2MEZA

Flexible anchoring of archaeal mbf1 on ribosomes suggests role as recruitment factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
ENAELEIVTDYYKIIKTAREQLGISQQQLAQKLKVSENIVKRFESGKLKPTISQARQLEKILGIKLVTPLENNEESEKEFDDTGLTLGDVVNIKEGKKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal MBF1 binds to 30S and 70S ribosomes via its helix-turn-helix domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
molecule keywords Multiprotein Bridging Factor (MBP-like)
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2mezA00
3MLFA 2KPJA 4I6RA 3EUSA 1LMB3 2IUOA 4X4HA 2AW6A 2BNOA 3GN5A 1O4XA 3KXAA 1S7EA 2XIUA 2A6CA 3IVPA 1WETA 2B5AA 4MCTA 4X4EA 4X4FA 4JCYA 4NDWA 1UXDA 1LCDA 1WH8A 2LYKA 2GRLA 5K98B 4X4GA 1WH6A 4YARA 1LLIA 2H8RA 4PU8A 4Z5DA 4X4DA 1SQ8A 3TRBA 4I6TA 1AU7A 2PUFA 4GHJA 2AXUA 1ADRA 1ZZ8A 3OP9A 2WIUB 1OCTC 1ZZCA 1EFAA 4MCXA 1E3OC 1X2LA 3LISA 1PRUA 4J1WA 1RIOA 1QQBA 2EBYA 3VK0A 3UFDA 2O4AA 1PNRA 1JH9A 2IVBA 3OMTA 2XI8A 1R69A 2ICPA 1LCCA 1PERL 2PUBA 3ZHIA 1HF0A 1PRVA 2PUCA 1DWKA 1ZZ7A 2O38A 3CECA 4Z5HA 2AWIA 4OB4A 4YG4A 1ZPQA 2KEIA 2OR1L 4PU7A 3O9XA 1PRAA 3CROL 1POUA 2HINA 4X4IA 2LYJA 1GT0C 1UXCA 2GRMA 1CQTA 4I8TA 3GBFA 2MEZA 1LQCA 1RZSA 1B0NA 4J1XA 4PU3C 2R1JL 1OSLA 1ZAYA 2XCJA 3G5GA 2LYRA 1YSEA 3QF3A 3BDNA 1JFSA 1XWRA 2KEJA 1Y9QA 1VPWA 2LYSA 1QP7A 4FN3A 2PIJA 4JCXA 1BDIA 2WUSR 4FBIA 2O49A 4IA8A 3R1FA 3SCHA 1ZVVA 3G7DA 2XJ3A 2ICTA 4IVZA 4X4CA 3ZKCA 4YG7B 4IWRA 1IC8A 2PUDA 3S8QA 3DNVB 2EWTA 4F8DA 2AUWA 2LCVA 3SCGA 1JWLA 1BDHA 3JXDL 3HZIB 4O8BA 2HSGA 3BS3A 2PUEA 2L49A 2BJCA 1X57A 1ZZBA 1RPEL 1ZZ6A 3F51A 3CLCA 3U3WA 2IV1A 3OQNA 2KEKA 3QYXA 3FMYA 3H5TA 2PUAA 1QPZA 1R63A 1L1MA 3B7HA 2BNNA 4Z58A 4Z5CA 3QWGA 1ZZ9A 4PU4C 3JXCL 1NEQA 1DW9A 2XSDC 2R63A 4YBAA 2PE5A 2LYLA 1WIZA 2JVLA 3KZ3A 1QP0A 4Z59A 3FYAA 3KJXA 2KZ8A 2AXVA 2MQKA 2PPXA 1QQAA 2IVGA 3LFPA 2L8NA 3F6WA 2LYQA 2IU7A 2EF8A 1UTXA 3D1NI 1RZRA 4Y42A 3OQMA 1CJGA 4I6UA 1ZUGA 3BD1A 2OFYA 4YG1A 1ZS4A 2CROA 4JQDA 4GQMA 2IVQA 5A7LA 2D5VA 3OQOA 1Y7YA 2JCGA 1JFTA 3F52A 1QP4A 2CSFA 2GZUA 3ZHMA 2LYPA 2BNMA 4X4BA 1NERA 2FJRA 3PXPA 3JXBC 3QQ6A 3GN5B 1RZRD 2AXZA 3L1PA 3RZZA 2PUGA 3FYMA 3SCFA
