JI1J 4DV3J 1I94J 4DUYJ 3T1YJ 4LF6J 4JI4J 1XNRJ 4LFAJ 5A2QU 3J7AN 1IBMJ 3W1YC 2ZM6J 4DV1J 2E5LJ 5FLXU 2UUBJ 3D3CJ 4JI0J 4DR4J 1N33J 4KYZA 2MTLA 4LF5J 5LM7E 4X65J 4LFBJ 4X62J 4JI8J 4AQYJ 1HNXJ 1FJGJ 3T1HJ 2MEWA 4LF8J 4LFCJ 3IMQJ 3D3BJ 4DV7J 4X64J 4DUZJ 4GKKJ 1HR0J 1XNQJ 2MQ8A 2UU9J 5IWAJ 4LF7J 4LF4J 4LF9J 4DR2J 2VQFJ 2KVQE 1XMOJ 5AJ3J 3J80U 2UUCJ 4DR3J 4DR5J 2F4VJ 1HNZJ 4JI2J 4DR6J 4NXNJ 4PWWA
chains in the Genus database with same CATH superfamily
2DK2A 3PM9A 4FYWB 4BC9A 4BHQA 2KYXA 4URGA 4J91A 5T7LB 1M5OC 2H51B 4UOGA 4N56A 3CO9A 1XC9A 3M6WA 2BOAA 4B3TF 2P6TA 3V81A 2DH9A 1FDBA 3H7HB 5F8HA 3EGNA 3EE3A 4TLRA 4DCPB 2VPXB 4O3QA 3M2UA 5AT1B 3GIIA 4CLZA 2ACYA 3F56A 2LDYA 2BQUA 2E1AA 2CZVC 2CQ0A 2O5DA 1HYSA 1NPPA 4HI1A 2YKMA 2I5JB 3MAAB 2HQIA 2DRDA 1MMLA 3OLAA 1AFIA 2HNYB 3IWLA 3WIVA 2J9DE 3HF5A 1VQ5S 2YKAA 3NLCA 2WK4A 2Q1LA 1UJ4A 1KQSR 2K1RA 5F41A 4LRDA 3T19A 4LF9J 3FEZA 3U1LA 4P2FA 4IDKA 1S99A 2HPUA 4RBVA 2HIQA 4ZK7M 4X4VA 3THPA 2DNLA 5CAAA 4K0KJ 2DYAA 3DLEA 2KRRA 4YR0A 3THVA 3KDNA 3I56S 4OV6A 2YNIA 4PWDA 5FJ4A 2XGQA 1X4EA 4AYBD 1NMEB 3OFHA 2YWFA 2XS2A 3R5GA 3MDFA 3N5BA 3MMCA 2IM2A 3NOCA 5JXSA 1PO6A 2M88A 3C6UA 4YN3B 2I2YA 3T5HA 3PJ9A 1HD0A 3NP5A 5D15A 1NK9A 3GP9A 3QWPA 4DFPA 3OVAA 5C7PA 2XLKA 4B3OA 5E3CA 3DM2A 3UE2A 2JHEA 3T1AA 5HMXA 2VFTA 4ZVOB 3A8KA 2CVIA 2BRKA 4RW9A 3ELHA 1HNZJ 2OPPB 3IWNC 4WP9A 1MU2B 2R7SA 4L75A 4JB8B 3A8JA 3OXFA 3C2PA 3BKTA 4LVNP 3T1HF 2C42A 1X9MA 1WORA 3VGSA 3KLGA 3MM6B 1Y7PA 3CCVS 2RNEA 3TA0A 4RW8A 1NJZA 1J27A 4QPTA 1SJFA 4WE1B 3KUGA 2EC2A 4ECVA 3R3TA 1JNZB 1RXOB 2EFVA 4OZNA 4FPRA 1NZAA 3A3OB 2OD6A 4QPXA 5I3UB 5KFMA 4YY3F 4LF6J 2IDEA 2MKSA 3R7NB 2AEFA 3V4MA 4C8MA 4CLTA 3D7SB 3BO3A 4WZQA 2FJWA 2KB2A 2XMVA 2BM0A 4A8WA 4Y00A 2CPEA 2G9OA 3MI7X 1K0TA 1NUEA 4PXEA 1CJUA 3M8SA 3PV8A 2PO4A 2OFHX 2HGMA 1NXIA 4UY85 2AX1A 4DPXA 5J1NA 2QJ3A 2VL1A 1RWOB 1SVDA 2GMLA 4I68A 2IRYA 4LFAF 3RR7A 2XY5A 2BEFA 4OYIA 3K5NA 4P2MA 2BYCA 2WB4A 1KTVA 4YB1P 5FD1A 4BWMA 3O3LA 5LMUJ 5F8GA 3R1LA 4C0OC 1UP1A 1CS4B 3CJKB 2NXNA 2ILYA 3M32B 3CMES 2DR6A 4ICLA 5HAOA 4ENOA 2GW8A 4WKRA 5CZXA 4I69A 5ETLA 2HMIA 4FS1A 2HNDB 3FSIA 4H4MA 5DM7Q 1TV6B 4CO0A 4C7QA 3QO9B 4QIGA 1RTIB 4ZHRA 7FD1A 3NBPA 3EMTA 1S9FA 5IC6B 3K5OA 4RZRA 2ZBRA 1VR6A 1RA7A 1UVMA 5DGBA 3FCWA 1H74A 1SCJB 3G82B 2QYCA 4P71A 4EBDA 4AQYF 3BSOA 2XWYA 3G8QA 2AW0A 4J9KA 2W2NP 4B9MA 5J2MB 1NSKL 1IKWB 2UU9F 5E33A 2Y8YA 3GJQB 2DGUA 4P10A 1VQOS 4WFXA 1NJWA 2YKOA 4EZ6A 2MQLA 3PYDA 3BQ1A 3N4WA 2R2RA 2V8VA 1KOOA 4PQAA 1K47A 4KO0A 4JBCA 5AXMA 3MHYA 3FMWA 4MKAA 2VQFF 1YJUA 3PNIA 1QAYA 2HZAA 5HVFA 4P2XA 1J5OA 2B9EA 2BE7D 1FKPA 3OL8A 1UVLA 2HHQA 5B0AA 1SJ1A 4Q7AA 1XBWA 2VA3A 1N6QA 3TVZA 4DQSA 1S6PB 1N4LA 2YKNB 4C3KA 1EETA 1KC8T 4XPCA 4DL4A 2HAIA 2PEHA 2AZ1A 2J5AA 4JI8J 1KRPA 4DEZA 1SKRA 2QTWA 3EUNA 3IWXA 1NDLA 1ULRA 2R7QA 4NMLA 3ILJA 1DTQB 1UWBA 3NCRA 2QMWA 3HT3A 2HWIA 4E0DA 4GKKF 1LW2B 2JJ4D 3DLKB 4B08A 2OMLA 3AOCA 3FSYA 4FF2A 2K3IA 1VIXA 4X84A 2DISA 2B4PA 1HA1A 1Q4RA 3AD8C 2DHXA 3CCZA 5L9XA 1YJTA 3DOMB 4O3RA 4KHMA 2OGUA 5AE2A 1RAIB 2XY7A 4NLWA 3MZIA 2V63A 4B3SF 3DCAA 3I6PA 4PYAA 2B4OA 3PO4A 2YX1A 3T3FA 3K57A 1DLOB 4K2JA 1SQFA 1E6VB 5GAHI 4JI1J 2LLZA 2HLTA 1F2HA 4DX6A 1KSPA 3VAFA 4DV5F 3Q24A 3GONA 1X9SA 2XCPA 4ILLA 4RW7B 2WSFC 2BE2A 2DR7A 2GCFA 4B3MF 4USHA 2XSJA 4HTJA 2AT1B 4O44A 4ZIWA 3LP1B 4X62J 3KHHA 4EBEA 3KJVA 3RAMA 3WC0A 2VBYA 2ZH6A 2CFXA 2JSXA 1X7VA 1NHVA 4X4QA 4AL6A 2PD1A 4FXVA 4RO0A 1S9EB 2QZ8A 4K4YA 4H54A 3AAWB 3BGFA 2GVDA 3JTPA 3Q83A 1M5KC 1C1CA 5H9EK 2A3JA 3AY0A 1AROP 3EPIA 3CDAA 3TWZA 3LW5C 4CH7A 3PFEA 4B9UA 1FA0A 1S59A 2RMLA 1N34J 3J81U 3RW7A 2Z56B 3FZBA 3ADAC 3CB4A 3D0IE 4W98A 1TL3B 2OH2A 2DHGA 2AIRB 5G0RA 2HYIB 5KAKA 1GXTA 3GG1A 3BPSP 1KDNA 3R5CA 1ZH5A 2R4FA 4NE9C 1TU0B 5D4NA 3SQOP 4N8NA 1Z2LA 1FJ7A 3TX0A 2L9NA 4HH1A 1FK9A 2XGPA 1EP4B 2PMZD 1VK8A 1D8YA 2DPIA 1X4BA 2V34A 1HPZA 3KLFA 3HSJA 4QIEA 3QLHB 3D6FB 4CTAB 2ZH7A 4NYZA 4RW6B 3FRYA 5HO4A 2WONA 2OPQB 4KBIA 3TUJC 2CJQA 2IYIA 4X4PA 3QJJA 4LMZA 1Q8KA 2ZH1A 2NYIA 4FDFA 5KFSA 4QYZJ 3OT9A 2PI4A 2C28A 3EGWB 1IBCB 2UUCF 3KG1A 1REGX 1PAUB 1OWXA 1QE1B 5CA5A 4DV0J 1TELA 2WB1D 3JSMA 3V5RA 3E01B 1L3VA 1TKTA 2HLUA 4YHHF 1W25A 1RWMB 3S8SA 4L73A 2B51A 5KFAA 2BJ7A 3W3SA 2MLZA 1SH0A 3Q2TC 5F8MA 3B4DA 3IG1A 4DFMA 2ASYA 5KFVA 4EK2A 5KFYA 5D4OA 4KGZB 1S49A 2PSZA 2W8KA 2B56A 2XULA 4KFBA 3IR5B 1T8EA 1HL6A 2LKZA 4ECSA 2MHNA 4ZIVA 2DIUA 2CPXA 5M2UA 2EBEA 2L41A 2W4DA 3M2VA 1IKYB 2GMJA 1JLBA 1P9QC 4QBUA 1XMOF 2OPSB 4LFCF 3B8HA 4JV5F 4ZVEA 1HWIA 4DL2A 4ELTA 3LTOA 3NNAA 2GGPB 3RB6A 1VJQA 5HI7A 4DU7A 3IM9A 1SL2A 2X1AA 2FJAB 4OZJA 4NCGA 3VAGA 2Y3YA 4RLEA 1HBNB 2C2OB 3LUYA 1Q79A 1AUSL 2W9BB 2HHVA 5HK4A 2RQMA 5C25A 4AXJA 5JVHQ 3EJMA 1R6YA 3H2UB 3K8VA 3SBMA 2IYGA 4JI0F 1U6FA 1FNOA 2DITA 3T5JA 3KYLA 5KFPA 2KG0A 1OPZA 3AD9C 3V6HA 3K59A 3NNHA 1S1TB 2XMAA 4DF4A 2HHTA 2WW8A 4OJ3A 3CJTA 3UN2A 1EKRA 4J7CA 2YTCA 3R1HA 3OR2A 1MN7A 5D3GB 1YVFA 2NLWA 1W7WA 2HKEA 4LVOP 3D1QA 2ASJA 2EC0A 3M6XA 3QFWA 2KJWA 1UVIA 3NCQA 2W7AA 4NL5A 3GFXA 1U49A 3QYYA 1E6YB 4PPZA 1BQXA 1X60A 4CWBA 4NA2A 4CDIA 2XI2A 3DXSX 1F9FA 2BABA 3DGPB 4FNHA 4M94A 4PXDA 2UXDJ 1N5TA 2OEKA 1FEHA 3QPIA 4J9SA 4FF4A 2C22A 3HVTB 1PJ5A 2XCAA 1PYSB 1H2VZ 1KVIA 2FC8A 2V8GA 5KFFA 3HI9A 2LECA 4AD6A 1UJ6A 4FYVB 5LXYA 2E66A 2BW7A 1VRTA 3WX4A 1NKCA 2W9AA 2J0QD 4PWUA 3GJTB 5LXRA 3DLLQ 1RP5A 2ZJQQ 3M05A 3UDEA 4OZ5A 2W4PA 1AZSA 2F8EX 3NEKA 1AUDA 2YX4A 4JI2J 4NLGA 3I4HX 3MEDB 2AJQA 3CGIA 5HJYA 1LFWA 3DMJA 1H98A 1ZA2B 4Y2IA 4YOEA 2ZD1A 1NO8A 1S6UA 1SJ3P 3JSBA 4Y2CA 4DX7A 3BH6B 4I2PB 3C16A 1FI4A 2A2DA 3EGZA 1HHQA 3F44A 2CJYB 3PDNA 2E5IA 3GG0A 1ZETA 1UFWA 5HBMA 4LQ9A 1YWXA 3QT7A 3C3LA 5CYMA 3H59A 3QGGA 1HQEB 4A8MP 3I9V9 5DDQC 2Y1RI 1Y10A 4X4RA 3Q8VA 2KVIA 3CNQP 1SUQA 2BKNA 3FRZA 1SKWA 5ETVA 4M1KA 3LA0A 2CPJA 3OW2R 2Z58B 5IZHA 1I51B 4ZVHA 4M5NA 3EVMA 2UVUA 1NSQA 4AT1B 2X1GA 3G9CA 4UTGA 2FLOA 3NMAA 4DFKA 3EICA 3MUMP 1YI2S 1HNIA 4XPEA 2FHKA 2LA4A 1XK8A 1RZMA 1UCNA 2GNKA 1TL7B 4HDGA 4UW2A 3DNCA 2B5JB 2KFYA 2VG5B 3HDSA 2YXLA 4ED5A 5H9FJ 3IGVA 5HROB 1S1WB 2HHHJ 3KK1A 2O1PA 2W01A 1I5OB 2V68A 2NXEA 2KH9A 3BBFA 3ISNC 4HACA 3ICLA 3W9HA 3M2RB 3BN4A 1U2CA 2SXLA 3SIPB 3D6TB 2ZITA 4K0KF 5L1IA 2CZ4A 5A2QU 3D54A 4M8LA 3PW2A 1WDTA 4IH6A 1H7WA 1RWXB 4F4AA 4LR9A 2F3JA 4MIBA 2ZE2B 4JI4F 4J9VA 4WTOB 4TU9A 1R8AA 3SI8A 4I0WA 3GCXP 4LBPA 1LWEB 4ZKAA 4DL0C 4X65F 2E7XA 5I3PA 3IR6B 1VYAA 2YVSA 2EKYA 2L9DA 1X5TA 1RKJA 1S9GA 1OYDA 3RU0A 1URNA 1NBEB 3SCKE 3GJRB 4H4OB 3H25A 3DLBA 1S4EA 1PC5A 1P9YA 2ZH3A 2QA4G 5JVGQ 1HBOA 1WHYA 4N7TA 1RT6B 1HI1A 1G2EA 3NAHA 2OMOA 4J9LA 1B7FA 1WF2A 2J9EA 1WC6A 1HBUA 2X1BA 3DRSB 3AOBA 3HXMA 1W2IA 2DNKA 2VG6A 1BQNB 1YSJA 1D09B 4BDPA 4P2SA 2EG2A 3PYFA 3GIKA 3EYZA 4EYHB 4C11A 1N33J 1JLCB 2V6AA 2B8PA 3PR5B 1RT1A 3TAPA 1GNKA 4GO5X 3O5TB 4LF6F 1YJVA 2YH0A 1R8BA 3HCXA 4DUZF 1TVRB 4S0MA 1XNQF 3PXGa 3HHEA 3SDEA 2YY3A 1YJNS 3MEGA 2MZSA 4UQTA 4EEYA 2RB7A 2DR9A 1VFJA 4IR9A 3RTVA 1X4AA 1SJ4P 4RUCA 2ZZTA 3VAHA 2GFFA 5IT4A 2GO8A 1NH7A 3H20A 2RAQA 4MK9A 2Y0BB 2ATCB 5LMNJ 3KOAA 4P7TA 1TL5A 1S1XA 2MKHA 2IDLA 4RL1A 5LJ5Y 2C3UA 1FRIA 4JI3F 4HTIA 1F9HA 5K14A 3J7AN 5LMUF 1WDDA 1LXNA 4OYBA 3FQLA 4KKOA 4KYZA 3OL9A 3EXCX 4O4GA 2UVWA 2WBMA 2CXEA 1NAQA 3LWMA 4F7VA 1Q78A 1P8GA 2JC1A 4CT8A 3IS9B 2E9ZA 3T5LA 3LP0A 5ETSA 2AEJA 2CQ3A 4ER8A 4FVMA 3CDWA 4DR5J 3IAM9 4QR2A 2XYHB 4Y34A 1U1QA 3F41A 2HFVA 4PUOA 1FT8A 5J2QB 2DNZA 2HS3A 2RE1A 5A8KA 3V81B 4ZVFA 4AFFA 2UXBF 3W61A 1KVJA 1T9TA 1FXLA 4OJ1A 5I4MA 2GV1A 4JI7J 1T3NA 1ROFA 2IJRA 2RS8A 3M2UB 5E3PA 1AFJA 2KYZA 2W24A 2QE5A 4HI2A 4F4KA 4O0IA 3CF5Q 1CC8A 3OLBA 1HYSB 4GVBA 4DV1J 2DKOB 2YKMB 2WRMA 1UEUA 3DFEA 1QDUB 2GIQA 5HN0A 2ZM6F 5KG2A 3HP6A 3C14B 1N5QA 1RTDA 1U8WA 1YJWS 5KG0A 3NAIA 5G4DA 1UAWA 3TANA 1SL1A 2K1RB 2BX6A 3BYRA 2RQCA 4QIWD 3I96A 1VBKA 4IDKB 5KT6A 4FXDA 1LFPA 2CYYA 1F0XA 2DR8A 2Z2MA 3UD5A 4GKJJ 4O3NA 3BR9A 5FLXY 2EBGA 1CJKB 4RPFA 4ZJOA 1PCAA 2KTQA 3E8OA 4WZMA 4LRCA 5GAEU 4KE5A 3A13A 3LAKA 4AL7A 4ANEA 5IV4A 5SUHA 2XG8A 1RT2A 3HVRA 3BBCA 2JNJA 4B3RJ 4PWDB 4OI2A 5A6PA 3P45B 3LH2S 4WK1A 4YEAA 2H9ZA 2VQEF 5BR8F 4QYRA 4WJBA 4DL6A 4K4UA 3VALA 2G13A 3CDUA 3QNWB 2IVFB 1JLGA 1PKUA 2PEBA 2V94A 2J6TA 5THWA 3JQMA 4U7UD 2ZKTA 2HVZA 6FD1A 3O8WA 2M7SA 1D3WA 2PN6A 2I6WA 1C0TA 2N4DA 2R2SA 3RGIA 1KN6A 4MYTA 4B3OB 2LQ8A 2AZ3A 1Q95G 2RRNA 5L1JA 3V6JA 4JP8A 4RW9B 3HHLA 4WFZA 4R0EA 3ZNJ1 5CHCB 4PXCA 3KKFA 1OSCA 1SKSA 1KBRA 4X62F 5M2RA 3ZTRA 1Q82T 3KLGB 1YITS 4KGXB 4NLUA 3MPYA 3JB9k 2K3KA 5D0RA 2KDOA 2VKZG 5AXLA 2C3OA 1NKEA 2IBOA 2K7JA 1IKXA 3NGRA 3KLVA 3TA1A 3G8SA 4K5RA 3GQCA 2W9CA 5D0HA 1YBUA 2UUAF 3CJ8A 5EGYA 1N34F 1T95A 1UA1A 3Q8UA 3HK2A 1CC7A 3SQGB 1JLEB 4PKDB 2J76E 4XTTA 3T6BA 3CJSA 1REVA 2DT9A 3ZTSA 2XMKA 5A8RB 3QJPA 3AQOA 3AJDA 3W60A 5I42B 2KM8C 4E8UA 2R3VA 3CC2S 2VIHA 2E1MC 1T3OA 2G2YA 2UUWA 4USKA 2A18A 1JXEA 4E98A 1SJQA 5DZ7A 2FIUA 2Q43A 1DY3A 3FBEA 3H90A 5E5NA 3U7JA 2G2ZA 1Y4ZB 2OIHA 5F8NA 4P9SA 5EDWA 1R8PA 1U6BA 2CQHA 3MPWA 3D67A 4LSZB 2HVEA 2QSWA 4ICLB 1YHQS 3FBFA 2Y9HA 3RB0A 3QRPA 3PZPA 1WUUA 3OL7A 1HMVA 2HMIB 4DR7J 2V2QA 1KQGB 4ETZA 4H4MB 2OJ3A 4B9TA 2KT3A 2UXCF 2FHMA 2ZH9A 1V3ZA 1CBKA 4UT4A 1T9XA 2IBKA 3QRQA 4DV3F 1F6TA 1FTCA 5IXUA 3HPOA 4DR4J 1XNRF 2F8MA 2ROPA 1ZS6A 1RT7B 4IKAA 4UOFA 2J9CA 2DR5A 4CYUA 4CLUA 1S1UA 4HVZA 1CULA 4MMOA 2WSEC 1JXLA 3SV4A 4I7FB 3ISND 2GJFA 4OQJA 1Q81T 3MD3A 1EB0A 4FF3A 4U95A 3GU0A 2D3O1 2A2CA 2IVYA 3OJSA 3G71S 4CNYA 3CE8A 4NXMJ 1NH8A 2CQDA 3FVYA 4A8YA 2PI5A 4G3IA 5LL6d 3BQ2A 1HD1A 3K5PA 5ETTA 1J5OB 1RJJA 2AYGA 4DSLA 5L38A 2ZC4A 1ZBTA 2DO4A 1B4SA 4WIIA 1N6QB 2VG7A 4IFVA 3ENWA 1EETB 4V19X 1SKUB 1D8ZA 4DSIA 2GO9A 3H5UA 2NUUG 3SCJE 3AHPA 1Q7YT 2VONA 3PCOB 1KEKA 3BDPA 3LO3A 2M5YA 3N79A 2L3MA 3FC9A 3P8BB 1FXRA 1U26A 1U8SA 4XO0A 4DQRA 2DGTA 1N0VC 1YJ9S 2NZ4A 2F8HA 4KB7A 3UR3C 2ALZA 2OEJA 2FZKB 2CIMA 3UPFA 2BQRA 3I4PA 3O1LA 1HARA 1ZAXA 4OX9J 1IBKF 3M9MB 1FDAA 2JZ5A 3CJQA 5C2GA 5F8IA 3DU5A 1GX5A 4ID5B 2GIRA 1TKXA 3VAJA 2BXJA 2GC8A 3GPAA 2FHJD 4XDDA 1I94J 1GEHA 4HT7A 1M1KT 2Z8QA 1RCXB 3K5MA 4YB6A 5L9NA 2WTFA 3OTCA 2AYBA 4O4RA 5KFXA 2CPHA 4O44B 1PSDA 5C2CA 1GT8A 5AE3A 4Q0BB 5KFZA 3MCMA 2ZHOA 1IBMF 4RNNA 3KJVB 1WI8A 4HYKA 1UVNA 5EX0A 3G6XA 1CQMA 1V3SA 5KFKA 4DV7J 5A6WA 1VQ7S 2RILA 1BD6A 4ECTA 4IOAQ 3R6GB 2ABYA 2B0GA 5KOWA 