2MEZA

Flexible anchoring of archaeal mbf1 on ribosomes suggests role as recruitment factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
ENAELEIVTDYYKIIKTAREQLGISQQQLAQKLKVSENIVKRFESGKLKPTISQARQLEKILGIKLVTPLENNEESEKEFDDTGLTLGDVVNIKEGKKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal MBF1 binds to 30S and 70S ribosomes via its helix-turn-helix domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Rna binding protein
molecule keywords Multiprotein Bridging Factor (MBP-like)
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2mezA00
2O38A 2LYKA 2ICPA 3TRBA 1YSEA 2OR1L 3CECA 1LQCA 1ADRA 3PXPA 4FN3A 2XJ3A 1R63A 2AWIA 4MCTA 4I8TA 1ZZCA 3L1PA 3F6WA 2LYJA 3SCGA 1WIZA 4F8DA 1X57A 1OCTC 1RZSA 1NEQA 4Z5DA 1LMB3 2ICTA 1S7EA 2LYPA 4I6UA 3GN5A 2GZUA 1QP0A 3ZHMA 1ZUGA 3BD1A 2XCJA 4PU4C 4X4FA 3QQ6A 1QP7A 2XIUA 4PU3C 2D5VA 3FYAA 2AUWA 2PPXA 4YG7B 2IVGA 1L1MA 3CLCA 3F51A 1JWLA 4YARA 3JXDL 1ZZ9A 2KEIA 4IWRA 4YBAA 2JCGA 2GRLA 2R1JL 1QQAA 4J1XA 4X4CA 4I6TA 3VK0A 2EWTA 2HSGA 2WUSR 3SCFA 3SCHA 4GQMA 1UXCA 3LFPA 4Z5CA 2IVQA 4X4BA 1WH6A 4X4DA 2KEKA 1PNRA 3JXBC 2PUDA 3JXCL 2EBYA 2JVLA 1E3OC 1VPWA 2PE5A 1RZRA 1PERL 3H5TA 1IC8A 4FBIA 3BS3A 1PRAA 3OMTA 3UFDA 4Z58A 3OQNA 1LCCA 1ZZBA 4PU7A 1WH8A 2FJRA 3RZZA 1X2LA 2GRMA 4JCYA 1Y9QA 2LYSA 1JH9A 2XSDC 2PUGA 2BJCA 4PU8A 1ZZ8A 2PUBA 2CSFA 2OFYA 3FYMA 4Z59A 2PUFA 1WETA 1PRVA 3S8QA 4JCXA 2A6CA 2EF8A 1QP4A 1RPEL 3D1NI 3FMYA 3G5GA 3IVPA 2IVBA 1AU7A 4MCXA 4X4EA 3GN5B 2LYRA 2MQKA 1CQTA 1BDIA 1ZS4A 3G7DA 3KZ3A 1ZAYA 4YG4A 2L8NA 4OB4A 2H8RA 1EFAA 2O49A 1GT0C 2BNNA 2KEJA 2R63A 3B7HA 2BNOA 2IUOA 1UXDA 3ZHIA 1RZRD 3OP9A 4Z5HA 2PUCA 4X4GA 1DWKA 3QF3A 1POUA 1HF0A 1LCDA 1PRUA 1ZVVA 5A7LA 3OQMA 4GHJA 2PUAA 1OSLA 3DNVB 2BNMA 1SQ8A 3LISA 2PUEA 1O4XA 1ZZ7A 1RIOA 3GBFA 1ZPQA 3KXAA 3BDNA 1JFTA 2B5AA 2AW6A 2KPJA 2CROA 2IU7A 1UTXA 2XI8A 3F52A 3R1FA 3MLFA 4YG1A 3O9XA 3QYXA 4JQDA 2LYLA 1DW9A 2L49A 2PIJA 4I6RA 5K98B 1QQBA 4J1WA 1LLIA 1Y7YA 3EUSA 1XWRA 2MEZA 2LCVA 2IV1A 3HZIB 2AXUA 3KJXA 3QWGA 4IVZA 4X4HA 1R69A 2AXVA 2WIUB 3U3WA 3ZKCA 2O4AA 2HINA 3CROL 1QPZA 2LYQA 1ZZ6A 4Y42A 4X4IA 2KZ8A 1B0NA 3OQOA 1JFSA 2AXZA 4O8BA 4IA8A 1CJGA 4NDWA 1NERA 1BDHA
chains in the Genus database with same CATH superfamily