chains in the Genus database with same CATH superfamily
1QB2A 2AW6A 1O4XA 1S7EA 1LCDA 2LYKA 2GRLA 3ME5A 1WH6A 4Z5DA 4X4DA 3TRBA 1AU7A 2PUFA 4GHJA 2AXUA 4MCXA 1E3OC 1X2LA 1PRUA 2EBYA 3NZLA 1R69A 2ICPA 4EZIA 1PRVA 1DWKA 1ZZ7A 2ODRD 2PXVA 2J7UA 3CECA 4DE8A 4Z5HA 1ZPQA 2KEIA 3PE5A 2OR1L 3CROL 3GBFA 2R1JL 1ZAYA 2XCJA 3BDNA 1VPWA 2KEJA 2LYSA 1QP7A 4FN3A 2PIJA 5DTMA 3M9LA 4FBIA 3R1FA 4IWRA 3NDBB 4YG7B 2EWTA 3VWSA 1RPEL 2PXBA 3B7HA 4Z5CA 1HQ1A 2PXQA 1NEQA 1DW9A 2JVLA 3QOXA 2KZ8A 2PXPA 1UTXA 3OQMA 3QFIA 3A9ZA 1ZUGA 3BD1A 4JQDA 2IVQA 3F52A 4ER5A 2GZUA 3MEJA 3GZCA 4X4BA 1NERA 3QOWA 3PXPA 3GN5B 5GAHi 2XXAA 3FYMA 3SCFA 3MLFA 3OKZA 4I6RA 3EUSA 3GN5A 3KXAA 4X4EA 4JCYA 4NDWA 1UXDA 5K98B 2H8RA 1LLIA 4PU8A 1SQ8A 1ZZ8A 3OP9A 1ZZCA 1EFAA 3NROA 5DSXA 2PXDA 3VK0A 3A9XA 1LCCA 2FFHA 2XXPA 4OB4A 4YG4A 4PU7A 1POUA 2HINA 2LYJA 1UXCA 2GRMA 2MEZA 5DRTA 5DTRA 1Y9QA 3GZDA 1NW3A 4JCXA 2XJ3A 4IVZA 3S8QA 4F8DA 2LCVA 2AUWA 3JXDL 3HZIB 2HSGA 3GUUA 1ZZBA 3CLCA 1ZZ6A 3U3WA 2IV1A 1L1MA 4OBMA 3QWGA 4PU4C 4ER6A 4YBAA 1QP0A 3KZ3A 2JQEA 4Z59A 2AXVA 2MQKA 1QQAA 2LLWA 2EF8A 1CJGA 4I6UA 2OFYA 4YG1A 1ZS4A 4GQMA 5A7LA 2D5VA 1Y7YA 2YBDA 4ER3A 4ER7A 2CSFA 2PXUA 3QQ6A 2HFZA 2M4HA 3RZZA 1U2ZA 2PXLA 4X4HA 1QZXA 2A6CA 3SX0A 2V3CC 2B5AA 4MCTA 2MXDA 1WH8A 4X4GA 4YARA 4I6TA 1ADRA 1MFQC 2WIUB 4HRAA 3LISA 2O4AA 1JH9A 2XI8A 2PUBA 1HF0A 2PUCA 2AWIA 3O9XA 4X4IA 1GT0C 1CQTA 4J1XA 1B0NA 1OSLA 3G5GA 2LYRA 1BDIA 2WUSR 2O49A 1ZVVA 3G7DA 4X4CA 3ZKCA 1IC8A 2PUDA 3DNVB 1JWLA 3G0TA 4O8BA 2L49A 1X57A 3F51A 3FMYA 2PUAA 1QPZA 1R63A 2BNNA 4Z58A 5JUWA 1ZZ9A 3JXCL 2XSDC 2R63A 2PE5A 2LYLA 5DRYA 3TELA 3FYAA 4DE9A 2IVGA 2VEOA 2L8NA 3F6WA 3D1NI 1RZRA 5GAGi 1QP4A 2L1PA 2HCNA 1DULA 2FJRA 3JXBC 4EQZA 3DM5A 3L1PA 3KL4A 4Q2JA 2KPJA 1LMB3 2IUOA 2BNOA 2XIUA 3IVPA 2HCSA 4WVLA 4ER0A 4X4FA 2PXFA 3A9YA 1OCTC 4J1WA 1RIOA 1QQBA 3UFDA 1PNRA 2IVBA 3OMTA 1PERL 2PXKA 3ZHIA 2O38A 2XXQA 2J7WA 3R09A 1PRAA 4I8TA 1LQCA 1RZSA 4PU3C 3QF3A 1YSEA 1JFSA 1XWRA 3OWQA 5DT2A 3TEPA 3GZDC 4IA8A 3SCHA 2ICTA 3TFLA 1BDHA 3SCGA 2PUEA 3BS3A 2LNMA 3NXHA 2BJCA 2PXTA 3OQNA 2KEKA 3QYXA 3H5TA 2LLVA 4EKIA 1WIZA 3KJXA 2PPXA 3LFPA 2LYQA 2IU7A 4Y42A 2CROA 2PXEA 3LQXA 3OQOA 2JCGA 4EKGA 1JFTA 3UWPA 3ZHMA 2LYPA 2BNMA 1RZRD 2AXZA 5DTQA 4EK9A 3SR4A 1WETA 3ZPXA 2PUGA