1GFWB 2GVDB 2VH7A 2RDIA 4K4VA 1C1CB 1B64A 3DC2A 4W4MA 2BOPA 2CJAA 1FD8A 3AXKA 1LWCA 3AODA 1FF2A 4QWAA 1WHVA 3IXQA 3FFIA 1YZ7A 2LDIA 2G0JA 4EUVA 2LQBA 2V4JA 5L1KA 4KH1B 5ETOA 5G0RB 2XEXA 1SH3A 4JI6F 4OYAA 4X66J 3OBIA 3VCDA 2CQ4A 2LQ5A 3W2WA 1WEXA 2YNHA 2E1RA 5F8LA 4XK8C 2HBQB 2VOOA 2AQ4A 3PEHA 2ALYB 4OYMA 4YFUA 1C0UB 1TP7A 4RX6A 1ELOA 1TUVA 1HPZB 2F7VA 4QIVA 3KLFB 1T9WA 1NDCA 5B09A 1DFDA 5HVGA 3IMQJ 3EGVA 2HVHA 3GV7B 1CG2A 3CJ5A 4WFAQ 2WONB 2AHOB 1MMDA 2UV8G 3M4XA 2VZ9A 1H6KX 2HFNA 1RI7A 4OMFG 2D1CA 2DXFA 5EWEA 3HZEA 4A8FA 3PTWA 4JUZA 3A8EA 3QJLA 2HWHA 2CQ1A 5JMNA 3O6QA 1RHUB 4CI0B 1P27B 1NK6A 4DV6J 2HS0A 4QYZK 4C8LA 3MCNA 3R2DJ 4J90A 4F4XA 1H2TZ 3GYNA 2RHQB 5BXIA 2AGOA 2KHCA 3I0SA 4DPTA 1IQTA 4I56A 4K5SA 3GSDA 2DNHA 3JSMB 4TY8A 2YWWA 2XTJP 1CQNA 2GVZA 1TKTB 5HL7Q 1UA0A 1R8HA 4JI5F 3TAMA 1CJTA 1X4GA 1U1RA 3GV5B 3ZTPA 2ZHAA 1EARA 1CVJA 2OI2A 3IG1B 4BLGA 2MQMA 1TAQA 1BGXT 3FJ2A 1EZZB 4HEA9 1PYOB 2PMHA 4PG4A 3M30A 3AXMA 3QQCD 2VJVA 2FC9A 1B70B 4KFBB 2IAJA 1TMMA 2MGZA 3RBXA 4Q8FA 3P49B 3RW6A 3MEKA 2B9YA 2NUHA 2FGCA 2V67A 1IJEB 3CCLS 3V6DA 4LJMA 4X64F 2HWTA 1RHJB 1XQIA 2ZNYA 3M2VB 1JLBB 2F4VJ 2LEPA 4DQPA 3U1MA 5KFHA 1VC0A 1DHMA 4HT5A 4FXWA 4K4TA 3RUBL 2LEBA 5C42A 1YJRA 4G1QA 2Z4PA 1Z1ZA 5IT9U 4Y28C 3MR5A 3PHEA 4WU3A 2KL8A 2AYMA 5HVHA 2CJ9A 2WHOA 1FX4A 1VHIA 3FDSA 2APOA 4OZ2A 4CIOA 3PKYA 2CADA 1OMSA 3GIRA 3VHQA 2VICA 4NCGB 1HWLA 1VDHA 4USJC 4G65A 3HSDA 2RF2B 2V9KA 4KJIA 1UKUA 2NCKL 2B4VA 4ZCKA 1RT4B 3J81j 2JEIA 2DTJA 3FCHA 1HNXJ 3GILA 1UW9A 1S76D 3EVOA 2ZUAA 1UZHA 1DZ5A 1RHQB 2D3ZA 3R5AA 5L1LA 3MUVP 1GXUA 5A0YA 2QMUB 2BACA 4XDCA 1U48A 4DR2J 2HS4A 1RUSA 3LALA 3DI6B 1HR0F 3NKYA 3OR2B 4LBIA 2RU9A 4RKUC 1MSWD 3UNYA 2R42A 1VBYA 5KT2A 2CQPA 3ISZA 2ZDOA 2O66A 4F2SA 3EZ5A 1TK5A 1N36J 3D0GE 1WKLA 3KG0A 4R8UB 4KY3A 1VISA 2WOMB 5BYSA 2HK2A 4L6V3 3TEGA 2KO1A 2KHDA 1RKIA 1H73A 1SI9A 2WVCA 2OLWA 4LSNB 2NYHA 2CQCA 4YB7A 4ELVA 3TA2A 4J9RA 4Q2LA 3L09A 1FVQA 4U6PA 4EU0A 1X4CA 2ZH8A 2MY7A 5DLFA 2IFXA 3M9OB 3KJNB 4M5KA 2O3DA 2GQ2A 4ZVRB 1OS5A 4UY8T 1VIOA 3MR7A 1RTZA 2LXUA 2AKWB 2V8HA 3MAAA 1CJVA 1WKJA 3MMBA 3J80U 4EBCA 3NL0A 5K8NA 4B9SA 1XJWB 1YLXA 3PRDA 3OJUA 1C4CA 1RADB 4K4ZA 2IA0A 4NLXA 4NEYA 4U8YA 4JYAJ 1Z4UA 2MZ1A 3QZ8A 4W92B 4PZVA 1GAOA 3DRXA 1RTHA 2XNQA 3C16B 5ADZA 4CLLA 1RT5A 2J6UA 1PBAA 4ZPTR 5HBMB 1VQKS 4OLPA 3DGVA 4DR5F 1N5VA 3DDKA 3PW5A 1NLKL 4CRJA 2AF6A 1EIYB 2HVDA 1L3KA 2OPRA 5B7WA 1B0TA 2ERRA 2E5LJ 4DXLA 1DURA 1SUQB 1ZOTA 3OTDA 3UQSA 4NLRA 4OHXA 2QFIA 3J81Y 2KXFA 5LSRA 4Y2KA 1IN0A 2F1FA 1JK9B 2FYXA 3Q2SC 3MURP 2VFVA 3KLHB 5IM0B 4EMDA 1HNIB 2AGPA 4WCEQ 4QU6A 4U9RA 4PWWA 4KHRA 1HNWJ 4I6YA 4MH8A 5U47A 4DZ6A 5F3TA 4ZVGA 3JXOA 2QRRA 4DSEA 2HHXA 3B6BA 5H9FK 3CJ4A 1F9EB 3G86A 1WJ9A 4YUDA 3DRRB 4TKTA 1C1BA 2F9JA 4O3OA 2E5HA 3NG8A 3OSPA 1Q1KA 5DG8A 3IM8A 3MM6A 3TARA 3P6YC 1OPIA 3NGDA 1KLMB 4OHZA 3M8PB 4Q2MA 2BE9B 4CQ1A 1SPBP 4PG6A 3D5MA 3IBCB 1FJGJ 1O51A 2AD9A 2Z0GA 5I3UA 4OI3A 1RB0A 3M8ZA 1TL4A 2YNFB 1QY7A 3G6ES 4KGVB 2FD2A 1FWPA 1S9GB 3I32A 2K06A 1Y5IB 5CYJA 1VQMS 1S0VA 3H42A 1HW8A 4IFYA 1JJHA 4ERDA 1HBOB 3IRXA 2M70A 3CJ0A 2V4RA 2AX0A 4OYPA 2JOQA 4YDXA 2V8DA 2KXNB 1S5ZA 3QGPA 3CJ2A 3G8TA 2RDDA 5LSOA 2DHHA 3UFCX 1U1LA 2MQOA 1RE1B 2MHEA 2B43A 3MMAB 4Q43A 4L76A 1ZA1B 3UDCA 4KHPF 3BGRA 4NZ0A 1NJIT 2CG4A 3M32A 4UZCA 1R31A 2HQGA 4EFAC 4NLQA 2VASA 2KT5A 3W5ZA 3QIDA 4C11B 2XWXA 5DDPC 1HI0P 4O3SA 3M8WA 2ZHBA 3UCZP 4F3QA 4LF8J 3RAQA 1ICEB 2A6MA 2MDAA 3P96A 4P7VA 3N6MA 1RTIA 5J2PB 3JSRA 1W26A 1BLUA 1KP6A 3WZ0A 1IKVA 2C2ZB 3SDEB 1U4BA 2CQIA 4USMA 2MKKA 1VOMA 2MSSA 5KFJA 2E29A 1Q8BA 3G82A 3QWUA 3G6VA 4B3TJ 4K59A 4ECUA 1HQ2A 1RBLA 5ETKA 4WFYA 5KFIA 3KFWX 2H65B 2DNYA 3FZ2A 4ZN1A 1XERA 5J2MA 2R8JA 1HIYA 1IKWA 1IWGA 1O8BA 1U1NA 5HANA 1LWXA 1S1XB 3ZZUA 2GA7A 1HLWA 5IT0A 3R5BA 4HLBA 3Q8RB 2CAJA 2GZOA 4C48A 5E3AA 2VDHA 2AYEA 5K14B 1RWPB 2LVWA 2L48A 2QGFB 4KKOB 3GJSB 3TZZA 3C6TA 4O4GB 2MTLA 2MKIA 5KFTA 2HRYA 2B3TB 1IXKA 2C3YA 2R8GA 2HURA 1VRUA 1SC1B 3WHIA 1Q53A 3LP0B 1FE0A 2JLGA 1D0EA 3LWLA 4OI4A 1LW0A 4H4KA 4LF7F 3W5XA 1S97A 4PUOB 1SIWB 3R8YA 3EXYA 2IM1A 1G6BA 4DQIA 1QUPA 1WOSA 2LEAA 2O67A 5A8KB 1LW2A 4Q8EA 3DLKA 1H3DA 1YJ7A 3R27A 2XLJA 2Y8WA 1U1KA 4QZVB 3UN3A 1VS3A 1IBLF 2B6AA 1IJFB 1FVSA 1FDNA 4IQMA 3DOMA 2CDQA 3Q8SB 3JTNA 4GVBB 1GX6A 2G1HA 1R8CA 1MWQA 1HFEL 2DXEA 3ZNUA 5J1PA 1X4FA 3GB0A 3QAEA 3TUPA 1YRTA 3BH7B 1BQMA 3PW4A 2DBBA 1OQ6A 1O5JA 2VDIA 1RTDB 4QW8A 2DGSA 1DJ0A 1BE4A 3I9ZA 4RW7A 1WKKA 2BJEA 2R2UA 3TJ9A 2VFSA 4NYPA 1T9VA 2RKIA 5K5MA 1JB0C 3EM1A 3LP1A 3TUZC 3RBDA 1OY8A 5HJXA 4MT1A 2XB2D 4DS4A 4Y6IA 1T0TV 3I5AA 1RBOB 2DNPA 4PQUB 4YQWA 1SQGA 2IPOB 4HL9A 4Y0FA 1KLNA 3DXBA 2FVCA 5J1EA 3V4IA 2JC0A 4YY3J 4U7CA 5JJBA 1JLQA 2EEYA 4KQZA 2R7UA 1FHTA 3BV8A 1PIEA 2CNOB 1X4HA 3ZZPA 3OVBA 3HULA 3QFHA 4KRWA 2EXUA 3VWSA 5B08A 2B9WA 4ED4A 1ZPWX 2WZ1A 4C3LA 2EK6A 1X5OA 1X9WA 3MF5A 3WQPA 3ZZYA 2X1FA 2EFNA 3MR6A 3SYZA 4NOHA 4OZ3A 1EP4A 2UUTA 1O0PA 3TAQA 4F4ZA 3NMRA 5IS2A 5A2QY 4CTAA 3TRGA 4OYWA 2C2NA 4O23A 4L3NA 2D7SA 4LSLA 4DV7F 3CCUS 5GAGI 3BSAA 5L39A 2HHSA 1B3TA 3I55S 3OTOF 3P5TL 1IQZA 3BM7A 4KSEB 3W62A 3KLEB 2CJKA 3D1OA 2FJBB 1MWZA 5KFLA 2MB0B 2W9CB 1RACB 2HW3A 1FXDA 1X8DA 1DTTA 1RWWB 4ZN3A 4QWCA 3MUTP 4PEOA 1NKBA 2GMHA 2JL9A 3GR1A 4UF4A 3OHAA 3NY0A 4ZDNA 3POTB 4ZP8A 1REVB 4AQYJ 1X0PA 3PEJA 4CT9A 1YG0A 2A0FB 4I6AA 3TP2A 3ZXWA 4DLGA 1XTZA 1WG1A 4ZPVR 3PYEA 4NLPA 2UU9J 2RU3A 2QFJA 3G6YA 5E0OA 1KHVA 4TN2A 2PMWA 3BSNA 4ANDA 1QJHA 3PIOQ 2WVFA 2ZDPA 1RTJB 2P9EA 2IY5B 5DRKA 4N47A 3LPYA 3FQKA 2PIIA 4N77A 4ZVUB 3IRWP 1UVJA 2EI5A 3CXCR 3EX7B 2IC3B 1HMVB 1K1QA 3TZYA 3DOKB 1SIZA 4C8NA 3UVJA 2HFOA 2OPSA 1MROA 5A8WB 1XWLA 1D9DA 1L5UA 4G1IA 2ZWPA 4TQSA 2P8IA 4URSA 3S01A 6FDRA 3DRPA 1HQUA 2JVRA 4NLSA 2GGPA 2EG1A 4U8VA 1EHWA 1VMBA 3HD1A 2QT7A 9ATCB 2W2QP 4KC5A 1FKOA 3UDLA 1ACMB 4OI6A 4GKKJ 4IOBA 2HVIA 2OP5A 2MQNA 2I38A 1U47A 2CKWA 3PYGA 5AJ3J 4HKQA 1R89A 2YPZA 2XMTA 5KG7A 5LSLA 5DG7A 4I4BA 2MSTA 1L3TA 4CM0A 4B3SJ 1FWKA 2M2BA 5KG1A 5KG4A 1NJXA 2ZJPQ 3BO4A 2RUSA 2FVSA 2FVRA 5CH7B 1BY9A 2A1BA 2DH8A 4DV5J 5D3GA 1GH8A 1QTNB 4DV2F 2VBWA 4ZP7A 2NXUA 4DPWA 2XZWA 3KHGA 1WNEA 3W1YC 4DUYF 3WBZA 1XEZA 1T03A 3H4DA 3BO2A 1QTMA 3UDVA 2LQJA 2FJVA 2JX2A 4IG0A 2AJ1A 3ITHB 3CUNA 4M5IA 3QT5A 2M0GB 3SZ2A 4M5DA 2MZTA 3ZZTA 2OTJS 3QGIA 4NZ7A 3EDRB 2P6SA 4WIQA 1JKHA 1N8RT 3RJMB 2EPIA 5D0EA 2VFRA 4J9NA 1NHKL 1S79A 3MM5B 2FY1A 2EVZA 4LIWA 3BJYA 4GMKA 3B78A 3VVTA 5KT4A 3W64A 2D41A 4DS5A 2OO4A 3P3DA 2ZEJA 2AV5A 2HRTA 2JEGA 4WF9Q 2LU2A 1MMNA 5GMKa 2CQBA 1OYEA 5ETPA 2XNRA 3RR8A 4QJVA 4ZCIA 2J9DA 1TUGB 2CNKB 5FDLB 4MIAA 4LQ3A 2XMWA 2BRLA 5KG3A 1HQEA 1S6OA 3ENQA 4Y3CA 2DGQA 4A46A 5EWFA 4DZDA 3MM8A 2FHOB 1PILA 2UUCJ 3GV8B 2B4UA 3ET6A 1WOOA 1X31C 3CCMS 4M5MA 2N3LA 4UUXA 2U1AA 4D3HA 4ED2A 1IR0A 1T05A 3DRYA 2CPDA 2CNLB 2VBXA 4YHHJ 1V6HA 2L08A 3HLUA 4DV4J 3EZUA 1TR0A 3DHXA 3A3NB 1AYEA 1I1GA 2G0IA 2YNHB 3ZTOA 3KUHA 3H0PA 3GLJA 2J7WA 1JLFB 2NS1B 4EI2A 3IO1A 3PG9A 4OI1A 5EHHA 3S7RA 3M2RA 4LF5J 3CULA 2J7KA 2FVQA 1AT1B 1G4CA 1KQKA 3KK2A 3CCRS 2ZKUA 3M7VA 1NDPA 4UQGA 1UETA 1WC3A 2DNMA 1LNQA 2ZE2A 3SFUA 5T14A 3D68A 2CUYA 1XMOJ 2D9PA 2GJ2A 3GSIA 1NK8A 1NSAA 2R7VA 5IWAF 3DOLA 4JV5J 4A8KA 2AJFE 2XQCA 1X5SA 5GADI 2FGOA 5DS7A 1KHWA 5ETNA 2WAQD 3DLGA 4CM2A 3I0SB 3NWRA 1M1GA 1WF1A 1NB7A 3VGTA 2RH3A 3I31A 1FRKA 1KD1T 1NEEA 4H4OA 1XMQF 2GVZB 1Q5YA 2LP4A 1RAFB 4CLYA 5D0GA 4PR6A 1RT3A 1CJTB 1RHRB 4KT0C 4B17A 5HMYA 3C19A 3D4JA 3D6HB 1QAIA 3AFGA 4AUKA 3HJFA 1N0UA 1WOPA 1XIQA 3DRSA 4JI0J 2E5GA 4ZPBA 5E3RA 3M30B 2R7TA 4I2QA 3SEOA 3GTYX 1BQNA 4RR5A 1IVZA 4X4OA 5RUBA 2QA1A 3M8QB 2UP1A 2MMYA 3UNGC 5GAHU 1WHWA 3V6DB 2MQ8A 4ZS6A 4USWA 1DBDA 3OFEA 4R5PA 4YDDB 1MW7A 1A6LA 3DYAA 2HHWA 5F8JA 3I0RB 2YNGA 4TXSA 4O0NA 4OJGA 1TAUA 3JAMU 1FRXA 5DQGA 1U1OA 3BS9A 1AA1B 3WX8A 4OX8A 3TUIC 2BVZA 3KTQA 1RISA 5B0FA 1SV5A 1FNMA 4FYYB 2KFNA 4FS2A 4IUFA 1UWAA 1KR4A 3HSZA 4MYUA 2R9LA 4WKYA 2WBRA 2VJUA 4ED6A 4USTA 3KK3B 3BZQA 1FRHA 2FY8A 3ZC4A 1C2PA 3BGOP 1FE4A 4ZVTB 2ZOGA 4F04B 2BKPA 1PYTA 5A0YB 2E44A 1WI6A 3CIZA 1U09A 2XY6A 1YX2A 4NX9A 3MM7A 5ETQA 2F40A 1JX4A 5LT5A 1RAGB 2R7RA 4QU7A 2AWZA 1Y3KA 2PT0A 4F50A 4DR3F 4NA3A 4LF8F 4GC7A 4ZP6A 3IS9A 1KKHA 4QCLA 2ILZA 4IOCQ 1S0MA 3PKMA 1DAXA 3UO0A 2XHWA 2FZCB 3MECA 4FZVA 4OHYA 3CCES 5IFMA 4Q45A 2M9KA 1S10A 5KFCA 5J2QA 2OUGA 3OTEA 5DETA 1H2UX 3D66A 2KRBA 3HHKA 2UUBJ 2RJZA 4EYIB 1S12A 3HKWA 2HNZA 3AA9A 2DHSA 2FB0A 2KKHA 4QOTA 1CPZA 1RAHB 3N5FA 4E2FB 3D9BA 3MAQA 3T9ZA 2E1PA 1G1XA 2DEIA 2BJ3A 1CJVB 3MMBB 5D77A 3HHNB 1UW4A 2DPJA 1XMBA 2X3GA 4OYOA 5IC4B 3C14A 3K2YA 2HK3A 4ANCA 1BXNA 4LF9F 2XSFA 2LXFA 3IBFB 1RYRA 2GHPA 1WG5A 3UR0A 3PX0A 2NPFA 4HHHA 4ECRA 1RTHB 2JLFA 1V9OA 2DRAA 2ZUGA 1RT5B 4LT6A 3OHBA 2AJ4A 2IRXA 2PFFB 2CNNB 1NRKA 3MOJB 1N32J 1YBAA 2HQDA 4KTQA 3H5YA 2PFDA 1CJKA 1U0HB 3BB5A 5B0EA 2D3UA 4JI4J 2CVEA 5HP1B 4M5GA 2HQFA 2OPRB 1S48A 3FKBA 4WXWA 3DU6A 2JVOA 1HNVB 1T7PA 1TMJA 4X65J 4PG7A 4CNZA 3JYTB 3IAS9 2N3OA 1S1VB 3LOUA 5GADU 4LF2A 4OYXA 1UTAA 2AGQA 4OX6A 3BYPA 4F3OA 2QA4S 1JJ4A 2I1RA 2C2DA 1Q16B 4CLPA 1OO0B 2I0XA 5KT5A 4ZVSB 5ETRA 3H5SA 4IRCA 1YKWA 2EFGA 2J6SA 3W2VB 4N8OA 4CO3A 2RIJA 4DPYA 5K8OA 2H5IB 3MPUB 3ILIA 1HNZF 2BJ1A 4WPAA 3CCQS 2CZ9A 3L9ZA 5KFNA 4IH5A 1Y3JA 3NGUA 1C1BB 4DOZA 2Y1IA 2ZZMA 2QLXA 3G4SS 2XO7A 4DX5A 1FERA 4OL8A 1EAYC 2YWKA 2KZZA 3DDIA 5B0DA 3F0NA 4NI2B 4ZPWR 3H98A 5K8MA 4DSFA 1QD1A 4DG1A 1P1LA 1U25A 4ZLNA 2XS7A 1V3RA 4DUZJ 3R6LB 1JJCB 1XNQJ 2FLNA 1R0CB 3SQGA 4URQU 2MKCA 1JLEA 4FPIA 4ETXA 3QRRA 3BDEA 1ZTTA 3PRBA 4IFYB 4PRFA 1APSA 2HQ3A 3LANA 3CWJA 5A8RA 2Y0SD 1JXVA 3IRXB 1RYSA 3QSIA 2QA2A 2V2ZA 5I42A 2OHDA 2R7XA 2CJBA 3H5XA 4KV8A 4PYDA 3MFIA 1ZAVA 5GMDA 2VB6A 1F60B 2ASDA 1F5BA 3FMBA 2HBZB 2V50A 2H48B 3U02A 4WBFA 4JI3J 3JSYA 3ETMA 1RAAB 4QR1A 1N52B 1VQ9S 2NPIA 1TL1B 3BGRB 2HZVA 4NLVA 2D74B 3JQKA 4KIAA 1WF0A 1D1UA 5J2NA 3KLIA 3W7BA 4ATNA 4Z37A 4ECYA 5K9FA 5EUHA 1CLFA 1VLOA 2DCLA 3NOGA 4WFNQ 3CJRA 2YKQA 5BYRA 4JV2A 3I87A 4DUTA 3ZZZA 5IT9Y 4F25A 1F1BB 3GFHA 2DNRA 4TYAA 4IO1A 4NLYA 5DDOC 3ZO7A 2Y1LB 1SQEA 1IKVB 3Q0AA 1UL3A 2HIYA 3CPWR 4RW4A 1RT7A 1F5CA 1PGZA 5CXTA 3C8YA 3L95X 3L7OA 4OV1A 5K8PA 4CLFA 3R7SB 3TNVA 4OFZA 4DJBA 2AP6A 3LGHA 1BWVA 3LF0A 2UXBJ 2YQ3A 2CPZA 4OX7A 4L3KA 4I7FA 4N5SA 4C6AA 3QBCA 7FDRA 1NK0A 3MM9A 1LKZA 1R0AA 