chains in the Genus database with same CATH topology
3MLFA 2KPJA 4I6RA 3EUSA 1LMB3 2IUOA 4X4HA 2AW6A 2BNOA 3GN5A 1O4XA 3KXAA 1S7EA 2XIUA 2A6CA 3IVPA 1WETA 2B5AA 4MCTA 4X4EA 4X4FA 4JCYA 4NDWA 1UXDA 1LCDA 1WH8A 2LYKA 2GRLA 5K98B 4X4GA 1WH6A 4YARA 1LLIA 2H8RA 4PU8A 4Z5DA 4X4DA 1SQ8A 3TRBA 4I6TA 1AU7A 2PUFA 4GHJA 2AXUA 1ADRA 1ZZ8A 3OP9A 2WIUB 1OCTC 1ZZCA 1EFAA 4MCXA 1E3OC 1X2LA 3LISA 1PRUA 4J1WA 1RIOA 1QQBA 2EBYA 3VK0A 3UFDA 2O4AA 1PNRA 1JH9A 2IVBA 3OMTA 2XI8A 1R69A 2ICPA 1LCCA 1PERL 2PUBA 3ZHIA 1HF0A 1PRVA 2PUCA 1DWKA 1ZZ7A 2O38A 3CECA 4Z5HA 2AWIA 4OB4A 4YG4A 1ZPQA 2KEIA 2OR1L 4PU7A 3O9XA 1PRAA 3CROL 1POUA 2HINA 4X4IA 2LYJA 1GT0C 1UXCA 2GRMA 1CQTA 4I8TA 3GBFA 2MEZA 1LQCA 1RZSA 1B0NA 4J1XA 4PU3C 2R1JL 1OSLA 1ZAYA 2XCJA 3G5GA 2LYRA 1YSEA 3QF3A 3BDNA 1JFSA 1XWRA 2KEJA 1Y9QA 1VPWA 2LYSA 1QP7A 4FN3A 2PIJA 4JCXA 1BDIA 2WUSR 4FBIA 2O49A 4IA8A 3R1FA 3SCHA 1ZVVA 3G7DA 2XJ3A 2ICTA 4IVZA 4X4CA 3ZKCA 4YG7B 4IWRA 1IC8A 2PUDA 3S8QA 3DNVB 2EWTA 4F8DA 2AUWA 2LCVA 3SCGA 1JWLA 1BDHA 3JXDL 3HZIB 4O8BA 2HSGA 3BS3A 2PUEA 2L49A 2BJCA 1X57A 1ZZBA 1RPEL 1ZZ6A 3F51A 3CLCA 3U3WA 2IV1A 3OQNA 2KEKA 3QYXA 3FMYA 3H5TA 2PUAA 1QPZA 1R63A 1L1MA 3B7HA 2BNNA 4Z58A 4Z5CA 3QWGA 1ZZ9A 4PU4C 3JXCL 1NEQA 1DW9A 2XSDC 2R63A 4YBAA 2PE5A 2LYLA 1WIZA 2JVLA 3KZ3A 1QP0A 4Z59A 3FYAA 3KJXA 2KZ8A 2AXVA 2MQKA 2PPXA 1QQAA 2IVGA 3LFPA 2L8NA 3F6WA 2LYQA 2IU7A 2EF8A 1UTXA 3D1NI 1RZRA 4Y42A 3OQMA 1CJGA 4I6UA 1ZUGA 3BD1A 2OFYA 4YG1A 1ZS4A 2CROA 4JQDA 4GQMA 2IVQA 5A7LA 2D5VA 3OQOA 1Y7YA 2JCGA 1JFTA 3F52A 1QP4A 2CSFA 2GZUA 3ZHMA 2LYPA 2BNMA 4X4BA 1NERA 2FJRA 3PXPA 3JXBC 3QQ6A 3GN5B 1RZRD 2AXZA 3L1PA 3RZZA 2PUGA 3FYMA 3SCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MLF A;  2KPJ A;  4I6R A;  3EUS A;  1LMB 3;  2IUO A;  4X4H A;  2AW6 A;  2BNO A;  3GN5 A;  1O4X A;  3KXA A;  1S7E A;  2XIU A;  2A6C A;  3IVP A;  1WET A;  2B5A A;  4MCT A;  4X4E A;  4X4F A;  4JCY A;  4NDW A;  1UXD A;  1LCD A;  1WH8 A;  2LYK A;  2GRL A;  5K98 B;  4X4G A;  1WH6 A;  4YAR A;  1LLI A;  2H8R A;  4PU8 A;  4Z5D A;  4X4D A;  1SQ8 A;  3TRB A;  4I6T A;  1AU7 A;  2PUF A;  4GHJ A;  2AXU A;  1ADR A;  1ZZ8 A;  3OP9 A;  2WIU B;  1OCT C;  1ZZC A;  1EFA A;  4MCX A;  1E3O C;  1X2L A;  3LIS A;  1PRU A;  4J1W A;  1RIO A;  1QQB A;  2EBY A;  3VK0 A;  3UFD A;  2O4A A;  1PNR A;  1JH9 A;  2IVB A;  3OMT A;  2XI8 A;  1R69 A;  2ICP A;  1LCC A;  1PER L;  2PUB A;  3ZHI A;  1HF0 A;  1PRV A;  2PUC A;  1DWK A;  1ZZ7 A;  2O38 A;  3CEC A;  4Z5H A;  2AWI A;  4OB4 A;  4YG4 A;  1ZPQ A;  2KEI A;  2OR1 L;  4PU7 A;  3O9X A;  1PRA A;  3CRO L;  1POU A;  2HIN A;  4X4I A;  2LYJ A;  1GT0 C;  1UXC A;  2GRM A;  1CQT A;  4I8T A;  3GBF A;  2MEZ A;  1LQC A;  1RZS A;  1B0N A;  4J1X A;  4PU3 C;  2R1J L;  1OSL A;  1ZAY A;  2XCJ A;  3G5G A;  2LYR A;  1YSE A;  3QF3 A;  3BDN A;  1JFS A;  1XWR A;  2KEJ A;  1Y9Q A;  1VPW A;  2LYS A;  1QP7 A;  4FN3 A;  2PIJ A;  4JCX A;  1BDI A;  2WUS R;  4FBI A;  2O49 A;  4IA8 A;  3R1F A;  3SCH A;  1ZVV A;  3G7D A;  2XJ3 A;  2ICT A;  4IVZ A;  4X4C A;  3ZKC A;  4YG7 B;  4IWR A;  1IC8 A;  2PUD A;  3S8Q A;  3DNV B;  2EWT A;  4F8D A;  2AUW A;  2LCV A;  3SCG A;  1JWL A;  1BDH A;  3JXD L;  3HZI B;  4O8B A;  2HSG A;  3BS3 A;  2PUE A;  2L49 A;  2BJC A;  1X57 A;  1ZZB A;  1RPE L;  1ZZ6 A;  3F51 A;  3CLC A;  3U3W A;  2IV1 A;  3OQN A;  2KEK A;  3QYX A;  3FMY A;  3H5T A;  2PUA A;  1QPZ A;  1R63 A;  1L1M A;  3B7H A;  2BNN A;  4Z58 A;  4Z5C A;  3QWG A;  1ZZ9 A;  4PU4 C;  3JXC L;  1NEQ A;  1DW9 A;  2XSD C;  2R63 A;  4YBA A;  2PE5 A;  2LYL A;  1WIZ A;  2JVL A;  3KZ3 A;  1QP0 A;  4Z59 A;  3FYA A;  3KJX A;  2KZ8 A;  2AXV A;  2MQK A;  2PPX A;  1QQA A;  2IVG A;  3LFP A;  2L8N A;  3F6W A;  2LYQ A;  2IU7 A;  2EF8 A;  1UTX A;  3D1N I;  1RZR A;  4Y42 A;  3OQM A;  1CJG A;  4I6U A;  1ZUG A;  3BD1 A;  2OFY A;  4YG1 A;  1ZS4 A;  2CRO A;  4JQD A;  4GQM A;  2IVQ A;  5A7L A;  2D5V A;  3OQO A;  1Y7Y A;  2JCG A;  1JFT A;  3F52 A;  1QP4 A;  2CSF A;  2GZU A;  3ZHM A;  2LYP A;  2BNM A;  4X4B A;  1NER A;  2FJR A;  3PXP A;  3JXB C;  3QQ6 A;  3GN5 B;  1RZR D;  2AXZ A;  3L1P A;  3RZZ A;  2PUG A;  3FYM A;  3SCF A; 