2FPHX 5EWGA 5F9LA 4U96A 1J5EJ 1LOUA 4PG5A 4A8OA 4DFJA 2OEMA 3DKDA 4K4SA 4RNMA 2POKA 4U67Q 1JLAA 3Q22A 3TW0A 5I3QA 3VAMA 2ZM6J 1N5YA 3LGNA 4KPCA 4YB5A 4DSKA 3C6TB 2CWXA 4ECWA 2N82B 3A4TA 4MAKA 1WSRA 4I6WA 2D9OA 1PBUA 2IMOA 3OV7A 3KNAA 3RYLA 4RBTA 3ZZ0A 3TQ1A 4PAAA 3MEEA 2MZJA 3J7A1 3ZZOA 5IOLA 1FRLA 3V2UC 1FRMA 1KFDA 4KGMA 1VRUB 4P75A 5GMEA 4JI8F 1N54B 3Q86A 3ZFVA 1Y0HA 2GHWA 6AT1B 1HBMA 3DLEB 1OY6A 1UPPA 3J7ZT 2ZH5A 1UFLA 1LW0B 2XYPB 7AT1B 4LUBA 4DR6J 3QZ7A 1PJ7A 2EK1A 1SC6A 2YNIB 4GVLA 4A8XA 5F3ZA 4ITSA 3N28A 3AB2B 5KTQA 3ZTQA 2B8QA 1RWNB 3MMCB 2JFDA 2W2MP 2W7PA 2VQEJ 2QLFB 5BR8J 4PPDA 2RQKA 3C6UB 5AJ3F 2B6AB 2GHVC 2HRUA 3FEXB 3ENAA 1PJ6A 2QMXA 2AMCB 3J80Y 3B54A 4JI1F 3MTKA 4CZCA 3DM2B 5HLFA 1RSCA 3D3CJ 4ID5A 1BQMB 2JEJA 2X3DA 2IA6A 3SXLA 2JLEA 1RLDA 2MQQA 1AW0A 1K73T 2C2EA 2P5VA 5DQHA 4DMZA 3MR2A 4WWSA 1Q0NA 4KH0B 2RKIB 3W8GA 4Q0BA 4RW8B 1SC3B 3OXGA 5DLGA 2CPIA 4ZLLA 4J9OA 4D3GA 3CT9A 3FBCA 3BGLA 1M90T 2NR0A 1NSPA 5CYQA 2QN6B 4RBUA 4K4XA 2XHCA 3EZOA 1FDDA 5HQ8A 3GIMA 4ZA1A 5J1EB 3D6MB 3V4IB 1QVFR 3U1NA 5MAOA 4C8OA 4J5OA 1JLQB 2V0NA 2HHPA 4J9QA 2MXYA 2UUAJ 5DO2A 3PW0A 1CJUB 2FVPA 1GTEA 4LRBA 2DHAA 2FHJA 2XLIA 1HHSA 2GJIA 4BS2A 2W4CA 1WEZA 8RUCA 3H2VE 2MY8A 3NNCA 1HWKA 4DL3A 4UOCA 1LEOA 4FBTA 2LXIA 5CD4A 1S77D 4OIXA 1Y5NB 2V9WA 3TQEA 3VVUA 2RHSB 2V8PA 1C0UA 4ED8A 4A8QA 1JQGA 3G2XA 2XZTB 8ATCB 3K17A 2QYGA 3CJ3A 1VC5A 5DG9A 1FFWB 5DDRC 4LSLB 3O2IA 3RRKA 3LAMA 1WC1A 1KOHA 2I9SA 3OVSA 1FRJA 4OZ0A 3MD1A 4IO9Q 4ZHRB 1SJRA 4MK8A 5AXNA 3NBPB 2UXCJ 2H54B 4DV0F 4DV3J 4FNIA 1DTTB 2ZWOA 4K8RA 4NLTA 1XNRJ 1Y5LB 4RWXA 1TTHB 4ES1A 3M8YA 4WP8A 2A6OA 2HAFA 1N88A 2H5EA 4DV4F 3UN5A 4DSJA 2ZFHA 4YS2A 4JOUA 1F2GA 2KU7A 2ZNZA 2F4FA 2ZBCA 1SB6A 3CW2C 4DPUA 3CD6S 5HSPA 2DJWA 1WSVA 5C24A 2NSCA 3GFZA 1WELA 4KO0B 3TZXA 5L46A 1YRUA 2IM3A 2CPYA 4LF5F 5HMZA 4ECQA 3KMSA 1EX8A 1FKPB 4LRAA 4TVAB 4C2MA 4FKXA 2J0WA 2M8DB 3RZAA 2CWKA 4GO7X 3JTOA 5IV3A 1M5VC 3UVJB 4ZOSA 1Y9OA 1MROB 4EWTA 1I3OB 2C3MA 2ROEA 4ID8A 2KI2A 3DRPB 3RAXA 1HQUB 4N41A 4A47A 1JNRB 4LR8A 4DDFA 1PG5B 3IBWA 3CMQA 1UWBB 2OKQA 3SV3A 3CC7S 2DCUB 3OSNA 3IC1A 1FKOB 1XR5A 4ES3A 4LF1A 3D3BJ 3MR3A 4DL5A 2RF2A 4FBUA 4C97A 2E7WA 3AH6A 1SH2A 4V19J 2XO6A 1FD2A 1FFGB 3N01A 1RT4A 1M1HA 5CZVA 1NK7A 3AJ1A 3HFVA 1ZM9A 2W25A 4MK7A 4ZCLA 1IBKJ 3KUEA 1VC6A 1YBTA 1VQ4S 1SXLA 4JV0A 2I8EA 2VV5A 1JIHA 4DR1J 4P52A 1RABB 3DI6A 4M95A 1U6ZA 3QIPA 2OSQA 2DNNA 2RUGA 2BE2B 1JJ2R 2EFOA 2XSJB 3ZZRA 3A8IA 4UOHA 3KG4A 2UXDF 2VC1A 1IBMJ 3C46A 2XS5A 3US5A 3EDQB 4MFBA 3CD5A 1T03B 3D1HA 2ZJRQ 2N7CA 3D2WA 4R8UA 3VQTA 1Z2ZA 4QWBA 2WOMA 1IM6A 3A1YG 5T41A 2Q79A 4IG0B 1MWYA 4RU9A 4TU8A 4LSNA 2RDJA 1YGYA 3HZGA 2XI3A 4DF8A 2BQ3A 4M5DB 3NS7B 3H8YA 2NXJA 3LP2A 3W9IA 2FJDB 4MIWA 4ZPCA 3H40A 1WTBA 2KN4A 3NWGA 3M1VA 4IQXA 3HKZD 1NPRA 1EQ0A 4LRFA 1JKHB 1GK8A 1KS2A 1WC5A 1RAJA 4F02A 2BMBA 2BW2A 4JI2F 2QX0A 4PG8A 1SBRA 1U7LA 2KT2A 3CCJS 3L7UA 3OR1A 4JI6J 4ECXA 3H4BA 2X7IA 5HQLA 3T6JA 2IM0A 1KVKA 2Z2LA 1FK9B 3SFGA 4CLSA 4G1PA 3HD2A 3QT8A 4NYOA 1L3UA 5KFBA 3NRBA 4J9MA 4Z2XA 3T41A 1NK4A 4DI6A 2CQ2A 4C3MA 2ASLA 4TYBA 2VA2A 3NS5A 1VQPS 1TFWA 1YRXA 2OELA 1ZAWA 2NXCA 3TZWA 2C1EB 2FJXA 3MM8B 2ZH4A 2YQ1A 3DN9A 3GWCA 4ZJLA 2UUBF 4IG3A 3ET6B 4F26A 1Y00A 3FCVA 3Q8YA 4NWBA 1BMQB 1IM4A 2PA8D 1D9FA 4RWWA 4WYWA 4HDHA 3NXZA 3KLHA 1T05B 5IM0A 1R6VA 3L4BC 4F4YA 4EO6A 3CDBA 5KG5A 1VBXA 4JI5J 2HHHF 2N4CA 2OTLS 1TUWA 2MZRA 3CDEA 1HWJA 2DD8S 1S4FA 2CRLA 2HFSA 1H72C 1ZPVA 3C15A 3MAHA 4DN0A 3SCLE 3KJFB 1JMTA 4K50A 1VQLS 3DRRA 3MCOA 3NGSA 4ALZA 2COLA 4CO4A 5KFEA 3R97A 1GMVA 3BKFA 3KK2B 4X4NA 5GAEI 1N32F 4X64J 3UW1A 2FDNA 1UMJA 2VUGA 2FLLA 1TQLA 2FZGB 1KLMA 3M8PA 5KOXA 2H3EB 4LF4J 1NDKA 1ZZFA 3OPKA 4RUBA 4LIRA 3DOLB 3A12A 1G3OA 2M8HA 2XMMA 2YNFA 3G87A 4P6QA 1H38A 3DLGB 2EFQA 4F36A 2P9CA 3HHLC 3OUYA 2VC0A 5C25B 3OQ2A 2YKPA 3LPEA 1RT3B 2BA9A 3TOQA 1FTRA 5B0GA 4TU7A 2K8GA 1QSLA 2JFKA 4DBQA 4RNOA 1LWFA 2HFZA 2Z2YB 3FBBA 3R9LA 1S6QA 3GFYA 1K0VA 3NGTA 1T02A 2CQGA 1N5SA 4GRSA 1UVKA 4I2QB 3ULHA 1QAXA 2BANA 3MMAA 2DY1A 2J8SA 4M5HA 1BWEA 1OIAA 1FJCA 1SL0A 3SSQA 1N33F 3THTA 1FKAF 4X4SA 2LMIA 1GMWA 1HR0J 3HMJG 3ILOA 4QW9A 5HATA 1IUJA 3MFHA 5EN1A 4R5PB 3H2LA 4PABA 2NSBA 5DM6Q 3AOAA 2ZVIA 3DYAB 3L7PA 1TKZA 3QSYB 3M9NB 4NZ6A 4NXNJ 2MPUA 9RUBA 3CEDA 5IQQA 2YNGB 2L9WA 3HM9A 1VBZA 5T7LA 2BZ2A 2QC3A 4NA1A 5J2PA 1N56A 2RQ4A 4Z7YA 3HVAA 1EQMA 3AT1B 4TLQA 1HI8A 3TYTA 1U02A 3PO5A 1YZ6A 1QUVA 3ONQA 2E9TA 5LOQA 1SV5B 2KXHA 3W65A 5LMNF 2UVRA 2YWEA 2G1DA 2E5JA 4NMXA 3K8WA 5AE1A 2R8KA 4QIFA 2B7BB 4WU2A 1VRTB 4FP9A 1W2BR 1S0NA 4GC6A 4ELUA 4NRUA 2BJ8A 4W90B 2BV3A 2HBYB 3ENVA 1IR2A 2V2VA 3GR0A 2I5JA 1AZSB 3N0VA 4F67A 5D8HB 2HNYA 4NLDA 3HHDA 3PACA 4EZ9A 3IN5A 3DMJB 2M4MA 2ZD1B 3NCPA 3IFEA 2VFUA 1MNEA 3MM7B 5MLCV 1C4AA 4CP5A 3JS9A 3K7RA 1VHFA 3NS6A 1EJ7L 2GIFA 3ILLA 4N76A 4L74A 1TZ0A 3MOZA 1RLCL 2G0CA 5F9NA 1NNDA 3K0JA 5CYMB 1GTHA 1P6TA 1HWUA 2BKOA 3GYGA 2B7CB 5JUMA 4ZVPB 4OJHA 2QL7B 1RBAA 2DGWA 1Q7LB 2DXDA 3MECB 2KZMA 2DIVA 3WDOA 2NZCA 2FJEB 2EFPA 4P73A 1K1SA 4TQRA 4USIA 1YK9A 4JI7F 4FYXB 5CQGA 4MKBA 3W5YA 2QEXS 1KFSA 1MLAA 2Y1JA 3SMZA 4EGLA 2HNZB 4FYDA 2XBPA 3PJXA 4DV1F 1T9YA 4RUHA 5LJ3Y 1J5EF 3PX4A 3GE9A 3BN7A 2V4QA 2DNGA 2Q3PA 3R5JB 2LA6A 3KK1B 2DGVA 1F3VA 3KHLA 1VLYA 3X3UA 2XM3A 2DO0A 4HACB 2OPPA 4F4WA 4J9PA 2D3OR 1MU2A 1CEZA 1NCLA 2XZDB 3W9JA 4JV1A 3Q89A 2GQQA 2QLWA 3CD0A 2VKRA 2N7YA 4GKJF 2QO3A 1Q8LA 1R43A 2R8IA 5CABA 4CLWA 2EKNA 3MMJA 4WE1A 4ZITA 5C5JA 3LQVA 3AQPA 1AB8A 2IMWP 4DR6F 2KFZA 3R7BB 4USUA 2RT3A 4B3RF 1RHMB 3T1YJ 4PQUA 1GMUA 5D4PA 1GMWD 1R27B 3VTIA 1UEVA 4I67A 3OFFA 4QR0A 4M63A 4CCHA 5GVQA 1K8AT 3TJ8A 4LFBJ 1EKSA 2FUG9 3TJAA 3BKUA 1A7GE 3X1LB 1NU4A 3W66A 3EVWA 3E2EA 1NK5A 1OY9A 1FFSB 1H0HB 2IHR1 3IA0A 4WP3A 3OXLA 2H5JB 1J2VA 3GZ7A 2VODA 3K58A 1HBUB 4HR2A 2CPFA 4Y2MA 3WC2A 3RG6A 2J0SD 3R2CJ 3IGNA 4X4UA 4P74A 3MTJA 2M52A 2VG6B 5ETMA 1HW9A 2GQCA 4FVCA 2O01C 5A76A 1YDLA 2WVDA 2LCWA 1CS4A 3CJKA 2R2TA 1S0OA 2J0XA 5B0BA 1KNZA 4KHPJ 2M3DA 2BDPA 2UV8A 1R7IA 5F0UA 2D69A 2HNDA 3PY8A 4DCOB 1RT1B 5M2PA 1QVGR 5CCMA 1VQSA 2IJNA 1TV6A 4CH0S 4YP3A 3QO9A 3VAIA 3KLEA 2YWHA 4HH0A 2HQCA 4DG1B 3AB4B 2C2KB 3MEGB 2AJ2A 2ROGA 3E3XA 3UWTA 2VOPA 4YR2A 4OYZA 3POTA 2WSCC 2KVQE 3KDOA 3N6NA 3N6LA 2F63A 4X4TA 3HT0A 3VGVA 1RAOA 4WXOA 3TVKA 5K20B 5D4LA 1WACA 2DEJA 2ZBPA 4KV8B 4DQQA 1VK3A 3UD3P 3KHRA 1RTJA 3AA8A 3CMAS 1RGVA 3O44A 4WTYA 2BUNA 2MZQA 2K2PA 3QAUA 2G2OA 3VV2B 4DR7F 2J8AA 3QGHA 4C9DA 1F3FA 1YQHA 5J2NB 1S6PA 3Q23A 3KLIB 5HQMA 2IC3A 2MJNA 2PGCA 2WCXA 2YKNA 3OD2A 1FNXH 2OD4A 4C98A 2A10A 3W8PA 3DOKA 4IYQA 2QL5B 4KR0B 4YR3A 3QT6A 3RBEA 1Q86T 5A8WA 4DL7A 3AJ2A 3FNNA 4WFBQ 2WVBA 1G7CB 2Q66A 4DR4F 4LR7A 3SCIE 1UFKA 3JQJA 2V69A 3JAMY 3VF0B 1VRQC 2DGOA 3D28A 3I82A 3J7YI 4LF7J 1DTQA 1ZTWA 3HFZB 1F5AA 4RW4B 3RBZA 1RDRA 3GCWP 1RU1A 2H1YA 4IR1A 2QL9B 1TKDA 2VU5A 2BR0A 2DGXA 2H4WB 2F5GA 4ILMA 5IQ6A 4DWIA 2VD3A 4PXBA 3MM9B 4F2RA 3I5CA 1IBLJ 2DNQA 1R0AB 5HMWA 4NXMF 2W7OA 2B9XA 3HJVA 2PC6A 1M5HA 1ZM2A 4ZLJA 1DQAA 1DLOA 2IIHA 2MJUA 3V6KA 4IRKA 1E6VA 1T9UA 1JLAB 4BC7A 1K9MT 1VQ8S 2ADCA 5KFWA 1O6XA 4ED7A 3TI0A 5ITHA 1N5YB 2CDRB 2XMUA 4HHJA 3BSCA 3PR4A 1FO1A 1RK8A 1RCOB 2QSFA 2VBZA 3MEEB 3T1HJ 4DX8H 1M0SA 1RWVB 2DVIA 1U1MA 1UZDA 2XYGB 1B99A 4ECZA 2W2PP 1HBMB 2R7WA 1S9EA 4OZLA 5KFDA 5H9EJ 3HHLD 1RAEB 1RT2B 4TNOA 1ZM4A 5DQIA 3KNGA 3KXDA 3ITHA 3KWMA 4I64A 1PC4A 3VR1A 3T5KA 3PHTA 1VQ6S 3U27A 4NPOA 1JLGB 2UZAA 1TL3A 2JRSA 2GAHC 2V2KA 4OX9F 1RHKB 1S7HA 4NCAA 4C8KA 4NRTA 4FKYA 2HG4A 3P4UB 4ZP9A 1H7XA 2LFVA 2OFGX 1HHTP 1C0TB 1WD6A 4CO5A 2Z2ZA 4LFAJ 2DH7A 5BYQA 3MM5A 1P1TA 1SC4B 2MYFA 5HLFB 1I94F 2ZOFA 4OI0A 3EWGA 3BEGB 4DR1F 1X4DA 4WK3A 4C4WA 3HHLB 2QV6A 1VJWA 1V5IB 2HSEB 4X2BA 3QLHA 5KFOA 2AU0A 1TK0A 1VQNS 3KMQA 1ZYQA 1NPKA 4RW6A 3M6UA 2OPQA 2YBVA 1R3NA 3PW7A 5KFQA 2MQPA 1LK7A 3DDNA 3PX6A 5KT3A 3A3PB 2FTRA 2JEFA 1GQEA 5FDLA 3HFKA 2F65A 5CD4H 1IKXB 1PAEX 1N48A 2AJ0A 3OTOJ 1QSYA 1CSJA 4WYLA 3CCSS 1Q5VA 3RRHA 1S72S 5CYQB 2GAGC 4OHWA 2ZOMA 1AXQA 1QE1A 3T9NA 4ZCMA 4BCAA 4ZPDA 3S6EA 4ZJQA 1NM2A 4NEZA 4RNHA 3SSRA 1LV5A 2LQ9A 1VI7A 3QATA 3E01A 4Y65A 1I6JA 3CC4S 3CTRA 5F0WA 4F3MA 3OL6A 2HHUA 4X66F 1TFYA 2FQQB 2YX7A 3PRVA 2J7UA 4C0HA 4F0MA 2RRBA 2RRAA 1ITPA 2HGLA 4ZMMA 5LM7E 5H1SV 4CO2A 1S7IA 3TEHB 1IWAA 4ED0A 1JLFA 5KFGA 4DN9A 2ZH2A 1WHXA 1WTFA 2IJFA 1B0VA 3AD7C 2RS2A 3M8RA 2X51A 3TO8A 4F8RA 1FCAA 2VQFJ 4UUWA 1HKAA 1NZ8A 2FLPA 2ZBQA 4FF1A 1VGYA 3R5DA 1IKYA 3VGUA 3BPDA 2XMJA 2U2FA 4DPOA 2EW9A 1A9NB 5CCLA 3B4MA 3J7Z5 2VPWB 4DV6F 1DQ8A 3CO0P 3BF4A 1RA6A 1QAJA 3B82A 1MN9A 1T11A 4C0BA 4B9NA 1M5PC 2JH3A 4DCJB 5DJBA 2ATLA 4C8YA 3PIPQ 3W63A 4CYUB 4FN5A 3PVXA 1S1UB 3UCUP 5KFRA 3BR8A 1CULB 5D6GA 1HBNA 1A0OB 1QLNA 2C3PA 5B0CA 2ZVSA 3GIJA 4NCBA 1Y11A 3J7YU 2W9BA 1U2FA 1S57A 4USVA 2HGNA 2KJVA 4IH7A 8AT1B 3PFOA 1RU2A 3HSGA 2HBRB 1FJEB 3BQ0A 2PDAA 2HEKA 4DLEA 4C8ZA 3L3CA 1U24A 3BBBA 2P2CB 1B7YB 1KTQA 5C24B 1URRA 1S1TA 1WC4A 3UCGA 2KG1A 3M8QA 4ED3A 2GS8A 1TK8A 3D0HE 4K4WA 2F4VF 2G4BA 1LK5A 4R0JA 4B3MJ 2VG7B 4IFVB 3UD4P 3VAKA 2ACMA 1E6YA 4Q5VA 2ZBIA 4NLOA 2BBEA 4LF4F 1K44A 4DV2J 3FUYA 3UI3A 4A8SA 1X5PA 2BJDA 3I0RA 4HHUA 4AE5A 3DGPA 1XN9A 4P72A 1BC6A 3Q8PB 1D9AA 3K89A 4M5LA 4DUYJ 3MPVA 2DRBA 3DHWC 2BJ9A 5E7OB 4EO8A 3HVTA 3TX8A 4Q44A 3CCWA 1VQYA 4G6VB 3DLJA 2NQPA 1LQ9A 2DY9A 2GX8A 4OLOA 4B9VA 4F0KA 3KJQB 1U2RA 2UVVA 1HNXF 1UEKA 3KK3A 4B02A 1X0FA 3NGKA 3VQSA 3MEDA 1WG4A 4DR2F 1TKXB 4J37A 4V1Ak 4CLKA 1L3SA 4TY9A 4ES2A 3BGUA 2AEMA 2H4YB 1XR7A 2QLBB 4ZPAA 5KG6A 3HO1A 2VHGA 3VZIA 2VPYB 4I2PA 3QIPB 2QLJB 4OZ1A 1FX2A 2E9RX 5FIIA 3FEYB 4AXIA 2MKYA 2LYVA 5EX3A 3ETOA 4NXNF 2BM1A 1N36F 2RSQA 3CSKA 3MCSA 4O3PA 3FK4A 3FGVA 4AL5A 1T94A 3I5BA 4MFBB 3VZHA 4ZLPA 2W2OP 5FLXU 5GAGU 2HZCA 3MXHP 3FSXA 3S1TA 1RWKB 2HFUA 4XIUA 2EWHA 2IVMA 3CIMA 2Q6CA 1LWCB 3FFIB 3MWBA 3GMGA 1OJ4A 2YQ0A 2RD5C 5SZTA 2V4JB 3LP2B 3GYXB 1M5SA 4B9LA 4R25A 3TVYA 3C66A 3M1VB 2PA3A 3CVKA 1FWLA 1TL7A 2B5JA 2Z57B 2VG5A 4LREA 3DLHA 4ED1A 3W2WB 1R0BG 3OR1B 5HROA 1S1WA 1UPMB 1RQ0A 2LU1A 1V5VA 5E3QA 1NJYA 4JYAF 3IR7B 4H4KC 1QM9A 3OTBA 2WVEA 4A4JA 5BJRA 1WEYA 3M6VA 4Z7CA 4KAIA 2YPYA 4BBYA 4K7QA 2JDJA 2KM8B 1WC0A 4NASA 4YMEA 1RWUA 1MG7A 2NREA 2YWGA 3BREA 2W1BA 4U7UK 4RNFA 2E5LF 4LFCJ 1U0HA 3P5BP 4MKVA 3HVWA 1KONA 5HP1A 1LWEA 1OQ3A 3RRGA 4CO1A 1UJ5A 4DU8A 1KWMA 3HX9A 4QQBA 1VCTA 2K7KA 1U1PA 1HNVA 1KQFB 5IWAJ 2CJXB 2YH1A 4CH1A 3Q8QB 1U45A 4IG3B 3LGMA 4TY8B 2ADBA 4A48A 3JYTA 2F9DA 2W8LA 1Q8IA 4ZVQB 1S1VA 2Z30B 1DQ9A 3TR5A 4RJVA 2OSRA 4MJKA 3TAMB 1ZM3A 1ZZNA 4L72B 3PJWA 1RT6A 1XMQJ 1IR1A 4KPYA 1HNWF 2P9GA 3MGJA 1YIJS 4MKYA 2ZC3A 1DRZA 2QIFA 2E1CA 3K5LA 2ZZNA 2IRUA 4QWDA 3W2VA 2CA9A 2MLXA 1GXLA 3C15B 3OFGA 1U0SA 2IAJB 3G96A 4K2XA 2MGZB 2DNOA 4RU2A 3EPGA 3N9UC 2XC9A 4RUAA 5D78A 1JLCA 1B0PA 2MEWA 2C2MB 2R8HA 2DB1A 2PE8A 5DZ6A 2JWNA 2R7OA 5L8RC 4NI2A 2Q6BA 1FJGF 3T1YF 5E2QA 3WIUA 4ILRA 4M5JA 3CD7A 5C42B 1TVRA 4G1QB 3RB3A 4PCQA 4QWEA 2MLYA 5KT7A 4IRDA 4KGKA 2E7VA 4LFBF 4BWJA 2CG8A 1XR6A 3RB4A 4Y2AA 3SSSA 2RVJA 3OUYB 1NHUA 4I1TA 1QSSA 4XAKA 2QG9B 3CCTA 1FESA 4OHVA 1BHNA 1LXJA 4MTPA 1LWFB 5E41A 2VPZB 1S6QB 2C2RA 5KFUA 1NB2A 1BUXA 3IP0A 2BANB 4LBHA 5DGAA 2WW4A 4UZBA 1WWHA 1YTYA 1TL1A 3E51A 3MPDA 1JWWA 1DARA 2MKJA 1OSDA 2OAUA 3F73A 1FEEA 4F0HA 2V5HG 5AXKA 4DHVA 4J9UE 1TKZB 3QMQA 4DR3J 2VF3A