#chains in the Genus database with same CATH topology
 1QB2 A;  2AW6 A;  1O4X A;  1S7E A;  1LCD A;  2LYK A;  2GRL A;  3ME5 A;  1WH6 A;  4Z5D A;  4X4D A;  3TRB A;  1AU7 A;  2PUF A;  4GHJ A;  2AXU A;  4MCX A;  1E3O C;  1X2L A;  1PRU A;  2EBY A;  3NZL A;  1R69 A;  2ICP A;  4EZI A;  1PRV A;  1DWK A;  1ZZ7 A;  2ODR D;  2PXV A;  2J7U A;  3CEC A;  4DE8 A;  4Z5H A;  1ZPQ A;  2KEI A;  3PE5 A;  2OR1 L;  3CRO L;  3GBF A;  2R1J L;  1ZAY A;  2XCJ A;  3BDN A;  1VPW A;  2KEJ A;  2LYS A;  1QP7 A;  4FN3 A;  2PIJ A;  5DTM A;  3M9L A;  4FBI A;  3R1F A;  4IWR A;  3NDB B;  4YG7 B;  2EWT A;  3VWS A;  1RPE L;  2PXB A;  3B7H A;  4Z5C A;  1HQ1 A;  2PXQ A;  1NEQ A;  1DW9 A;  2JVL A;  3QOX A;  2KZ8 A;  2PXP A;  1UTX A;  3OQM A;  3QFI A;  3A9Z A;  1ZUG A;  3BD1 A;  4JQD A;  2IVQ A;  3F52 A;  4ER5 A;  2GZU A;  3MEJ A;  3GZC A;  4X4B A;  1NER A;  3QOW A;  3PXP A;  3GN5 B;  5GAH i;  2XXA A;  3FYM A;  3SCF A;  3MLF A;  3OKZ A;  4I6R A;  3EUS A;  3GN5 A;  3KXA A;  4X4E A;  4JCY A;  4NDW A;  1UXD A;  5K98 B;  2H8R A;  1LLI A;  4PU8 A;  1SQ8 A;  1ZZ8 A;  3OP9 A;  1ZZC A;  1EFA A;  3NRO A;  5DSX A;  2PXD A;  3VK0 A;  3A9X A;  1LCC A;  2FFH A;  2XXP A;  4OB4 A;  4YG4 A;  4PU7 A;  1POU A;  2HIN A;  2LYJ A;  1UXC A;  2GRM A;  2MEZ A;  5DRT A;  5DTR A;  1Y9Q A;  3GZD A;  1NW3 A;  4JCX A;  2XJ3 A;  4IVZ A;  3S8Q A;  4F8D A;  2LCV A;  2AUW A;  3JXD L;  3HZI B;  2HSG A;  3GUU A;  1ZZB A;  3CLC A;  1ZZ6 A;  3U3W A;  2IV1 A;  1L1M A;  4OBM A;  3QWG A;  4PU4 C;  4ER6 A;  4YBA A;  1QP0 A;  3KZ3 A;  2JQE A;  4Z59 A;  2AXV A;  2MQK A;  1QQA A;  2LLW A;  2EF8 A;  1CJG A;  4I6U A;  2OFY A;  4YG1 A;  1ZS4 A;  4GQM A;  5A7L A;  2D5V A;  1Y7Y A;  2YBD A;  4ER3 A;  4ER7 A;  2CSF A;  2PXU A;  3QQ6 A;  2HFZ A;  2M4H A;  3RZZ A;  1U2Z A;  2PXL A;  4X4H A;  1QZX A;  2A6C A;  3SX0 A;  2V3C C;  2B5A A;  4MCT A;  2MXD A;  1WH8 A;  4X4G A;  4YAR A;  4I6T A;  1ADR A;  1MFQ C;  2WIU B;  4HRA A;  3LIS A;  2O4A A;  1JH9 A;  2XI8 A;  2PUB A;  1HF0 A;  2PUC A;  2AWI A;  3O9X A;  4X4I A;  1GT0 C;  1CQT A;  4J1X A;  1B0N A;  1OSL A;  3G5G A;  2LYR A;  1BDI A;  2WUS R;  2O49 A;  1ZVV A;  3G7D A;  4X4C A;  3ZKC A;  1IC8 A;  2PUD A;  3DNV B;  1JWL A;  3G0T A;  4O8B A;  2L49 A;  1X57 A;  3F51 A;  3FMY A;  2PUA A;  1QPZ A;  1R63 A;  2BNN A;  4Z58 A;  5JUW A;  1ZZ9 A;  3JXC L;  2XSD C;  2R63 A;  2PE5 A;  2LYL A;  5DRY A;  3TEL A;  3FYA A;  4DE9 A;  2IVG A;  2VEO A;  2L8N A;  3F6W A;  3D1N I;  1RZR A;  5GAG i;  1QP4 A;  2L1P A;  2HCN A;  1DUL A;  2FJR A;  3JXB C;  4EQZ A;  3DM5 A;  3L1P A;  3KL4 A;  4Q2J A;  2KPJ A;  1LMB 3;  2IUO A;  2BNO A;  2XIU A;  3IVP A;  2HCS A;  4WVL A;  4ER0 A;  4X4F A;  2PXF A;  3A9Y A;  1OCT C;  4J1W A;  1RIO A;  1QQB A;  3UFD A;  1PNR A;  2IVB A;  3OMT A;  1PER L;  2PXK A;  3ZHI A;  2O38 A;  2XXQ A;  2J7W A;  3R09 A;  1PRA A;  4I8T A;  1LQC A;  1RZS A;  4PU3 C;  3QF3 A;  1YSE A;  1JFS A;  1XWR A;  3OWQ A;  5DT2 A;  3TEP A;  3GZD C;  4IA8 A;  3SCH A;  2ICT A;  3TFL A;  1BDH A;  3SCG A;  2PUE A;  3BS3 A;  2LNM A;  3NXH A;  2BJC A;  2PXT A;  3OQN A;  2KEK A;  3QYX A;  3H5T A;  2LLV A;  4EKI A;  1WIZ A;  3KJX A;  2PPX A;  3LFP A;  2LYQ A;  2IU7 A;  4Y42 A;  2CRO A;  2PXE A;  3LQX A;  3OQO A;  2JCG A;  4EKG A;  1JFT A;  3UWP A;  3ZHM A;  2LYP A;  2BNM A;  1RZR D;  2AXZ A;  5DTQ A;  4EK9 A;  3SR4 A;  1WET A;  3ZPX A;  2PUG A; 
#chains in the Genus database with same CATH homology
 3MLF A;  2KPJ A;  4I6R A;  3EUS A;  1LMB 3;  2IUO A;  4X4H A;  2AW6 A;  2BNO A;  3GN5 A;  1O4X A;  3KXA A;  1S7E A;  2XIU A;  2A6C A;  3IVP A;  1WET A;  2B5A A;  4MCT A;  4X4E A;  4X4F A;  4JCY A;  4NDW A;  1UXD A;  1LCD A;  1WH8 A;  2LYK A;  2GRL A;  5K98 B;  4X4G A;  1WH6 A;  4YAR A;  1LLI A;  2H8R A;  4PU8 A;  4Z5D A;  4X4D A;  1SQ8 A;  3TRB A;  4I6T A;  1AU7 A;  2PUF A;  