chains in the Genus database with same CATH topology
1IBKJ 4JV5J 3R2CJ 1HNWJ 4RJVA 3OTOJ 4V1Ak 4DV6J 4K0KJ 4GKJJ 4NEYA 4JYAJ 4B3SJ 4B3TJ 1N34J 5LMUJ 3R2DJ 4NXMJ 2UXBJ 2HHHJ 3J81U 4OX9J 1XMQJ 4JI6J 4DR1J 4B3MJ 1IBLJ 3JAMU 4YHHJ 5IT9U 4JI5J 4DV4J 4DV0J 2VQEJ 5BR8J 2KL8A 5LMNJ 4NEZA 4B3RJ 1N36J 4DR7J 4YY3J 4DV2J 4JI7J 4JI3J 1J5EJ 2UXCJ 4HHUA 4DV5J 2UUAJ 1N32J 4KHPJ 4KY3A 4X66J 2UXDJ 4JI1J 4DV3J 1I94J 4DUYJ 3T1YJ 4LF6J 4JI4J 1XNRJ 4LFAJ 5A2QU 3J7AN 1IBMJ 3W1YC 2ZM6J 4DV1J 2E5LJ 5FLXU 2UUBJ 3D3CJ 4JI0J 4DR4J 1N33J 4KYZA 2MTLA 4LF5J 5LM7E 4X65J 4LFBJ 4X62J 4JI8J 4AQYJ 1HNXJ 1FJGJ 3T1HJ 2MEWA 4LF8J 4LFCJ 3IMQJ 3D3BJ 4DV7J 4X64J 4DUZJ 4GKKJ 1HR0J 1XNQJ 2MQ8A 2UU9J 5IWAJ 4LF7J 4LF4J 4LF9J 4DR2J 2VQFJ 2KVQE 1XMOJ 5AJ3J 3J80U 2UUCJ 4DR3J 4DR5J 2F4VJ 1HNZJ 4JI2J 4DR6J 4NXNJ 4PWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK J;  4JV5 J;  3R2C J;  1HNW J;  4RJV A;  3OTO J;  4V1A k;  4DV6 J;  4K0K J;  4GKJ J;  4NEY A;  4JYA J;  4B3S J;  4B3T J;  1N34 J;  5LMU J;  3R2D J;  4NXM J;  2UXB J;  2HHH J;  3J81 U;  4OX9 J;  1XMQ J;  4JI6 J;  4DR1 J;  4B3M J;  1IBL J;  3JAM U;  4YHH J;  5IT9 U;  4JI5 J;  4DV4 J;  4DV0 J;  2VQE J;  5BR8 J;  2KL8 A;  5LMN J;  4NEZ A;  4B3R J;  1N36 J;  4DR7 J;  4YY3 J;  4DV2 J;  4JI7 J;  4JI3 J;  1J5E J;  2UXC J;  4HHU A;  4DV5 J;  2UUA J;  1N32 J;  4KHP J;  4KY3 A;  4X66 J;  2UXD J;  4JI1 J;  4DV3 J;  1I94 J;  4DUY J;  3T1Y J;  4LF6 J;  4JI4 J;  1XNR J;  4LFA J;  5A2Q U;  3J7A N;  1IBM J;  3W1Y C;  2ZM6 J;  4DV1 J;  2E5L J;  5FLX U;  2UUB J;  3D3C J;  4JI0 J;  4DR4 J;  1N33 J;  4KYZ A;  2MTL A;  4LF5 J;  5LM7 E;  4X65 J;  4LFB J;  4X62 J;  4JI8 J;  4AQY J;  1HNX J;  1FJG J;  3T1H J;  2MEW A;  4LF8 J;  4LFC J;  3IMQ J;  3D3B J;  4DV7 J;  4X64 J;  4DUZ J;  4GKK J;  1HR0 J;  1XNQ J;  2MQ8 A;  2UU9 J;  5IWA J;  4LF7 J;  4LF4 J;  4LF9 J;  4DR2 J;  2VQF J;  2KVQ E;  1XMO J;  5AJ3 J;  3J80 U;  2UUC J;  4DR3 J;  4DR5 J;  2F4V J;  1HNZ J;  4JI2 J;  4DR6 J;  4NXN J;  4PWW A; 
#chains in the Genus database with same CATH topology
 2DK2 A;  3PM9 A;  4FYW B;  4BC9 A;  4BHQ A;  2KYX A;  4URG A;  4J91 A;  5T7L B;  1M5O C;  2H51 B;  4UOG A;  4N56 A;  3CO9 A;  1XC9 A;  3M6W A;  2BOA A;  4B3T F;  2P6T A;  3V81 A;  2DH9 A;  1FDB A;  3H7H B;  5F8H A;  3EGN A;  3EE3 A;  4TLR A;  4DCP B;  2VPX B;  4O3Q A;  3M2U A;  5AT1 B;  3GII A;  4CLZ A;  2ACY A;  3F56 A;  2LDY A;  2BQU A;  2E1A A;  2CZV C;  2CQ0 A;  2O5D A;  1HYS A;  1NPP A;  4HI1 A;  2YKM A;  2I5J B;  3MAA B;  2HQI A;  2DRD A;  1MML A;  3OLA A;  1AFI A;  2HNY B;  3IWL A;  3WIV A;  2J9D E;  3HF5 A;  1VQ5 S;  2YKA A;  3NLC A;  2WK4 A;  2Q1L A;  1UJ4 A;  1KQS R;  2K1R A;  5F41 A;  4LRD A;  3T19 A;  4LF9 J;  3FEZ A;  3U1L A;  4P2F A;  4IDK A;  1S99 A;  2HPU A;  4RBV A;  2HIQ A;  4ZK7 M;  4X4V A;  3THP A;  2DNL A;  5CAA A;  4K0K J;  2DYA A;  3DLE A;  2KRR A;  4YR0 A;  3THV A;  3KDN A;  3I56 S;  4OV6 A;  2YNI A;  4PWD A;  5FJ4 A;  2XGQ A;  1X4E A;  4AYB D;  1NME B;  3OFH A;  2YWF A;  2XS2 A;  3R5G A;  3MDF A;  3N5B A;  3MMC A;  2IM2 A;  3NOC A;  5JXS A;  1PO6 A;  2M88 A;  3C6U A;  4YN3 B;  2I2Y A;  3T5H A;  3PJ9 A;  1HD0 A;  3NP5 A;  5D15 A;  1NK9 A;  3GP9 A;  3QWP A;  4DFP A;  3OVA A;  5C7P A;  2XLK A;  4B3O A;  5E3C A;  3DM2 A;  3UE2 A;  2JHE A;  3T1A A;  5HMX A;  2VFT A;  4ZVO B;  3A8K A;  2CVI A;  2BRK A;  4RW9 A;  3ELH A;  1HNZ J;  2OPP B;  3IWN C;  4WP9 A;  1MU2 B;  2R7S A;  4L75 A;  4JB8 B;  3A8J A;  3OXF A;  3C2P A;  3BKT A;  4LVN P;  3T1H F;  2C42 A;  1X9M A;  1WOR A;  3VGS A;  3KLG A;  3MM6 B;  1Y7P A;  3CCV S;  2RNE A;  3TA0 A;  4RW8 A;  1NJZ A;  1J27 A;  4QPT A;  1SJF A;  4WE1 B;  3KUG A;  2EC2 A;  4ECV A;  3R3T A;  1JNZ B;  1RXO B;  2EFV A;  4OZN A;  4FPR A;  1NZA A;  3A3O B;  2OD6 A;  4QPX A;  5I3U B;  5KFM A;  4YY3 F;  4LF6 J;  2IDE A;  2MKS A;  3R7N B;  2AEF A;  3V4M A;  4C8M A;  4CLT A;  3D7S B;  3BO3 A;  4WZQ A;  2FJW A;  2KB2 A;  2XMV A;  2BM0 A;  4A8W A;  4Y00 A;  2CPE A;  2G9O A;  3MI7 X;  1K0T A;  1NUE A;  4PXE A;  1CJU A;  3M8S A;  3PV8 A;  2PO4 A;  2OFH X;  2HGM A;  1NXI A;  4UY8 5;  2AX1 A;  4DPX A;  5J1N A;  2QJ3 A;  2VL1 A;  1RWO B;  1SVD A;  2GML A;  4I68 A;  2IRY A;  4LFA F;  3RR7 A;  2XY5 A;  2BEF A;  4OYI A;  3K5N A;  4P2M A;  2BYC A;  2WB4 A;  1KTV A;  4YB1 P;  5FD1 A;  4BWM A;  3O3L A;  5LMU J;  5F8G A;  3R1L A;  4C0O C;  1UP1 A;  1CS4 B;  3CJK B;  2NXN A;  2ILY A;  3M32 B;  3CME S;  2DR6 A;  4ICL A;  5HAO A;  4ENO A;  2GW8 A;  4WKR A;  5CZX A;  4I69 A;  5ETL A;  2HMI A;  4FS1 A;  2HND B;  3FSI A;  4H4M A;  5DM7 Q;  1TV6 B;  4CO0 A;  4C7Q A;  3QO9 B;  4QIG A;  1RTI B;  4ZHR A;  7FD1 A;  3NBP A;  3EMT A;  1S9F A;  5IC6 B;  3K5O A;  4RZR A;  2ZBR A;  1VR6 A;  1RA7 A;  1UVM A;  5DGB A;  3FCW A;  1H74 A;  1SCJ B;  3G82 B;  2QYC A;  4P71 A;  4EBD A;  4AQY F;  3BSO A;  2XWY A;  3G8Q A;  2AW0 A;  4J9K A;  2W2N P;  4B9M A;  5J2M B;  1NSK L;  1IKW B;  2UU9 F;  5E33 A;  2Y8Y A;  3GJQ B;  2DGU A;  4P10 A;  1VQO S;  4WFX A;  1NJW A;  2YKO A;  4EZ6 A;  2MQL A;  3PYD A;  3BQ1 A;  3N4W A;  2R2R A;  2V8V A;  1KOO A;  4PQA A;  1K47 A;  4KO0 A;  4JBC A;  5AXM A;  3MHY A;  3FMW A;  4MKA A;  2VQF F;  1YJU A;  3PNI A;  1QAY A;  2HZA A;  5HVF A;  4P2X A;  1J5O A;  2B9E A;  2BE7 D;  1FKP A;  3OL8 A;  1UVL A;  2HHQ A;  5B0A A;  1SJ1 A;  4Q7A A;  1XBW A;  2VA3 A;  1N6Q A;  3TVZ A;  4DQS A;  1S6P B;  1N4L A;  2YKN B;  4C3K A;  1EET A;  1KC8 T;  4XPC A;  4DL4 A;  2HAI A;  2PEH A;  2AZ1 A;  2J5A A;  4JI8 J;  1KRP A;  4DEZ A;  1SKR A;  2QTW A;  3EUN A;  3IWX A;  1NDL A;  1ULR A;  2R7Q A;  4NML A;  3ILJ A;  1DTQ B;  1UWB A;  3NCR A;  2QMW A;  3HT3 A;  2HWI A;  4E0D A;  4GKK F;  1LW2 B;  2JJ4 D;  3DLK B;  4B08 A;  2OML A;  3AOC A;  3FSY A;  4FF2 A;  2K3I A;  1VIX A;  4X84 A;  2DIS A;  2B4P A;  1HA1 A;  1Q4R A;  3AD8 C;  2DHX A;  3CCZ A;  5L9X A;  1YJT A;  3DOM B;  4O3R A;  4KHM A;  2OGU A;  5AE2 A;  1RAI B;  2XY7 A;  4NLW A;  3MZI A;  2V63 A;  4B3S F;  3DCA A;  3I6P A;  4PYA A;  2B4O A;  3PO4 A;  2YX1 A;  3T3F A;  3K57 A;  1DLO B;  4K2J A;  1SQF A;  1E6V B;  5GAH I;  4JI1 J;  2LLZ A;  2HLT A;  1F2H A;  4DX6 A;  1KSP A;  3VAF A;  4DV5 F;  3Q24 A;  3GON A;  1X9S A;  2XCP A;  4ILL A;  4RW7 B;  2WSF C;  2BE2 A;  2DR7 A;  2GCF A;  4B3M F;  4USH A;  2XSJ A;  4HTJ A;  2AT1 B;  4O44 A;  4ZIW A;  3LP1 B;  4X62 J;  3KHH A;  4EBE A;  3KJV A;  3RAM A;  3WC0 A;  2VBY A;  2ZH6 A;  2CFX A;  2JSX A;  1X7V A;  1NHV A;  4X4Q A;  4AL6 A;  2PD1 A;  4FXV A;  4RO0 A;  1S9E B;  2QZ8 A;  4K4Y A;  4H54 A;  3AAW B;  3BGF A;  2GVD A;  3JTP A;  3Q83 A;  1M5K C;  1C1C A;  5H9E K;  2A3J A;  3AY0 A;  1ARO P;  3EPI A;  3CDA A;  3TWZ A;  3LW5 C;  4CH7 A;  3PFE A;  4B9U A;  1FA0 A;  1S59 A;  2RML A;  1N34 J;  3J81 U;  3RW7 A;  2Z56 B;  3FZB A;  3ADA C;  3CB4 A;  3D0I E;  4W98 A;  1TL3 B;  2OH2 A;  2DHG A;  2AIR B;  5G0R A;  2HYI B;  5KAK A;  1GXT A;  3GG1 A;  3BPS P;  1KDN A;  3R5C A;  1ZH5 A;  2R4F A;  4NE9 C;  1TU0 B;  5D4N A;  3SQO P;  4N8N A;  1Z2L A;  1FJ7 A;  3TX0 A;  2L9N A;  4HH1 A;  1FK9 A;  2XGP A;  1EP4 B;  2PMZ D;  1VK8 A;  1D8Y A;  2DPI A;  1X4B A;  2V34 A;  1HPZ A;  3KLF A;  3HSJ A;  4QIE A;  3QLH B;  3D6F B;  4CTA B;  2ZH7 A;  4NYZ A;  4RW6 B;  3FRY A;  5HO4 A;  2WON A;  2OPQ B;  4KBI A;  3TUJ C;  2CJQ A;  2IYI A;  4X4P A;  3QJJ A;  4LMZ A;  1Q8K A;  2ZH1 A;  2NYI A;  4FDF A;  5KFS A;  4QYZ J;  3OT9 A;  2PI4 A;  2C28 A;  3EGW B;  1IBC B;  2UUC F;  3KG1 A;  1REG X;  1PAU B;  1OWX A;  1QE1 B;  5CA5 A;  4DV0 J;  1TEL A;  2WB1 D;  3JSM A;  3V5R A;  3E01 B;  1L3V A;  1TKT A;  2HLU A;  4YHH F;  1W25 A;  1RWM B;  3S8S A;  4L73 A;  2B51 A;  5KFA A;  2BJ7 A;  3W3S A;  2MLZ A;  1SH0 A;  3Q2T C;  5F8M A;  3B4D A;  3IG1 A;  4DFM A;  2ASY A;  5KFV A;  4EK2 A;  5KFY A;  5D4O A;  4KGZ B;  1S49 A;  2PSZ A;  2W8K A;  2B56 A;  2XUL A;  4KFB A;  3IR5 B;  1T8E A;  1HL6 A;  2LKZ A;  4ECS A;  2MHN A;  4ZIV A;  2DIU A;  2CPX A;  5M2U A;  2EBE A;  2L41 A;  2W4D A;  3M2V A;  1IKY B;  2GMJ A;  1JLB A;  1P9Q C;  4QBU A;  1XMO F;  2OPS B;  4LFC F;  3B8H A;  4JV5 F;  4ZVE A;  1HWI A;  4DL2 A;  4ELT A;  3LTO A;  3NNA A;  2GGP B;  3RB6 A;  1VJQ A;  5HI7 A;  4DU7 A;  3IM9 A;  1SL2 A;  2X1A A;  2FJA B;  4OZJ A;  4NCG A;  3VAG A;  2Y3Y A;  4RLE A;  1HBN B;  2C2O B;  3LUY A;  1Q79 A;  1AUS L;  2W9B B;  2HHV A;  5HK4 A;  2RQM A;  5C25 A;  4AXJ A;  5JVH Q;  3EJM A;  1R6Y A;  3H2U B;  3K8V A;  3SBM A;  2IYG A;  4JI0 F;  1U6F A;  1FNO A;  2DIT A;  3T5J A;  3KYL A;  5KFP A;  2KG0 A;  1OPZ A;  3AD9 C;  3V6H A;  3K59 A;  3NNH A;  1S1T B;  2XMA A;  4DF4 A;  2HHT A;  2WW8 A;  4OJ3 A;  3CJT A;  3UN2 A;  1EKR A;  4J7C A;  2YTC A;  3R1H A;  3OR2 A;  1MN7 A;  5D3G B;  1YVF A;  2NLW A;  1W7W A;  2HKE A;  4LVO P;  3D1Q A;  2ASJ A;  2EC0 A;  3M6X A;  3QFW A;  2KJW A;  1UVI A;  3NCQ A;  2W7A A;  4NL5 A;  3GFX A;  1U49 A;  3QYY A;  1E6Y B;  4PPZ A;  1BQX A;  1X60 A;  4CWB A;  4NA2 A;  4CDI A;  2XI2 A;  3DXS X;  1F9F A;  2BAB A;  3DGP B;  4FNH A;  4M94 A;  4PXD A;  2UXD J;  1N5T A;  2OEK A;  1FEH A;  3QPI A;  4J9S A;  4FF4 A;  2C22 A;  3HVT B;  1PJ5 A;  2XCA A;  1PYS B;  1H2V Z;  1KVI A;  2FC8 A;  2V8G A;  5KFF A;  3HI9 A;  2LEC A;  4AD6 A;  1UJ6 A;  4FYV B;  5LXY A;  2E66 A;  2BW7 A;  1VRT A;  3WX4 A;  1NKC A;  2W9A A;  2J0Q D;  4PWU A;  3GJT B;  5LXR A;  3DLL Q;  1RP5 A;  2ZJQ Q;  3M05 A;  3UDE A;  4OZ5 A;  2W4P A;  1AZS A;  2F8E X;  3NEK A;  1AUD A;  2YX4 A;  4JI2 J;  4NLG A;  3I4H X;  3MED B;  2AJQ A;  3CGI A;  5HJY A;  1LFW A;  3DMJ A;  1H98 A;  1ZA2 B;  4Y2I A;  4YOE A;  2ZD1 A;  1NO8 A;  1S6U A;  1SJ3 P;  3JSB A;  4Y2C A;  4DX7 A;  3BH6 B;  4I2P B;  3C16 A;  1FI4 A;  2A2D A;  3EGZ A;  1HHQ A;  3F44 A;  2CJY B;  3PDN A;  2E5I A;  3GG0 A;  1ZET A;  1UFW A;  5HBM A;  4LQ9 A;  1YWX A;  3QT7 A;  3C3L A;  5CYM A;  3H59 A;  3QGG A;  1HQE B;  4A8M P;  3I9V 9;  5DDQ C;  2Y1R I;  1Y10 A;  4X4R A;  3Q8V A;  2KVI A;  3CNQ P;  1SUQ A;  2BKN A;  3FRZ A;  1SKW A;  5ETV A;  4M1K A;  3LA0 A;  2CPJ A;  3OW2 R;  2Z58 B;  5IZH A;  1I51 B;  4ZVH A;  4M5N A;  3EVM A;  2UVU A;  1NSQ A;  4AT1 B;  2X1G A;  3G9C A;  4UTG A;  2FLO A;  3NMA A;  4DFK A;  3EIC A;  3MUM P;  1YI2 S;  1HNI A;  4XPE A;  2FHK A;  2LA4 A;  1XK8 A;  1RZM A;  1UCN A;  2GNK A;  1TL7 B;  4HDG A;  4UW2 A;  3DNC A;  2B5J B;  2KFY A;  2VG5 B;  3HDS A;  2YXL A;  4ED5 A;  5H9F J;  3IGV A;  5HRO B;  1S1W B;  2HHH J;  3KK1 A;  2O1P A;  2W01 A;  1I5O B;  2V68 A;  2NXE A;  2KH9 A;  3BBF A;  3ISN C;  4HAC A;  3ICL A;  3W9H A;  3M2R B;  3BN4 A;  1U2C A;  2SXL A;  3SIP B;  3D6T B;  2ZIT A;  4K0K F;  5L1I A;  2CZ4 A;  5A2Q U;  3D54 A;  4M8L A;  3PW2 A;  1WDT A;  4IH6 A;  1H7W A;  1RWX B;  4F4A A;  4LR9 A;  2F3J A;  4MIB A;  2ZE2 B;  4JI4 F;  4J9V A;  4WTO B;  4TU9 A;  1R8A A;  3SI8 A;  4I0W A;  3GCX P;  4LBP A;  1LWE B;  4ZKA A;  4DL0 C;  4X65 F;  2E7X A;  5I3P A;  3IR6 B;  1VYA A;  2YVS A;  2EKY A;  2L9D A;  1X5T A;  1RKJ A;  1S9G A;  1OYD A;  3RU0 A;  1URN A;  1NBE B;  3SCK E;  3GJR B;  4H4O B;  3H25 A;  3DLB A;  1S4E A;  1PC5 A;  1P9Y A;  2ZH3 A;  2QA4 G;  5JVG Q;  1HBO A;  1WHY A;  4N7T A;  1RT6 B;  1HI1 A;  1G2E A;  3NAH A;  2OMO A;  4J9L A;  1B7F A;  1WF2 A;  2J9E A;  1WC6 A;  1HBU A;  2X1B A;  3DRS B;  3AOB A;  3HXM A;  1W2I A;  2DNK A;  2VG6 A;  1BQN B;  1YSJ A;  1D09 B;  4BDP A;  4P2S A;  2EG2 A;  3PYF A;  3GIK A;  3EYZ A;  4EYH B;  4C11 A;  1N33 J;  1JLC B;  2V6A A;  2B8P A;  3PR5 B;  1RT1 A;  3TAP A;  1GNK A;  4GO5 X;  3O5T B;  4LF6 F;  1YJV A;  2YH0 A;  1R8B A;  3HCX A;  4DUZ F;  1TVR B;  4S0M A;  1XNQ F;  3PXG a;  3HHE A;  3SDE A;  2YY3 A;  1YJN S;  3MEG A;  2MZS A;  4UQT A;  4EEY A;  2RB7 A;  2DR9 A;  1VFJ A;  4IR9 A;  3RTV A;  1X4A A;  1SJ4 P;  4RUC A;  2ZZT A;  3VAH A;  2GFF A;  5IT4 A;  2GO8 A;  1NH7 A;  3H20 A;  2RAQ A;  4MK9 A;  2Y0B B;  2ATC B;  5LMN J;  3KOA A;  4P7T A;  1TL5 A;  1S1X A;  2MKH A;  2IDL A;  4RL1 A;  5LJ5 Y;  2C3U A;  1FRI A;  4JI3 F;  4HTI A;  1F9H A;  5K14 A;  3J7A N;  5LMU F;  1WDD A;  1LXN A;  4OYB A;  3FQL A;  4KKO A;  4KYZ A;  3OL9 A;  3EXC X;  4O4G A;  2UVW A;  2WBM A;  2CXE A;  1NAQ A;  3LWM A;  4F7V A;  1Q78 A;  1P8G A;  2JC1 A;  4CT8 A;  3IS9 B;  2E9Z A;  3T5L A;  3LP0 A;  5ETS A;  2AEJ A;  2CQ3 A;  4ER8 A;  4FVM A;  3CDW A;  4DR5 J;  3IAM 9;  4QR2 A;  2XYH B;  4Y34 A;  1U1Q A;  3F41 A;  2HFV A;  4PUO A;  1FT8 A;  5J2Q B;  2DNZ A;  2HS3 A;  2RE1 A;  5A8K A;  3V81 B;  4ZVF A;  4AFF A;  2UXB F;  3W61 A;  1KVJ A;  1T9T A;  1FXL A;  4OJ1 A;  5I4M A;  2GV1 A;  4JI7 J;  1T3N A;  1ROF A;  2IJR A;  2RS8 A;  3M2U B;  5E3P A;  1AFJ A;  2KYZ A;  2W24 A;  2QE5 A;  4HI2 A;  4F4K A;  4O0I A;  3CF5 Q;  1CC8 A;  3OLB A;  1HYS B;  4GVB A;  4DV1 J;  2DKO B;  2YKM B;  2WRM A;  1UEU A;  3DFE A;  1QDU B;  2GIQ A;  5HN0 A;  2ZM6 F;  5KG2 A;  3HP6 A;  3C14 B;  1N5Q A;  1RTD A;  1U8W A;  1YJW S;  5KG0 A;  3NAI A;  5G4D A;  1UAW A;  3TAN A;  1SL1 A;  2K1R B;  2BX6 A;  3BYR A;  2RQC A;  4QIW D;  3I96 A;  1VBK A;  4IDK B;  5KT6 A;  4FXD A;  1LFP A;  2CYY A;  1F0X A;  2DR8 A;  2Z2M A;  3UD5 A;  4GKJ J;  4O3N A;  3BR9 A;  5FLX Y;  2EBG A;  1CJK B;  4RPF A;  4ZJO A;  1PCA A;  2KTQ A;  3E8O A;  4WZM A;  4LRC A;  5GAE U;  4KE5 A;  3A13 A;  3LAK A;  4AL7 A;  4ANE A;  5IV4 A;  5SUH A;  2XG8 A;  1RT2 A;  3HVR A;  3BBC A;  2JNJ A;  4B3R J;  4PWD B;  4OI2 A;  5A6P A;  3P45 B;  3LH2 S;  4WK1 A;  4YEA A;  2H9Z A;  2VQE F;  5BR8 F;  4QYR A;  4WJB A;  4DL6 A;  4K4U A;  3VAL A;  2G13 A;  3CDU A;  3QNW B;  2IVF B;  1JLG A;  1PKU A;  2PEB A;  2V94 A;  2J6T A;  5THW A;  3JQM A;  4U7U D;  2ZKT A;  2HVZ A;  6FD1 A;  3O8W A;  2M7S A;  1D3W A;  2PN6 A;  2I6W A;  1C0T A;  2N4D A;  2R2S A;  3RGI A;  1KN6 A;  4MYT A;  4B3O B;  2LQ8 A;  2AZ3 A;  1Q95 G;  2RRN A;  5L1J A;  3V6J A;  4JP8 A;  4RW9 B;  3HHL A;  4WFZ A;  4R0E A;  3ZNJ 1;  5CHC B;  4PXC A;  3KKF A;  1OSC A;  1SKS A;  1KBR A;  4X62 F;  5M2R A;  3ZTR A;  1Q82 T;  3KLG B;  1YIT S;  4KGX B;  4NLU A;  3MPY A;  3JB9 k;  2K3K A;  5D0R A;  2KDO A;  2VKZ G;  5AXL A;  2C3O A;  1NKE A;  2IBO A;  2K7J A;  1IKX A;  3NGR A;  3KLV A;  3TA1 A;  3G8S A;  4K5R A;  3GQC A;  2W9C A;  5D0H A;  1YBU A;  2UUA F;  3CJ8 A;  5EGY A;  1N34 F;  1T95 A;  1UA1 A;  3Q8U A;  3HK2 A;  1CC7 A;  3SQG B;  1JLE B;  4PKD B;  2J76 E;  4XTT A;  3T6B A;  3CJS A;  1REV A;  2DT9 A;  3ZTS A;  2XMK A;  5A8R B;  3QJP A;  3AQO A;  3AJD A;  3W60 A;  5I42 B;  2KM8 C;  4E8U A;  2R3V A;  3CC2 S;  2VIH A;  2E1M C;  1T3O A;  2G2Y A;  2UUW A;  4USK A;  2A18 A;  1JXE A;  4E98 A;  1SJQ A;  5DZ7 A;  2FIU A;  2Q43 A;  1DY3 A;  3FBE A;  3H90 A;  5E5N A;  3U7J A;  2G2Z A;  1Y4Z B;  2OIH A;  5F8N A;  4P9S A;  5EDW A;  1R8P A;  1U6B A;  2CQH A;  3MPW A;  3D67 A;  4LSZ B;  2HVE A;  2QSW A;  4ICL B;  1YHQ S;  3FBF A;  2Y9H A;  3RB0 A;  3QRP A;  3PZP A;  1WUU A;  3OL7 A;  1HMV A;  2HMI B;  4DR7 J;  2V2Q A;  1KQG B;  4ETZ A;  4H4M B;  2OJ3 A;  4B9T A;  2KT3 A;  2UXC F;  2FHM A;  2ZH9 A;  1V3Z A;  1CBK A;  4UT4 A;  1T9X A;  2IBK A;  3QRQ A;  4DV3 F;  1F6T A;  1FTC A;  5IXU A;  3HPO A;  4DR4 J;  1XNR F;  2F8M A;  2ROP A;  1ZS6 A;  1RT7 B;  4IKA A;  4UOF A;  2J9C A;  2DR5 A;  4CYU A;  4CLU A;  1S1U A;  4HVZ A;  1CUL A;  4MMO A;  2WSE C;  1JXL A;  3SV4 A;  4I7F B;  3ISN D;  2GJF A;  4OQJ A;  1Q81 T;  3MD3 A;  1EB0 A;  4FF3 A;  4U95 A;  3GU0 A;  2D3O 1;  2A2C A;  2IVY A;  3OJS A;  3G71 S;  4CNY A;  3CE8 A;  4NXM J;  1NH8 A;  2CQD A;  3FVY A;  4A8Y A;  2PI5 A;  4G3I A;  5LL6 d;  3BQ2 A;  1HD1 A;  3K5P A;  5ETT A;  1J5O B;  1RJJ A;  2AYG A;  4DSL A;  5L38 A;  2ZC4 A;  1ZBT A;  2DO4 A;  1B4S A;  4WII A;  1N6Q B;  2VG7 A;  4IFV A;  3ENW A;  1EET B;  4V19 X;  1SKU B;  1D8Z A;  4DSI A;  2GO9 A;  3H5U A;  2NUU G;  3SCJ E;  3AHP A;  1Q7Y T;  2VON A;  3PCO B;  1KEK A;  3BDP A;  3LO3 A;  2M5Y A;  3N79 A;  2L3M A;  3FC9 A;  3P8B B;  1FXR A;  1U26 A;  1U8S A;  4XO0 A;  4DQR A;  2DGT A;  1N0V C;  1YJ9 S;  2NZ4 A;  2F8H A;  4KB7 A;  3UR3 C;  2ALZ A;  2OEJ A;  2FZK B;  2CIM A;  3UPF A;  2BQR A;  3I4P A;  3O1L A;  1HAR A;  1ZAX A;  4OX9 J;  1IBK F;  3M9M B;  1FDA A;  2JZ5 A;  3CJQ A;  5C2G A;  5F8I A;  3DU5 A;  1GX5 A;  4ID5 B;  2GIR A;  1TKX A;  3VAJ A;  2BXJ A;  2GC8 A;  3GPA A;  2FHJ D;  4XDD A;  1I94 J;  1GEH A;  4HT7 A;  1M1K T;  2Z8Q A;  1RCX B;  3K5M A;  4YB6 A;  5L9N A;  2WTF A;  3OTC A;  2AYB A;  4O4R A;  5KFX A;  2CPH A;  4O44 B;  1PSD A;  5C2C A;  1GT8 A;  5AE3 A;  4Q0B B;  5KFZ A;  3MCM A;  2ZHO A;  1IBM F;  4RNN A;  3KJV B;  1WI8 A;  4HYK A;  1UVN A;  5EX0 A;  3G6X A;  1CQM A;  1V3S A;  5KFK A;  4DV7 J;  5A6W A;  1VQ7 S;  2RIL A;  1BD6 A;  4ECT A;  4IOA Q;  3R6G B;  2ABY A;  2B0G A;  5KOW A;  1GFW B;  2GVD B;  2VH7 A;  2RDI A;  4K4V A;  1C1C B;  1B64 A;  3DC2 A;  4W4M A;  2BOP A;  2CJA A;  1FD8 A;  3AXK A;  1LWC A;  3AOD A;  1FF2 A;  4QWA A;  1WHV A;  3IXQ A;  3FFI A;  1YZ7 A;  2LDI A;  2G0J A;  4EUV A;  2LQB A;  2V4J A;  5L1K A;  4KH1 B;  5ETO A;  5G0R B;  2XEX A;  1SH3 A;  4JI6 F;  4OYA A;  4X66 J;  3OBI A;  3VCD A;  2CQ4 A;  2LQ5 A;  3W2W A;  1WEX A;  2YNH A;  2E1R A;  5F8L A;  4XK8 C;  2HBQ B;  2VOO A;  2AQ4 A;  3PEH A;  2ALY B;  4OYM A;  4YFU A;  1C0U B;  1TP7 A;  4RX6 A;  1ELO A;  1TUV A;  1HPZ B;  2F7V A;  4QIV A;  3KLF B;  1T9W A;  1NDC A;  5B09 A;  1DFD A;  5HVG A;  3IMQ J;  3EGV A;  2HVH A;  3GV7 B;  1CG2 A;  3CJ5 A;  4WFA Q;  2WON B;  2AHO B;  1MMD A;  2UV8 G;  3M4X A;  2VZ9 A;  1H6K X;  2HFN A;  1RI7 A;  4OMF G;  2D1C A;  2DXF A;  5EWE A;  3HZE A;  4A8F A;  3PTW A;  4JUZ A;  3A8E A;  3QJL A;  2HWH A;  2CQ1 A;  5JMN A;  3O6Q A;  1RHU B;  4CI0 B;  1P27 B;  1NK6 A;  4DV6 J;  2HS0 A;  4QYZ K;  4C8L A;  3MCN A;  3R2D J;  4J90 A;  4F4X A;  1H2T Z;  3GYN A;  2RHQ B;  5BXI A;  2AGO A;  2KHC A;  3I0S A;  4DPT A;  1IQT A;  4I56 A;  4K5S A;  3GSD A;  2DNH A;  3JSM B;  4TY8 A;  2YWW A;  2XTJ P;  1CQN A;  2GVZ A;  1TKT B;  5HL7 Q;  1UA0 A;  1R8H A;  4JI5 F;  3TAM A;  1CJT A;  1X4G A;  1U1R A;  3GV5 B;  3ZTP A;  2ZHA A;  1EAR A;  1CVJ A;  2OI2 A;  3IG1 B;  4BLG A;  2MQM A;  1TAQ A;  1BGX T;  3FJ2 A;  1EZZ B;  4HEA 9;  1PYO B;  2PMH A;  4PG4 A;  3M30 A;  3AXM A;  3QQC D;  2VJV A;  2FC9 A;  1B70 B;  4KFB B;  2IAJ A;  1TMM A;  2MGZ A;  3RBX A;  4Q8F A;  3P49 B;  3RW6 A;  3MEK A;  2B9Y A;  2NUH A;  2FGC A;  2V67 A;  1IJE B;  3CCL S;  3V6D A;  4LJM A;  4X64 F;  2HWT A;  1RHJ B;  1XQI A;  2ZNY A;  3M2V B;  1JLB B;  2F4V J;  2LEP A;  4DQP A;  3U1M A;  5KFH A;  1VC0 A;  1DHM A;  4HT5 A;  4FXW A;  4K4T A;  3RUB L;  2LEB A;  5C42 A;  1YJR A;  4G1Q A;  2Z4P A;  1Z1Z A;  5IT9 U;  4Y28 C;  3MR5 A;  3PHE A;  4WU3 A;  2KL8 A;  2AYM A;  5HVH A;  2CJ9 A;  2WHO A;  1FX4 A;  1VHI A;  3FDS A;  2APO A;  4OZ2 A;  4CIO A;  3PKY A;  2CAD A;  1OMS A;  3GIR A;  3VHQ A;  2VIC A;  4NCG B;  1HWL A;  1VDH A;  4USJ C;  4G65 A;  3HSD A;  2RF2 B;  2V9K A;  4KJI A;  1UKU A;  2NCK L;  2B4V A;  4ZCK A;  1RT4 B;  3J81 j;  2JEI A;  2DTJ A;  3FCH A;  1HNX J;  3GIL A;  1UW9 A;  1S76 D;  3EVO A;  2ZUA A;  1UZH A;  1DZ5 A;  1RHQ B;  2D3Z A;  3R5A A;  5L1L A;  3MUV P;  1GXU A;  5A0Y A;  2QMU B;  2BAC A;  4XDC A;  1U48 A;  4DR2 J;  2HS4 A;  1RUS A;  3LAL A;  3DI6 B;  1HR0 F;  3NKY A;  3OR2 B;  4LBI A;  2RU9 A;  4RKU C;  1MSW D;  3UNY A;  2R42 A;  1VBY A;  5KT2 A;  2CQP A;  3ISZ A;  2ZDO A;  2O66 A;  4F2S A;  3EZ5 A;  1TK5 A;  1N36 J;  3D0G E;  1WKL A;  3KG0 A;  4R8U B;  4KY3 A;  1VIS A;  2WOM B;  5BYS A;  2HK2 