4GHJ A;  2AXU A;  1ADR A;  1ZZ8 A;  3OP9 A;  2WIU B;  1OCT C;  1ZZC A;  1EFA A;  4MCX A;  1E3O C;  1X2L A;  3LIS A;  1PRU A;  4J1W A;  1RIO A;  1QQB A;  2EBY A;  3VK0 A;  3UFD A;  2O4A A;  1PNR A;  1JH9 A;  2IVB A;  3OMT A;  2XI8 A;  1R69 A;  2ICP A;  1LCC A;  1PER L;  2PUB A;  3ZHI A;  1HF0 A;  1PRV A;  2PUC A;  1DWK A;  1ZZ7 A;  2O38 A;  3CEC A;  4Z5H A;  2AWI A;  4OB4 A;  4YG4 A;  1ZPQ A;  2KEI A;  2OR1 L;  4PU7 A;  3O9X A;  1PRA A;  3CRO L;  1POU A;  2HIN A;  4X4I A;  2LYJ A;  1GT0 C;  1UXC A;  2GRM A;  1CQT A;  4I8T A;  3GBF A;  2MEZ A;  1LQC A;  1RZS A;  1B0N A;  4J1X A;  4PU3 C;  2R1J L;  1OSL A;  1ZAY A;  2XCJ A;  3G5G A;  2LYR A;  1YSE A;  3QF3 A;  3BDN A;  1JFS A;  1XWR A;  2KEJ A;  1Y9Q A;  1VPW A;  2LYS A;  1QP7 A;  4FN3 A;  2PIJ A;  4JCX A;  1BDI A;  2WUS R;  4FBI A;  2O49 A;  4IA8 A;  3R1F A;  3SCH A;  1ZVV A;  3G7D A;  2XJ3 A;  2ICT A;  4IVZ A;  4X4C A;  3ZKC A;  4YG7 B;  4IWR A;  1IC8 A;  2PUD A;  3S8Q A;  3DNV B;  2EWT A;  4F8D A;  2AUW A;  2LCV A;  3SCG A;  1JWL A;  1BDH A;  3JXD L;  3HZI B;  4O8B A;  2HSG A;  3BS3 A;  2PUE A;  2L49 A;  2BJC A;  1X57 A;  1ZZB A;  1RPE L;  1ZZ6 A;  3F51 A;  3CLC A;  3U3W A;  2IV1 A;  3OQN A;  2KEK A;  3QYX A;  3FMY A;  3H5T A;  2PUA A;  1QPZ A;  1R63 A;  1L1M A;  3B7H A;  2BNN A;  4Z58 A;  4Z5C A;  3QWG A;  1ZZ9 A;  4PU4 C;  3JXC L;  1NEQ A;  1DW9 A;  2XSD C;  2R63 A;  4YBA A;  2PE5 A;  2LYL A;  1WIZ A;  2JVL A;  3KZ3 A;  1QP0 A;  4Z59 A;  3FYA A;  3KJX A;  2KZ8 A;  2AXV A;  2MQK A;  2PPX A;  1QQA A;  2IVG A;  3LFP A;  2L8N A;  3F6W A;  2LYQ A;  2IU7 A;  2EF8 A;  1UTX A;  3D1N I;  1RZR A;  4Y42 A;  3OQM A;  1CJG A;  4I6U A;  1ZUG A;  3BD1 A;  2OFY A;  4YG1 A;  1ZS4 A;  2CRO A;  4JQD A;  4GQM A;  2IVQ A;  5A7L A;  2D5V A;  3OQO A;  1Y7Y A;  2JCG A;  1JFT A;  3F52 A;  1QP4 A;  2CSF A;  2GZU A;  3ZHM A;  2LYP A;  2BNM A;  4X4B A;  1NER A;  2FJR A;  3PXP A;  3JXB C;  3QQ6 A;  3GN5 B;  1RZR D;  2AXZ A;  3L1P A;  3RZZ A;  2PUG A;  3FYM A;  3SCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...