A;  4L6V 3;  3TEG A;  2KO1 A;  2KHD A;  1RKI A;  1H73 A;  1SI9 A;  2WVC A;  2OLW A;  4LSN B;  2NYH A;  2CQC A;  4YB7 A;  4ELV A;  3TA2 A;  4J9R A;  4Q2L A;  3L09 A;  1FVQ A;  4U6P A;  4EU0 A;  1X4C A;  2ZH8 A;  2MY7 A;  5DLF A;  2IFX A;  3M9O B;  3KJN B;  4M5K A;  2O3D A;  2GQ2 A;  4ZVR B;  1OS5 A;  4UY8 T;  1VIO A;  3MR7 A;  1RTZ A;  2LXU A;  2AKW B;  2V8H A;  3MAA A;  1CJV A;  1WKJ A;  3MMB A;  3J80 U;  4EBC A;  3NL0 A;  5K8N A;  4B9S A;  1XJW B;  1YLX A;  3PRD A;  3OJU A;  1C4C A;  1RAD B;  4K4Z A;  2IA0 A;  4NLX A;  4NEY A;  4U8Y A;  4JYA J;  1Z4U A;  2MZ1 A;  3QZ8 A;  4W92 B;  4PZV A;  1GAO A;  3DRX A;  1RTH A;  2XNQ A;  3C16 B;  5ADZ A;  4CLL A;  1RT5 A;  2J6U A;  1PBA A;  4ZPT R;  5HBM B;  1VQK S;  4OLP A;  3DGV A;  4DR5 F;  1N5V A;  3DDK A;  3PW5 A;  1NLK L;  4CRJ A;  2AF6 A;  1EIY B;  2HVD A;  1L3K A;  2OPR A;  5B7W A;  1B0T A;  2ERR A;  2E5L J;  4DXL A;  1DUR A;  1SUQ B;  1ZOT A;  3OTD A;  3UQS A;  4NLR A;  4OHX A;  2QFI A;  3J81 Y;  2KXF A;  5LSR A;  4Y2K A;  1IN0 A;  2F1F A;  1JK9 B;  2FYX A;  3Q2S C;  3MUR P;  2VFV A;  3KLH B;  5IM0 B;  4EMD A;  1HNI B;  2AGP A;  4WCE Q;  4QU6 A;  4U9R A;  4PWW A;  4KHR A;  1HNW J;  4I6Y A;  4MH8 A;  5U47 A;  4DZ6 A;  5F3T A;  4ZVG A;  3JXO A;  2QRR A;  4DSE A;  2HHX A;  3B6B A;  5H9F K;  3CJ4 A;  1F9E B;  3G86 A;  1WJ9 A;  4YUD A;  3DRR B;  4TKT A;  1C1B A;  2F9J A;  4O3O A;  2E5H A;  3NG8 A;  3OSP A;  1Q1K A;  5DG8 A;  3IM8 A;  3MM6 A;  3TAR A;  3P6Y C;  1OPI A;  3NGD A;  1KLM B;  4OHZ A;  3M8P B;  4Q2M A;  2BE9 B;  4CQ1 A;  1SPB P;  4PG6 A;  3D5M A;  3IBC B;  1FJG J;  1O51 A;  2AD9 A;  2Z0G A;  5I3U A;  4OI3 A;  1RB0 A;  3M8Z A;  1TL4 A;  2YNF B;  1QY7 A;  3G6E S;  4KGV B;  2FD2 A;  1FWP A;  1S9G B;  3I32 A;  2K06 A;  1Y5I B;  5CYJ A;  1VQM S;  1S0V A;  3H42 A;  1HW8 A;  4IFY A;  1JJH A;  4ERD A;  1HBO B;  3IRX A;  2M70 A;  3CJ0 A;  2V4R A;  2AX0 A;  4OYP A;  2JOQ A;  4YDX A;  2V8D A;  2KXN B;  1S5Z A;  3QGP A;  3CJ2 A;  3G8T A;  2RDD A;  5LSO A;  2DHH A;  3UFC X;  1U1L A;  2MQO A;  1RE1 B;  2MHE A;  2B43 A;  3MMA B;  4Q43 A;  4L76 A;  1ZA1 B;  3UDC A;  4KHP F;  3BGR A;  4NZ0 A;  1NJI T;  2CG4 A;  3M32 A;  4UZC A;  1R31 A;  2HQG A;  4EFA C;  4NLQ A;  2VAS A;  2KT5 A;  3W5Z A;  3QID A;  4C11 B;  2XWX A;  5DDP C;  1HI0 P;  4O3S A;  3M8W A;  2ZHB A;  3UCZ P;  4F3Q A;  4LF8 J;  3RAQ A;  1ICE B;  2A6M A;  2MDA A;  3P96 A;  4P7V A;  3N6M A;  1RTI A;  5J2P B;  3JSR A;  1W26 A;  1BLU A;  1KP6 A;  3WZ0 A;  1IKV A;  2C2Z B;  3SDE B;  1U4B A;  2CQI A;  4USM A;  2MKK A;  1VOM A;  2MSS A;  5KFJ A;  2E29 A;  1Q8B A;  3G82 A;  3QWU A;  3G6V A;  4B3T J;  4K59 A;  4ECU A;  1HQ2 A;  1RBL A;  5ETK A;  4WFY A;  5KFI A;  3KFW X;  2H65 B;  2DNY A;  3FZ2 A;  4ZN1 A;  1XER A;  5J2M A;  2R8J A;  1HIY A;  1IKW A;  1IWG A;  1O8B A;  1U1N A;  5HAN A;  1LWX A;  1S1X B;  3ZZU A;  2GA7 A;  1HLW A;  5IT0 A;  3R5B A;  4HLB A;  3Q8R B;  2CAJ A;  2GZO A;  4C48 A;  5E3A A;  2VDH A;  2AYE A;  5K14 B;  1RWP B;  2LVW A;  2L48 A;  2QGF B;  4KKO B;  3GJS B;  3TZZ A;  3C6T A;  4O4G B;  2MTL A;  2MKI A;  5KFT A;  2HRY A;  2B3T B;  1IXK A;  2C3Y A;  2R8G A;  2HUR A;  1VRU A;  1SC1 B;  3WHI A;  1Q53 A;  3LP0 B;  1FE0 A;  2JLG A;  1D0E A;  3LWL A;  4OI4 A;  1LW0 A;  4H4K A;  4LF7 F;  3W5X A;  1S97 A;  4PUO B;  1SIW B;  3R8Y A;  3EXY A;  2IM1 A;  1G6B A;  4DQI A;  1QUP A;  1WOS A;  2LEA A;  2O67 A;  5A8K B;  1LW2 A;  4Q8E A;  3DLK A;  1H3D A;  1YJ7 A;  3R27 A;  2XLJ A;  2Y8W A;  1U1K A;  4QZV B;  3UN3 A;  1VS3 A;  1IBL F;  2B6A A;  1IJF B;  1FVS A;  1FDN A;  4IQM A;  3DOM A;  2CDQ A;  3Q8S B;  3JTN A;  4GVB B;  1GX6 A;  2G1H A;  1R8C A;  1MWQ A;  1HFE L;  2DXE A;  3ZNU A;  5J1P A;  1X4F A;  3GB0 A;  3QAE A;  3TUP A;  1YRT A;  3BH7 B;  1BQM A;  3PW4 A;  2DBB A;  1OQ6 A;  1O5J A;  2VDI A;  1RTD B;  4QW8 A;  2DGS A;  1DJ0 A;  1BE4 A;  3I9Z A;  4RW7 A;  1WKK A;  2BJE A;  2R2U A;  3TJ9 A;  2VFS A;  4NYP A;  1T9V A;  2RKI A;  5K5M A;  1JB0 C;  3EM1 A;  3LP1 A;  3TUZ C;  3RBD A;  1OY8 A;  5HJX A;  4MT1 A;  2XB2 D;  4DS4 A;  4Y6I A;  1T0T V;  3I5A A;  1RBO B;  2DNP A;  4PQU B;  4YQW A;  1SQG A;  2IPO B;  4HL9 A;  4Y0F A;  1KLN A;  3DXB A;  2FVC A;  5J1E A;  3V4I A;  2JC0 A;  4YY3 J;  4U7C A;  5JJB A;  1JLQ A;  2EEY A;  4KQZ A;  2R7U A;  1FHT A;  3BV8 A;  1PIE A;  2CNO B;  1X4H A;  3ZZP A;  3OVB A;  3HUL A;  3QFH A;  4KRW A;  2EXU A;  3VWS A;  5B08 A;  2B9W A;  4ED4 A;  1ZPW X;  2WZ1 A;  4C3L A;  2EK6 A;  1X5O A;  1X9W A;  3MF5 A;  3WQP A;  3ZZY A;  2X1F A;  2EFN A;  3MR6 A;  3SYZ A;  4NOH A;  4OZ3 A;  1EP4 A;  2UUT A;  1O0P A;  3TAQ A;  4F4Z A;  3NMR A;  5IS2 A;  5A2Q Y;  4CTA A;  3TRG A;  4OYW A;  2C2N A;  4O23 A;  4L3N A;  2D7S A;  4LSL A;  4DV7 F;  3CCU S;  5GAG I;  3BSA A;  5L39 A;  2HHS A;  1B3T A;  3I55 S;  3OTO F;  3P5T L;  1IQZ A;  3BM7 A;  4KSE B;  3W62 A;  3KLE B;  2CJK A;  3D1O A;  2FJB B;  1MWZ A;  5KFL A;  2MB0 B;  2W9C B;  1RAC B;  2HW3 A;  1FXD A;  1X8D A;  1DTT A;  1RWW B;  4ZN3 A;  4QWC A;  3MUT P;  4PEO A;  1NKB A;  2GMH A;  2JL9 A;  3GR1 A;  4UF4 A;  3OHA A;  3NY0 A;  4ZDN A;  3POT B;  4ZP8 A;  1REV B;  4AQY J;  1X0P A;  3PEJ A;  4CT9 A;  1YG0 A;  2A0F B;  4I6A A;  3TP2 A;  3ZXW A;  4DLG A;  1XTZ A;  1WG1 A;  4ZPV R;  3PYE A;  4NLP A;  2UU9 J;  2RU3 A;  2QFJ A;  3G6Y A;  5E0O A;  1KHV A;  4TN2 A;  2PMW A;  3BSN A;  4AND A;  1QJH A;  3PIO Q;  2WVF A;  2ZDP A;  1RTJ B;  2P9E A;  2IY5 B;  5DRK A;  4N47 A;  3LPY A;  3FQK A;  2PII A;  4N77 A;  4ZVU B;  3IRW P;  1UVJ A;  2EI5 A;  3CXC R;  3EX7 B;  2IC3 B;  1HMV B;  1K1Q A;  3TZY A;  3DOK B;  1SIZ A;  4C8N A;  3UVJ A;  2HFO A;  2OPS A;  1MRO A;  5A8W B;  1XWL A;  1D9D A;  1L5U A;  4G1I A;  2ZWP A;  4TQS A;  2P8I A;  4URS A;  3S01 A;  6FDR A;  3DRP A;  1HQU A;  2JVR A;  4NLS A;  2GGP A;  2EG1 A;  4U8V A;  1EHW A;  1VMB A;  3HD1 A;  2QT7 A;  9ATC B;  2W2Q P;  4KC5 A;  1FKO A;  3UDL A;  1ACM B;  4OI6 A;  4GKK J;  4IOB A;  2HVI A;  2OP5 A;  2MQN A;  2I38 A;  1U47 A;  2CKW A;  3PYG A;  5AJ3 J;  4HKQ A;  1R89 A;  2YPZ A;  2XMT A;  5KG7 A;  5LSL A;  5DG7 A;  4I4B A;  2MST A;  1L3T A;  4CM0 A;  4B3S J;  1FWK A;  2M2B A;  5KG1 A;  5KG4 A;  1NJX A;  2ZJP Q;  3BO4 A;  2RUS A;  2FVS A;  2FVR A;  5CH7 B;  1BY9 A;  2A1B A;  2DH8 A;  4DV5 J;  5D3G A;  1GH8 A;  1QTN B;  4DV2 F;  2VBW A;  4ZP7 A;  2NXU A;  4DPW A;  2XZW A;  3KHG A;  1WNE A;  3W1Y C;  4DUY F;  3WBZ A;  1XEZ A;  1T03 A;  3H4D A;  3BO2 A;  1QTM A;  3UDV A;  2LQJ A;  2FJV A;  2JX2 A;  4IG0 A;  2AJ1 A;  3ITH B;  3CUN A;  4M5I A;  3QT5 A;  2M0G B;  3SZ2 A;  4M5D A;  2MZT A;  3ZZT A;  2OTJ S;  3QGI A;  4NZ7 A;  3EDR B;  2P6S A;  4WIQ A;  1JKH A;  1N8R T;  3RJM B;  2EPI A;  5D0E A;  2VFR A;  4J9N A;  1NHK L;  1S79 A;  3MM5 B;  2FY1 A;  2EVZ A;  4LIW A;  3BJY A;  4GMK A;  3B78 A;  3VVT A;  5KT4 A;  3W64 A;  2D41 A;  4DS5 A;  2OO4 A;  3P3D A;  2ZEJ A;  2AV5 A;  2HRT A;  2JEG A;  4WF9 Q;  2LU2 A;  1MMN A;  5GMK a;  2CQB A;  1OYE A;  5ETP A;  2XNR A;  3RR8 A;  4QJV A;  4ZCI A;  2J9D A;  1TUG B;  2CNK B;  5FDL B;  4MIA A;  4LQ3 A;  2XMW A;  2BRL A;  5KG3 A;  1HQE A;  1S6O A;  3ENQ A;  4Y3C A;  2DGQ A;  4A46 A;  5EWF A;  4DZD A;  3MM8 A;  2FHO B;  1PIL A;  2UUC J;  3GV8 B;  2B4U A;  3ET6 A;  1WOO A;  1X31 C;  3CCM S;  4M5M A;  2N3L A;  4UUX A;  2U1A A;  4D3H A;  4ED2 A;  1IR0 A;  1T05 A;  3DRY A;  2CPD A;  2CNL B;  2VBX A;  4YHH J;  1V6H A;  2L08 A;  3HLU A;  4DV4 J;  3EZU A;  1TR0 A;  3DHX A;  3A3N B;  1AYE A;  1I1G A;  2G0I A;  2YNH B;  3ZTO A;  3KUH A;  3H0P A;  3GLJ A;  2J7W A;  1JLF B;  2NS1 B;  4EI2 A;  3IO1 A;  3PG9 A;  4OI1 A;  5EHH A;  3S7R A;  3M2R A;  4LF5 J;  3CUL A;  2J7K A;  2FVQ A;  1AT1 B;  1G4C A;  1KQK A;  3KK2 A;  3CCR S;  2ZKU A;  3M7V A;  1NDP A;  4UQG A;  1UET A;  1WC3 A;  2DNM A;  1LNQ A;  2ZE2 A;  3SFU A;  5T14 A;  3D68 A;  2CUY A;  1XMO J;  2D9P A;  2GJ2 A;  3GSI A;  1NK8 A;  1NSA A;  2R7V A;  5IWA F;  3DOL A;  4JV5 J;  4A8K A;  2AJF E;  2XQC A;  1X5S A;  5GAD I;  2FGO A;  5DS7 A;  1KHW A;  5ETN A;  2WAQ D;  3DLG A;  4CM2 A;  3I0S B;  3NWR A;  1M1G A;  1WF1 A;  1NB7 A;  3VGT A;  2RH3 A;  3I31 A;  1FRK A;  1KD1 T;  1NEE A;  4H4O A;  1XMQ F;  2GVZ B;  1Q5Y A;  2LP4 A;  1RAF B;  4CLY A;  5D0G A;  4PR6 A;  1RT3 A;  1CJT B;  1RHR B;  4KT0 C;  4B17 A;  5HMY A;  3C19 A;  3D4J A;  3D6H B;  1QAI A;  3AFG A;  4AUK A;  3HJF A;  1N0U A;  1WOP A;  1XIQ A;  3DRS A;  4JI0 J;  2E5G A;  4ZPB A;  5E3R A;  3M30 B;  2R7T A;  4I2Q A;  3SEO A;  3GTY X;  1BQN A;  4RR5 A;  1IVZ A;  4X4O A;  5RUB A;  2QA1 A;  3M8Q B;  2UP1 A;  2MMY A;  3UNG C;  5GAH U;  1WHW A;  3V6D B;  2MQ8 A;  4ZS6 A;  4USW A;  1DBD A;  3OFE A;  4R5P A;  4YDD B;  1MW7 A;  1A6L A;  3DYA A;  2HHW A;  5F8J A;  3I0R B;  2YNG A;  4TXS A;  4O0N A;  4OJG A;  1TAU A;  3JAM U;  1FRX A;  5DQG A;  1U1O A;  3BS9 A;  1AA1 B;  3WX8 A;  4OX8 A;  3TUI C;  2BVZ A;  3KTQ A;  1RIS A;  5B0F A;  1SV5 A;  1FNM A;  4FYY B;  2KFN A;  4FS2 A;  4IUF A;  1UWA A;  1KR4 A;  3HSZ A;  4MYU A;  2R9L A;  4WKY A;  2WBR A;  2VJU A;  4ED6 A;  4UST A;  3KK3 B;  3BZQ A;  1FRH A;  2FY8 A;  3ZC4 A;  1C2P A;  3BGO P;  1FE4 A;  4ZVT B;  2ZOG A;  4F04 B;  2BKP A;  1PYT A;  5A0Y B;  2E44 A;  1WI6 A;  3CIZ A;  1U09 A;  2XY6 A;  1YX2 A;  4NX9 A;  3MM7 A;  5ETQ A;  2F40 A;  1JX4 A;  5LT5 A;  1RAG B;  2R7R A;  4QU7 A;  2AWZ A;  1Y3K A;  2PT0 A;  4F50 A;  4DR3 F;  4NA3 A;  4LF8 F;  4GC7 A;  4ZP6 A;  3IS9 A;  1KKH A;  4QCL A;  2ILZ A;  4IOC Q;  1S0M A;  3PKM A;  1DAX A;  3UO0 A;  2XHW A;  2FZC B;  3MEC A;  4FZV A;  4OHY A;  3CCE S;  5IFM A;  4Q45 A;  2M9K A;  1S10 A;  5KFC A;  5J2Q A;  2OUG A;  3OTE A;  5DET A;  1H2U X;  3D66 A;  2KRB A;  3HHK A;  2UUB J;  2RJZ A;  4EYI B;  1S12 A;  3HKW A;  2HNZ A;  3AA9 A;  2DHS A;  2FB0 A;  2KKH A;  4QOT A;  1CPZ A;  1RAH B;  3N5F A;  4E2F B;  3D9B A;  3MAQ A;  3T9Z A;  2E1P A;  1G1X A;  2DEI A;  2BJ3 A;  1CJV B;  3MMB B;  5D77 A;  3HHN B;  1UW4 A;  2DPJ A;  1XMB A;  2X3G A;  4OYO A;  5IC4 B;  3C14 A;  3K2Y A;  2HK3 A;  4ANC A;  1BXN A;  4LF9 F;  2XSF A;  2LXF A;  3IBF B;  1RYR A;  2GHP A;  1WG5 A;  3UR0 A;  3PX0 A;  2NPF A;  4HHH A;  4ECR A;  1RTH B;  2JLF A;  1V9O A;  2DRA A;  2ZUG A;  1RT5 B;  4LT6 A;  3OHB A;  2AJ4 A;  2IRX A;  2PFF B;  2CNN B;  1NRK A;  3MOJ B;  1N32 J;  1YBA A;  2HQD A;  4KTQ A;  3H5Y A;  2PFD A;  1CJK A;  1U0H B;  3BB5 A;  5B0E A;  2D3U A;  4JI4 J;  2CVE A;  5HP1 B;  4M5G A;  2HQF A;  2OPR B;  1S48 A;  3FKB A;  4WXW A;  3DU6 A;  2JVO A;  1HNV B;  1T7P A;  1TMJ A;  4X65 J;  4PG7 A;  4CNZ A;  3JYT B;  3IAS 9;  2N3O A;  1S1V B;  3LOU A;  5GAD U;  4LF2 A;  4OYX A;  1UTA A;  2AGQ A;  4OX6 A;  3BYP A;  4F3O A;  2QA4 S;  1JJ4 A;  2I1R A;  2C2D A;  1Q16 B;  4CLP A;  1OO0 B;  2I0X A;  5KT5 A;  4ZVS B;  5ETR A;  3H5S A;  4IRC A;  1YKW A;  2EFG A;  2J6S A;  3W2V B;  4N8O A;  4CO3 A;  2RIJ A;  4DPY A;  5K8O A;  2H5I B;  3MPU B;  3ILI A;  1HNZ F;  2BJ1 A;  4WPA A;  3CCQ S;  2CZ9 A;  3L9Z A;  5KFN A;  4IH5 A;  1Y3J A;  3NGU A;  1C1B B;  4DOZ A;  2Y1I A;  2ZZM A;  2QLX A;  3G4S S;  2XO7 A;  4DX5 A;  1FER A;  4OL8 A;  1EAY C;  2YWK A;  2KZZ A;  3DDI A;  5B0D A;  3F0N A;  4NI2 B;  4ZPW R;  3H98 A;  5K8M A;  4DSF A;  1QD1 A;  4DG1 A;  1P1L A;  1U25 A;  4ZLN A;  2XS7 A;  1V3R A;  4DUZ J;  3R6L B;  1JJC B;  1XNQ J;  2FLN A;  1R0C B;  3SQG A;  4URQ U;  2MKC A;  1JLE A;  4FPI A;  4ETX A;  3QRR A;  3BDE A;  1ZTT A;  3PRB A;  4IFY B;  4PRF A;  1APS A;  2HQ3 A;  3LAN A;  3CWJ A;  5A8R A;  2Y0S D;  1JXV A;  3IRX B;  1RYS A;  3QSI A;  2QA2 A;  2V2Z A;  5I42 A;  2OHD A;  2R7X A;  2CJB A;  3H5X A;  4KV8 A;  4PYD A;  3MFI A;  1ZAV A;  5GMD A;  2VB6 A;  1F60 B;  2ASD A;  1F5B A;  3FMB A;  2HBZ B;  2V50 A;  2H48 B;  3U02 A;  4WBF A;  4JI3 J;  3JSY A;  3ETM A;  1RAA B;  4QR1 A;  1N52 B;  1VQ9 S;  2NPI A;  1TL1 B;  3BGR B;  2HZV A;  4NLV A;  2D74 B;  3JQK A;  4KIA A;  1WF0 A;  1D1U A;  5J2N A;  3KLI A;  3W7B A;  4ATN A;  4Z37 A;  4ECY A;  5K9F A;  5EUH A;  1CLF A;  1VLO A;  2DCL A;  3NOG A;  4WFN Q;  3CJR A;  2YKQ A;  5BYR A;  4JV2 A;  3I87 A;  4DUT A;  3ZZZ A;  5IT9 Y;  4F25 A;  1F1B B;  3GFH A;  2DNR A;  4TYA A;  4IO1 A;  4NLY A;  5DDO C;  3ZO7 A;  2Y1L B;  1SQE A;  1IKV B;  3Q0A A;  1UL3 A;  2HIY A;  3CPW R;  4RW4 A;  1RT7 A;  1F5C A;  1PGZ A;  5CXT A;  3C8Y A;  3L95 X;  3L7O A;  4OV1 A;  5K8P A;  4CLF A;  3R7S B;  3TNV A;  4OFZ A;  4DJB A;  2AP6 A;  3LGH A;  1BWV A;  3LF0 A;  2UXB J;  2YQ3 A;  2CPZ A;  4OX7 A;  4L3K A;  4I7F A;  4N5S A;  4C6A A;  3QBC A;  7FDR A;  1NK0 A;  3MM9 A;  1LKZ A;  1R0A A;  2FPH X;  5EWG A;  5F9L A;  4U96 A;  1J5E J;  1LOU A;  4PG5 A;  4A8O A;  4DFJ A;  2OEM A;  3DKD A;  4K4S A;  4RNM A;  2POK A;  4U67 Q;  1JLA A;  3Q22 A;  3TW0 A;  5I3Q A;  3VAM A;  2ZM6 J;  1N5Y A;  3LGN A;  4KPC A;  4YB5 A;  4DSK A;  3C6T B;  2CWX A;  4ECW A;  2N82 B;  3A4T A;  4MAK A;  1WSR A;  4I6W A;  2D9O A;  1PBU A;  2IMO A;  3OV7 A;  3KNA A;  3RYL A;  4RBT A;  3ZZ0 A;  3TQ1 A;  4PAA A;  3MEE A;  2MZJ A;  3J7A 1;  3ZZO A;  5IOL A;  1FRL A;  3V2U C;  1FRM A;  1KFD A;  4KGM A;  1VRU B;  4P75 A;  5GME A;  4JI8 F;  1N54 B;  3Q86 A;  3ZFV A;  1Y0H A;  2GHW A;  6AT1 B;  1HBM A;  3DLE B;  1OY6 A;  1UPP A;  3J7Z T;  2ZH5 A;  1UFL A;  1LW0 B;  2XYP B;  7AT1 B;  4LUB A;  4DR6 J;  3QZ7 A;  1PJ7 A;  2EK1 A;  1SC6 A;  2YNI B;  4GVL A;  4A8X A;  5F3Z A;  4ITS A;  3N28 A;  3AB2 B;  5KTQ A;  3ZTQ A;  2B8Q A;  1RWN B;  3MMC B;  2JFD A;  2W2M P;  2W7P A;  2VQE J;  2QLF B;  5BR8 J;  4PPD A;  2RQK A;  3C6U B;  5AJ3 F;  2B6A B;  2GHV C;  2HRU A;  3FEX B;  3ENA A;  1PJ6 A;  2QMX A;  2AMC B;  3J80 Y;  3B54 A;  4JI1 F;  3MTK A;  4CZC A;  3DM2 B;  5HLF A;  1RSC A;  3D3C J;  4ID5 A;  1BQM B;  2JEJ A;  2X3D A;  2IA6 A;  3SXL A;  2JLE A;  1RLD A;  2MQQ A;  1AW0 A;  1K73 T;  2C2E A;  2P5V A;  5DQH A;  4DMZ A;  3MR2 A;  4WWS A;  1Q0N A;  4KH0 B;  2RKI B;  3W8G A;  4Q0B A;  4RW8 B;  1SC3 B;  3OXG A;  5DLG A;  2CPI A;  4ZLL A;  4J9O A;  4D3G A;  3CT9 A;  3FBC A;  3BGL A;  1M90 T;  2NR0 A;  1NSP A;  5CYQ A;  2QN6 B;  4RBU A;  4K4X A;  2XHC A;  3EZO A;  1FDD A;  5HQ8 A;  3GIM A;  4ZA1 A;  5J1E B;  3D6M B;  3V4I B;  1QVF R;  3U1N A;  5MAO A;  4C8O A;  4J5O A;  1JLQ B;  2V0N A;  2HHP A;  4J9Q A;  2MXY A;  2UUA J;  5DO2 A;  3PW0 A;  1CJU B;  2FVP A;  1GTE A;  4LRB A;  2DHA A;  2FHJ A;  2XLI A;  1HHS A;  2GJI A;  4BS2 A;  2W4C A;  1WEZ A;  8RUC A;  3H2V E;  2MY8 A;  3NNC A;  1HWK A;  4DL3 A;  4UOC A;  1LEO A;  4FBT A;  2LXI A;  5CD4 A;  1S77 D;  4OIX A;  1Y5N B;  2V9W A;  3TQE A;  3VVU A;  2RHS B;  2V8P A;  1C0U A;  4ED8 A;  4A8Q A;  1JQG A;  3G2X A;  2XZT B;  8ATC B;  3K17 A;  2QYG A;  3CJ3 A;  1VC5 A;  5DG9 A;  1FFW B;  5DDR C;  4LSL B;  3O2I A;  3RRK A;  3LAM A;  1WC1 A;  1KOH A;  2I9S A;  3OVS A;  1FRJ A;  4OZ0 A;  3MD1 A;  4IO9 Q;  4ZHR B;  1SJR A;  4MK8 A;  5AXN A;  3NBP B;  2UXC J;  2H54 B;  4DV0 F;  4DV3 J;  4FNI A;  1DTT B;  2ZWO A;  4K8R A;  4NLT A;  1XNR J;  1Y5L B;  4RWX A;  1TTH B;  4ES1 A;  3M8Y A;  4WP8 A;  2A6O A;  2HAF A;  1N88 A;  2H5E A;  4DV4 F;  3UN5 A;  4DSJ A;  2ZFH A;  4YS2 A;  4JOU A;  1F2G A;  2KU7 A;  2ZNZ A;  2F4F A;  2ZBC A;  1SB6 A;  3CW2 C;  4DPU A;  3CD6 S;  5HSP A;  2DJW A;  1WSV A;  5C24 A;  2NSC A;  3GFZ A;  1WEL A;  4KO0 B;  3TZX A;  5L46 A;  1YRU A;  2IM3 A;  2CPY A;  4LF5 F;  5HMZ A;  4ECQ A;  3KMS A;  1EX8 A;  1FKP B;  4LRA A;  4TVA B;  4C2M A;  4FKX A;  2J0W A;  2M8D B;  3RZA A;  2CWK A;  4GO7 X;  3JTO A;  5IV3 A;  1M5V C;  3UVJ B;  4ZOS A;  1Y9O A;  1MRO B;  4EWT A;  1I3O B;  2C3M A;  2ROE A;  4ID8 A;  2KI2 A;  3DRP B;  3RAX A;  1HQU B;  4N41 A;  4A47 A;  1JNR B;  4LR8 A;  4DDF A;  1PG5 B;  3IBW A;  3CMQ A;  1UWB B;  2OKQ A;  3SV3 A;  3CC7 S;  2DCU B;  3OSN A;  3IC1 A;  1FKO B;  1XR5 A;  4ES3 A;  4LF1 A;  3D3B J;  3MR3 A;  4DL5 A;  2RF2 A;  4FBU A;  4C97 A;  2E7W A;  3AH6 A;  1SH2 A;  4V19 J;  2XO6 A;  1FD2 A;  1FFG B;  3N01 A;  1RT4 A;  1M1H A;  5CZV A;  1NK7 A;  3AJ1 A;  3HFV A;  1ZM9 A;  2W25 A;  4MK7 A;  4ZCL A;  1IBK J;  3KUE A;  1VC6 A;  1YBT A;  1VQ4 S;  1SXL A;  4JV0 A;  2I8E A;  2VV5 A;  1JIH A;  4DR1 J;  4P52 A;  1RAB B;  3DI6 A;  4M95 A;  1U6Z A;  3QIP A;  2OSQ A;  2DNN A;  2RUG A;  2BE2 B;  1JJ2 R;  2EFO A;  2XSJ B;  3ZZR A;  3A8I A;  4UOH A;  3KG4 A;  2UXD F;  2VC1 A;  1IBM J;  3C46 A;  2XS5 A;  3US5 A;  3EDQ B;  4MFB A;  3CD5 A;  1T03 B;  3D1H A;  2ZJR Q;  2N7C A;  3D2W A;  4R8U A;  3VQT A;  1Z2Z A;  4QWB A;  2WOM A;  1IM6 A;  3A1Y G;  5T41 A;  2Q79 A;  4IG0 B;  1MWY A;  4RU9 A;  4TU8 A;  4LSN A;  2RDJ A;  1YGY A;  3HZG A;  2XI3 A;  4DF8 A;  2BQ3 A;  4M5D B;  3NS7 B;  3H8Y A;  2NXJ A;  3LP2 A;  3W9I A;  2FJD B;  4MIW A;  4ZPC A;  3H40 A;  1WTB A;  2KN4 A;  3NWG A;  3M1V A;  4IQX A;  3HKZ D;  1NPR A;  1EQ0 A;  4LRF A;  1JKH B;  1GK8 A;  1KS2 A;  1WC5 A;  1RAJ A;  4F02 A;  2BMB A;  2BW2 A;  4JI2 F;  2QX0 A;  4PG8 A;  1SBR A;  1U7L A;  2KT2 A;  3CCJ S;  3L7U A;  3OR1 A;  4JI6 J;  4ECX A;  3H4B A;  2X7I A;  5HQL A;  3T6J A;  2IM0 A;  1KVK A;  2Z2L A;  1FK9 B;  3SFG A;  4CLS A;  4G1P A;  3HD2 A;  3QT8 A;  4NYO A;  1L3U A;  5KFB A;  3NRB A;  4J9M A;  4Z2X A;  3T41 A;  1NK4 A;  4DI6 A;  2CQ2 A;  4C3M A;  2ASL A;  4TYB A;  2VA2 A;  3NS5 A;  1VQP S;  1TFW A;  1YRX A;  2OEL A;  1ZAW A;  2NXC A;  3TZW A;  2C1E B;  2FJX A;  3MM8 B;  2ZH4 A;  2YQ1 A;  3DN9 A;  3GWC A;  4ZJL A;  2UUB F;  4IG3 A;  3ET6 B;  4F26 A;  1Y00 A;  3FCV A;  3Q8Y A;  4NWB A;  1BMQ B;  1IM4 A;  2PA8 D;  1D9F A;  4RWW A;  4WYW A;  4HDH A;  3NXZ A;  3KLH A;  1T05 B;  5IM0 A;  1R6V A;  3L4B C;  4F4Y A;  4EO6 A;  3CDB A;  5KG5 A;  1VBX A;  4JI5 J;  2HHH F;  2N4C A;  2OTL S;  1TUW A;  2MZR A;  3CDE A;  1HWJ A;  2DD8 S;  1S4F A;  2CRL A;  2HFS A;  1H72 C;  1ZPV A;  3C15 A;  3MAH A;  4DN0 A;  3SCL E;  3KJF B;  1JMT A;  4K50 A;  1VQL S;  3DRR A;  3MCO A;  3NGS A;  4ALZ A;  2COL A;  4CO4 A;  5KFE A;  3R97 A;  1GMV A;  3BKF A;  3KK2 B;  4X4N A;  5GAE I;  1N32 F;  4X64 J;  3UW1 A;  2FDN A;  1UMJ A;  2VUG A;  2FLL A;  1TQL A;  2FZG B;  1KLM A;  3M8P A;  5KOX A;  2H3E B;  4LF4 J;  1NDK A;  1ZZF A;  3OPK A;  4RUB A;  4LIR A;  3DOL B;  3A12 A;  1G3O A;  2M8H A;  2XMM A;  2YNF A;  3G87 A;  4P6Q A;  1H38 A;  3DLG B;  2EFQ A;  4F36 A;  2P9C A;  3HHL C;  3OUY A;  2VC0 A;  5C25 B;  3OQ2 A;  2YKP A;  3LPE A;  1RT3 B;  2BA9 A;  3TOQ A;  1FTR A;  5B0G A;  4TU7 A;  2K8G A;  1QSL A;  2JFK A;  4DBQ A;  4RNO A;  1LWF A;  2HFZ A;  2Z2Y B;  3FBB A;  3R9L A;  1S6Q A;  3GFY A;  1K0V A;  3NGT A;  1T02 A;  2CQG A;  1N5S A;  4GRS A;  1UVK A;  4I2Q B;  3ULH A;  1QAX A;  2BAN A;  3MMA A;  2DY1 A;  2J8S A;  4M5H A;  1BWE A;  1OIA A;  1FJC A;  1SL0 A;  3SSQ A;  1N33 F;  3THT A;  1FKA F;  4X4S A;  2LMI A;  1GMW A;  1HR0 J;  3HMJ G;  3ILO A;  4QW9 A;  5HAT A;  1IUJ A;  3MFH A;  5EN1 A;  4R5P B;  3H2L A;  4PAB A;  2NSB A;  5DM6 Q;  3AOA A;  2ZVI A;  3DYA B;  3L7P A;  1TKZ A;  3QSY B;  3M9N B;  4NZ6 A;  4NXN J;  2MPU A;  9RUB A;  3CED A;  5IQQ A;  2YNG B;  2L9W A;  3HM9 A;  1VBZ A;  5T7L A;  2BZ2 A;  2QC3 A;  4NA1 A;  5J2P A;  1N56 A;  2RQ4 A;  4Z7Y A;  3HVA A;  1EQM A;  3AT1 B;  4TLQ A;  1HI8 A;  3TYT A;  1U02 A;  3PO5 A;  1YZ6 A;  1QUV A;  3ONQ A;  2E9T A;  5LOQ A;  1SV5 B;  2KXH A;  3W65 A;  5LMN F;  2UVR A;  2YWE A;  2G1D A;  2E5J A;  4NMX A;  3K8W A;  5AE1 A;  2R8K A;  4QIF A;  2B7B B;  4WU2 A;  1VRT B;  4FP9 A;  1W2B R;  1S0N A;  4GC6 A;  4ELU A;  4NRU A;  2BJ8 A;  4W90 B;  2BV3 A;  2HBY B;  3ENV A;  1IR2 A;  2V2V A;  3GR0 A;  2I5J A;  1AZS B;  3N0V A;  4F67 A;  5D8H B;  2HNY A;  4NLD A;  3HHD A;  3PAC A;  4EZ9 A;  3IN5 A;  3DMJ B;  2M4M A;  2ZD1 B;  3NCP A;  3IFE A;  2VFU A;  1MNE A;  3MM7 B;  5MLC V;  1C4A A;  4CP5 A;  3JS9 A;  3K7R A;  1VHF A;  3NS6 A;  1EJ7 L;  2GIF A;  3ILL A;  4N76 A;  4L74 A;  1TZ0 A;  3MOZ A;  1RLC L;  2G0C A;  5F9N A;  1NND A;  3K0J A;  5CYM B;  1GTH A;  1P6T A;  1HWU A;  2BKO A;  3GYG A;  2B7C B;  5JUM A;  4ZVP B;  4OJH A;  2QL7 B;  1RBA A;  2DGW A;  1Q7L B;  2DXD A;  3MEC B;  2KZM A;  2DIV A;  3WDO A;  2NZC A;  2FJE B;  2EFP A;  4P73 A;  1K1S A;  4TQR A;  4USI A;  1YK9 A;  4JI7 F;  4FYX B;  5CQG A;  4MKB A;  3W5Y A;  2QEX S;  1KFS A;  1MLA A;  2Y1J A;  3SMZ A;  4EGL A;  2HNZ B;  4FYD A;  2XBP A;  3PJX A;  4DV1 F;  1T9Y A;  4RUH A;  5LJ3 Y;  1J5E F;  3PX4 A;  3GE9 A;  3BN7 A;  2V4Q A;  2DNG A;  2Q3P A;  3R5J B;  2LA6 A;  3KK1 B;  2DGV A;  1F3V A;  3KHL A;  1VLY A;  3X3U A;  2XM3 A;  2DO0 A;  4HAC B;  2OPP A;  4F4W A;  4J9P A;  2D3O R;  1MU2 A;  1CEZ A;  1NCL A;  2XZD B;  3W9J A;  4JV1 A;  3Q89 A;  2GQQ A;  2QLW A;  3CD0 A;  2VKR A;  2N7Y A;  4GKJ F;  2QO3 A;  1Q8L A;  1R43 A;  2R8I A;  5CAB A;  4CLW A;  2EKN A;  3MMJ A;  4WE1 A;  4ZIT A;  5C5J A;  3LQV A;  3AQP A;  1AB8 A;  2IMW P;  4DR6 F;  2KFZ A;  3R7B B;  4USU A;  2RT3 A;  4B3R F;  1RHM B;  3T1Y J;  4PQU A;  1GMU A;  5D4P A;  1GMW D;  1R27 B;  3VTI A;  1UEV A;  4I67 A;  3OFF A;  4QR0 A;  4M63 A;  4CCH A;  5GVQ A;  1K8A T;  3TJ8 A;  4LFB J;  1EKS A;  2FUG 9;  3TJA A;  3BKU A;  1A7G E;  3X1L B;  1NU4 A;  3W66 A;  3EVW A;  3E2E A;  1NK5 A;  1OY9 A;  1FFS B;  1H0H B;  2IHR 1;  3IA0 A;  4WP3 A;  3OXL A;  2H5J B;  1J2V A;  3GZ7 A;  2VOD A;  3K58 A;  1HBU B;  4HR2 A;  2CPF A;  4Y2M A;  3WC2 A;  3RG6 A;  2J0S D;  3R2C J;  3IGN A;  4X4U A;  4P74 A;  3MTJ A;  2M52 A;  2VG6 B;  5ETM A;  1HW9 A;  2GQC A;  4FVC A;  2O01 C;  5A76 A;  1YDL A;  2WVD A;  2LCW A;  1CS4 A;  3CJK A;  2R2T A;  1S0O A;  2J0X A;  5B0B A;  1KNZ A;  4KHP J;  2M3D A;  2BDP A;  2UV8 A;  1R7I A;  5F0U A;  2D69 A;  2HND A;  3PY8 A;  4DCO B;  1RT1 B;  5M2P A;  1QVG R;  5CCM A;  1VQS A;  2IJN A;  1TV6 A;  4CH0 S;  4YP3 A;  3QO9 A;  3VAI A;  3KLE A;  2YWH A;  4HH0 A;  2HQC A;  4DG1 B;  3AB4 B;  2C2K B;  3MEG B;  2AJ2 A;  2ROG A;  3E3X A;  3UWT A;  2VOP A;  4YR2 A;  4OYZ A;  3POT A;  2WSC C;  2KVQ E;  3KDO A;  3N6N A;  3N6L A;  2F63 A;  4X4T A;  3HT0 A;  3VGV A;  1RAO A;  4WXO A;  3TVK A;  5K20 B;  5D4L A;  1WAC A;  2DEJ A;  2ZBP A;  4KV8 B;  4DQQ A;  1VK3 A;  3UD3 P;  3KHR A;  1RTJ A;  3AA8 A;  3CMA S;  1RGV A;  3O44 A;  4WTY A;  2BUN A;  2MZQ A;  2K2P A;  3QAU A;  2G2O A;  3VV2 B;  4DR7 F;  2J8A A;  3QGH A;  4C9D A;  1F3F A;  1YQH A;  5J2N B;  1S6P A;  3Q23 A;  3KLI B;  5HQM A;  2IC3 A;  2MJN A;  2PGC A;  2WCX A;  2YKN A;  3OD2 A;  1FNX H;  2OD4 A;  4C98 A;  2A10 A;  3W8P A;  3DOK A;  4IYQ A;  2QL5 B;  4KR0 B;  4YR3 A;  3QT6 A;  3RBE A;  1Q86 T;  5A8W A;  4DL7 A;  3AJ2 A;  3FNN A;  4WFB Q;  2WVB A;  1G7C B;  2Q66 A;  4DR4 F;  4LR7 A;  3SCI E;  1UFK A;  3JQJ A;  2V69 A;  3JAM Y;  3VF0 B;  1VRQ C;  2DGO A;  3D28 A;  3I82 A;  3J7Y I;  4LF7 J;  1DTQ A;  1ZTW A;  3HFZ B;  1F5A A;  4RW4 B;  3RBZ A;  1RDR A;  3GCW P;  1RU1 A;  2H1Y A;  4IR1 A;  2QL9 B;  1TKD A;  2VU5 A;  2BR0 A;  2DGX A;  2H4W B;  2F5G A;  4ILM A;  5IQ6 A;  4DWI A;  2VD3 A;  4PXB A;  3MM9 B;  4F2R A;  3I5C A;  1IBL J;  2DNQ A;  1R0A B;  5HMW A;  4NXM F;  2W7O A;  2B9X A;  3HJV A;  2PC6 A;  1M5H A;  1ZM2 A;  4ZLJ A;  1DQA A;  1DLO A;  2IIH A;  2MJU A;  3V6K A;  4IRK A;  1E6V A;  1T9U A;  1JLA B;  4BC7 A;  1K9M T;  1VQ8 S;  2ADC A;  5KFW A;  1O6X A;  4ED7 A;  3TI0 A;  5ITH A;  1N5Y B;  2CDR B;  2XMU A;  4HHJ A;  3BSC A;  3PR4 A;  1FO1 A;  1RK8 A;  1RCO B;  2QSF A;  2VBZ A;  3MEE B;  3T1H J;  4DX8 H;  1M0S A;  1RWV B;  2DVI A;  1U1M A;  1UZD A;  2XYG B;  1B99 A;  4ECZ A;  2W2P P;  1HBM B;  2R7W A;  1S9E A;  4OZL A;  5KFD A;  5H9E J;  3HHL D;  1RAE B;  1RT2 B;  4TNO A;  1ZM4 A;  5DQI A;  3KNG A;  3KXD A;  3ITH A;  3KWM A;  4I64 A;  1PC4 A;  3VR1 A;  3T5K A;  3PHT A;  1VQ6 S;  3U27 A;  4NPO A;  1JLG B;  2UZA A;  1TL3 A;  2JRS A;  2GAH C;  2V2K A;  4OX9 F;  1RHK B;  1S7H A;  4NCA A;  4C8K A;  4NRT A;  4FKY A;  2HG4 A;  3P4U B;  4ZP9 A;  1H7X A;  2LFV A;  2OFG X;  1HHT P;  1C0T B;  1WD6 A;  4CO5 A;  2Z2Z A;  4LFA J;  2DH7 A;  5BYQ A;  3MM5 A;  1P1T A;  1SC4 B;  2MYF A;  5HLF B;  1I94 F;  2ZOF A;  4OI0 A;  3EWG A;  3BEG B;  4DR1 F;  1X4D A;  4WK3 A;  4C4W A;  3HHL B;  2QV6 A;  1VJW A;  1V5I B;  2HSE B;  4X2B A;  3QLH A;  5KFO A;  2AU0 A;  1TK0 A;  1VQN S;  3KMQ A;  1ZYQ A;  1NPK A;  4RW6 A;  3M6U A;  2OPQ A;  2YBV A;  1R3N A;  3PW7 A;  5KFQ A;  2MQP A;  1LK7 A;  3DDN A;  3PX6 A;  5KT3 A;  3A3P B;  2FTR A;  2JEF A;  1GQE A;  5FDL A;  3HFK A;  2F65 A;  5CD4 H;  1IKX B;  1PAE X;  1N48 A;  2AJ0 A;  3OTO J;  1QSY A;  1CSJ A;  4WYL A;  3CCS S;  1Q5V A;  3RRH A;  1S72 S;  5CYQ B;  2GAG C;  4OHW A;  2ZOM A;  1AXQ A;  1QE1 A;  3T9N A;  4ZCM A;  4BCA A;  4ZPD A;  3S6E A;  4ZJQ A;  1NM2 A;  4NEZ A;  4RNH A;  3SSR A;  1LV5 A;  2LQ9 A;  1VI7 A;  3QAT A;  3E01 A;  4Y65 A;  1I6J A;  3CC4 S;  3CTR A;  5F0W A;  4F3M A;  3OL6 A;  2HHU A;  4X66 F;  1TFY A;  2FQQ B;  2YX7 A;  3PRV A;  2J7U A;  4C0H A;  4F0M A;  2RRB A;  2RRA A;  1ITP A;  2HGL A;  4ZMM A;  5LM7 E;  5H1S V;  4CO2 A;  1S7I A;  3TEH B;  1IWA A;  4ED0 A;  1JLF A;  5KFG A;  4DN9 A;  2ZH2 A;  1WHX A;  1WTF A;  2IJF A;  1B0V A;  3AD7 C;  2RS2 A;  3M8R A;  2X51 A;  3TO8 A;  4F8R A;  1FCA A;  2VQF J;  4UUW A;  1HKA A;  1NZ8 A;  2FLP A;  2ZBQ A;  4FF1 A;  1VGY A;  3R5D A;  1IKY A;  3VGU A;  3BPD A;  2XMJ A;  2U2F A;  4DPO A;  2EW9 A;  1A9N B;  5CCL A;  3B4M A;  3J7Z 5;  2VPW B;  4DV6 F;  1DQ8 A;  3CO0 P;  3BF4 A;  1RA6 A;  1QAJ A;  3B82 A;  1MN9 A;  1T11 A;  4C0B A;  4B9N A;  1M5P C;  2JH3 A;  4DCJ B;  5DJB A;  2ATL A;  4C8Y A;  3PIP Q;  3W63 A;  4CYU B;  4FN5 A;  3PVX A;  1S1U B;  3UCU P;  5KFR A;  3BR8 A;  1CUL B;  5D6G A;  1HBN A;  1A0O B;  1QLN A;  2C3P A;  5B0C A;  2ZVS A;  3GIJ A;  4NCB A;  1Y11 A;  3J7Y U;  2W9B A;  1U2F A;  1S57 A;  4USV A;  2HGN A;  2KJV A;  4IH7 A;  8AT1 B;  3PFO A;  1RU2 A;  3HSG A;  2HBR B;  1FJE B;  3BQ0 A;  2PDA A;  2HEK A;  4DLE A;  4C8Z A;  3L3C A;  1U24 A;  3BBB A;  2P2C B;  1B7Y B;  1KTQ A;  5C24 B;  1URR A;  1S1T A;  1WC4 A;  3UCG A;  2KG1 A;  3M8Q A;  4ED3 A;  2GS8 A;  1TK8 A;  3D0H E;  4K4W A;  2F4V F;  2G4B A;  1LK5 A;  4R0J A;  4B3M J;  2VG7 B;  4IFV B;  3UD4 P;  3VAK A;  2ACM A;  1E6Y A;  4Q5V A;  2ZBI A;  4NLO A;  2BBE A;  4LF4 F;  1K44 A;  4DV2 J;  3FUY A;  3UI3 A;  4A8S A;  1X5P A;  2BJD A;  3I0R A;  4HHU A;  4AE5 A;  3DGP A;  1XN9 A;  4P72 A;  1BC6 A;  3Q8P B;  1D9A A;  3K89 A;  4M5L A;  4DUY J;  3MPV A;  2DRB A;  3DHW C;  2BJ9 A;  5E7O B;  4EO8 A;  3HVT A;  3TX8 A;  4Q44 A;  3CCW A;  1VQY A;  4G6V B;  3DLJ A;  2NQP A;  1LQ9 A;  2DY9 A;  2GX8 A;  4OLO A;  4B9V A;  4F0K A;  3KJQ B;  1U2R A;  2UVV A;  1HNX F;  1UEK A;  3KK3 A;  4B02 A;  1X0F A;  3NGK A;  3VQS A;  3MED A;  1WG4 A;  4DR2 F;  1TKX B;  4J37 A;  4V1A k;  4CLK A;  1L3S A;  4TY9 A;  4ES2 A;  3BGU A;  2AEM A;  2H4Y B;  1XR7 A;  2QLB B;  4ZPA A;  5KG6 A;  3HO1 A;  2VHG A;  3VZI A;  2VPY B;  4I2P A;  3QIP B;  2QLJ B;  4OZ1 A;  1FX2 A;  2E9R X;  5FII A;  3FEY B;  4AXI A;  2MKY A;  2LYV A;  5EX3 A;  3ETO A;  4NXN F;  2BM1 A;  1N36 F;  2RSQ A;  3CSK A;  3MCS A;  4O3P A;  3FK4 A;  3FGV A;  4AL5 A;  1T94 A;  3I5B A;  4MFB B;  3VZH A;  4ZLP A;  2W2O P;  5FLX U;  5GAG U;  2HZC A;  3MXH P;  3FSX A;  3S1T A;  1RWK B;  2HFU A;  4XIU A;  2EWH A;  2IVM A;  3CIM A;  2Q6C A;  1LWC B;  3FFI B;  3MWB A;  3GMG A;  1OJ4 A;  2YQ0 A;  2RD5 C;  5SZT A;  2V4J B;  3LP2 B;  3GYX B;  1M5S A;  4B9L A;  4R25 A;  3TVY A;  3C66 A;  3M1V B;  2PA3 A;  3CVK A;  1FWL A;  1TL7 A;  2B5J A;  2Z57 B;  2VG5 A;  4LRE A;  3DLH A;  4ED1 A;  3W2W B;  1R0B G;  3OR1 B;  5HRO A;  1S1W A;  1UPM B;  1RQ0 A;  2LU1 A;  1V5V A;  5E3Q A;  1NJY A;  4JYA F;  3IR7 B;  4H4K C;  1QM9 A;  3OTB A;  2WVE A;  4A4J A;  5BJR A;  1WEY A;  3M6V A;  4Z7C A;  4KAI A;  2YPY A;  4BBY A;  4K7Q A;  2JDJ A;  2KM8 B;  1WC0 A;  4NAS A;  4YME A;  1RWU A;  1MG7 A;  2NRE A;  2YWG A;  3BRE A;  2W1B A;  4U7U K;  4RNF A;  2E5L F;  4LFC J;  1U0H A;  3P5B P;  4MKV A;  3HVW A;  1KON A;  5HP1 A;  1LWE A;  1OQ3 A;  3RRG A;  4CO1 A;  1UJ5 A;  4DU8 A;  1KWM A;  3HX9 A;  4QQB A;  1VCT A;  2K7K A;  1U1P A;  1HNV A;  1KQF B;  5IWA J;  2CJX B;  2YH1 A;  4CH1 A;  3Q8Q B;  1U45 A;  4IG3 B;  3LGM A;  4TY8 B;  2ADB A;  4A48 A;  3JYT A;  2F9D A;  2W8L A;  1Q8I A;  4ZVQ B;  1S1V A;  2Z30 B;  1DQ9 A;  3TR5 A;  4RJV A;  2OSR A;  4MJK A;  3TAM B;  1ZM3 A;  1ZZN A;  4L72 B;  3PJW A;  1RT6 A;  1XMQ J;  1IR1 A;  4KPY A;  1HNW F;  2P9G A;  3MGJ A;  1YIJ S;  4MKY A;  2ZC3 A;  1DRZ A;  2QIF A;  2E1C A;  3K5L A;  2ZZN A;  2IRU A;  4QWD A;  3W2V A;  2CA9 A;  2MLX A;  1GXL A;  3C15 B;  3OFG A;  1U0S A;  2IAJ B;  3G96 A;  4K2X A;  2MGZ B;  2DNO A;  4RU2 A;  3EPG A;  3N9U C;  2XC9 A;  4RUA A;  5D78 A;  1JLC A;  1B0P A;  2MEW A;  2C2M B;  2R8H A;  2DB1 A;  2PE8 A;  5DZ6 A;  2JWN A;  2R7O A;  5L8R C;  4NI2 A;  2Q6B A;  1FJG F;  3T1Y F;  5E2Q A;  3WIU A;  4ILR A;  4M5J A;  3CD7 A;  5C42 B;  1TVR A;  4G1Q B;  3RB3 A;  4PCQ A;  4QWE A;  2MLY A;  5KT7 A;  4IRD A;  4KGK A;  2E7V A;  4LFB F;  4BWJ A;  2CG8 A;  1XR6 A;  3RB4 A;  4Y2A A;  3SSS A;  2RVJ A;  3OUY B;  1NHU A;  4I1T A;  1QSS A;  4XAK A;  2QG9 B;  3CCT A;  1FES A;  4OHV A;  1BHN A;  1LXJ A;  4MTP A;  1LWF B;  5E41 A;  2VPZ B;  1S6Q B;  2C2R A;  5KFU A;  1NB2 A;  1BUX A;  3IP0 A;  2BAN B;  4LBH A;  5DGA A;  2WW4 A;  4UZB A;  1WWH A;  1YTY A;  1TL1 A;  3E51 A;  3MPD A;  1JWW A;  1DAR A;  2MKJ A;  1OSD A;  2OAU A;  3F73 A;  1FEE A;  4F0H A;  2V5H G;  5AXK A;  4DHV A;  4J9U E;  1TKZ B;  3QMQ A;  4DR3 J;  2VF3 A; 
#chains in the Genus database with same CATH homology
 1IBK J;  4JV5 J;  3R2C J;  1HNW J;  4RJV A;  3OTO J;  4V1A k;  4DV6 J;  4K0K J;  4GKJ J;  4NEY A;  4JYA J;  4B3S J;  4B3T J;  1N34 J;  5LMU J;  3R2D J;  4NXM J;  2UXB J;  2HHH J;  3J81 U;  4OX9 J;  1XMQ J;  4JI6 J;  4DR1 J;  4B3M J;  1IBL J;  3JAM U;  4YHH J;  5IT9 U;  4JI5 J;  4DV4 J;  4DV0 J;  2VQE J;  5BR8 J;  2KL8 A;  5LMN J;  4NEZ A;  4B3R J;  1N36 J;  4DR7 J;  4YY3 J;  4DV2 J;  4JI7 J;  4JI3 J;  1J5E J;  2UXC J;  4HHU A;  4DV5 J;  2UUA J;  1N32 J;  4KHP J;  4KY3 A;  4X66 J;  2UXD J;  4JI1 J;  4DV3 J;  1I94 J;  4DUY J;  3T1Y J;  4LF6 J;  4JI4 J;  1XNR J;  4LFA J;  5A2Q U;  3J7A N;  1IBM J;  3W1Y C;  2ZM6 J;  4DV1 J;  2E5L J;  5FLX U;  2UUB J;  3D3C J;  4JI0 J;  4DR4 J;  1N33 J;  4KYZ A;  2MTL A;  4LF5 J;  5LM7 E;  4X65 J;  4LFB J;  4X62 J;  4JI8 J;  4AQY J;  1HNX J;  1FJG J;  3T1H J;  2MEW A;  4LF8 J;  4LFC J;  3IMQ J;  3D3B J;  4DV7 J;  4X64 J;  4DUZ J;  4GKK J;  1HR0 J;  1XNQ J;  2MQ8 A;  2UU9 J;  5IWA J;  4LF7 J;  4LF4 J;  4LF9 J;  4DR2 J;  2VQF J;  2KVQ E;  1XMO J;  5AJ3 J;  3J80 U;  2UUC J;  4DR3 J;  4DR5 J;  2F4V J;  1HNZ J;  4JI2 J;  4DR6 J;  4NXN J;  4PWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...