2ICPA 1ADRA 2LLVA 4I8TA 3F6WA 1OCTC 1LMB3 5DTRA 3QQ6A 1QP7A 3NROA 4PU3C 3F51A 3JXDL 1ZZ9A 4IWRA 2JCGA 1QQAA 4J1XA 2EWTA 3SCFA 4X4BA 2JVLA 2PXUA 1LCCA 3UFDA 4Z58A 4PU7A 4ER5A 3TEPA 2FJRA 1Y9QA 2PUGA 2PUBA 4PU8A 2CSFA 3FYMA 4JCXA 3GZDC 4DE8A 2A6CA 2EF8A 1QP4A 3D1NI 4X4EA 2LYRA 1BDIA 3G7DA 3KZ3A 2L8NA 2H8RA 4EQZA 1QB2A 2KEJA 3B7HA 3R09A 3OWQA 3QOXA 3ZHIA 3OP9A 2PUCA 3QF3A 2PUAA 1OSLA 2BNMA 3LISA 2PXFA 3KXAA 2B5AA 1UTXA 3R1FA 3MLFA 3QYXA 2L49A 5K98B 1QQBA 3LQXA 4EK9A 1NW3A 3ZKCA 2O4AA 3GZCA 1QPZA 4Y42A 3OQOA 1JFSA 2AXZA 2O38A 3OKZA 2LYKA 1YSEA 2OR1L 1LQCA 2XJ3A 4MCTA 4ER7A 1WIZA 4F8DA 1RZSA 3DM5A 4Z5DA 2ICTA 1S7EA 3ME5A 2LYPA 4I6UA 2GZUA 3ZHMA 1ZUGA 4X4FA 3UWPA 2XIUA 2D5VA 3FYAA 4YG7B 2IVGA 3PE5A 3CLCA 1JWLA 4YARA 2KEIA 4Q2JA 3VK0A 4GQMA 4Z5CA 2KEKA 3JXBC 5JUWA 1VPWA 1RZRA 1PERL 3H5TA 1IC8A 2MXDA 3OMTA 4FBIA 5DTQA 3VWSA 1ZZBA 3ZPXA 5DRTA 4JCYA 2LLWA 1JH9A 1ZZ8A 2OFYA 4Z59A 2PXTA 1PRVA 1RPEL 3IVPA 3M9LA 1ZS4A 1ZAYA 4OB4A 1GT0C 2BNNA 2ODRD 1RZRD 4X4GA 2VEOA 1SQ8A 2PUEA 4EZIA 3GBFA 2CROA 4ER6A 3O9XA 4JQDA 1DW9A 2JQEA 2PIJA 4I6RA 4J1WA 2PXVA 1XWRA 5DRYA 2PXDA 3QWGA 4X4HA 3U3WA 3GUUA 2PXKA 3A9YA 3GZDA 3HZIB 3NDBB 3CECA 3PXPA 1R63A 3SCGA 1X57A 2J7WA 1HQ1A 2XCJA 1L1MA 2PPXA 4X4CA 2HSGA 2WUSR 1UXCA 3LFPA 1PNRA 2EBYA 5DTMA 2M4HA 1WH8A 3QFIA 2GRMA 2LYSA 2PXBA 2HFZA 2PUFA 2IVBA 1AU7A 4MCXA 3GN5B 2MQKA 1CQTA 2R63A 2PXLA 2BNOA 3A9ZA 2XXQA 1UXDA 4Z5HA 1DWKA 1LCDA 1HF0A 1PRUA 3A9XA 3DNVB 1O4XA 1ZZ7A 4YG1A 3F52A 2LYLA 1LLIA 1Y7YA 3EUSA 2MEZA 2LCVA 5DT2A 2IV1A 2FFHA 3KJXA 1R69A 2AXVA 2WIUB 2PXPA 4ER3A 2KZ8A 2YBDA 1CJGA 4EKIA 4NDWA 1NERA 3TRBA 3SR4A 4FN3A 2AWIA 1ZZCA 3L1PA 4EKGA 2LYJA 1MFQC 3QOWA 3TFLA 1NEQA 3GN5A 1QP0A 3BD1A 4PU4C 1QZXA 2AUWA 4YBAA 2GRLA 3MEJA 2R1JL 2PXEA 4I6TA 4WVLA 3SCHA 4X4DA 2IVQA 1WH6A 2PUDA 3JXCL 2HCSA 1E3OC 2PE5A 2XXAA 2V3CC 3BS3A 1PRAA 3OQNA 3RZZA 1X2LA 2L1PA 2XSDC 2BJCA 1WETA 3S8QA 3FMYA 3G5GA 2HCNA 3KL4A 4DE9A 2J7UA 4YG4A 1EFAA 2O49A 3NZLA 2IUOA 5GAHi 3G0TA 3NXHA 1POUA 1ZVVA 5A7LA 3OQMA 4GHJA 1RIOA 1ZPQA 3BDNA 1JFTA 2AW6A 2KPJA 2XI8A 2IU7A 5GAGi 3SX0A 1DULA 2LNMA 2AXUA 4ER0A 4IVZA 3TELA 4HRAA 5DSXA 2HINA 3CROL 2LYQA 1U2ZA 1ZZ6A 2XXPA 4X4IA 2PXQA 1B0NA 4O8BA 4IA8A 1BDHA 4OBMA
chains in the Genus database with same CATH topology
2O38A 2LYKA 2ICPA 3TRBA 1YSEA 2OR1L 3CECA 1LQCA 1ADRA 3PXPA 4FN3A 2XJ3A 1R63A 2AWIA 4MCTA 4I8TA 1ZZCA 3L1PA 3F6WA 2LYJA 3SCGA 1WIZA 4F8DA 1X57A 1OCTC 1RZSA 1NEQA 4Z5DA 1LMB3 2ICTA 1S7EA 2LYPA 4I6UA 3GN5A 2GZUA 1QP0A 3ZHMA 1ZUGA 3BD1A 2XCJA 4PU4C 4X4FA 3QQ6A 1QP7A 2XIUA 4PU3C 2D5VA 3FYAA 2AUWA 2PPXA 4YG7B 2IVGA 1L1MA 3CLCA 3F51A 1JWLA 4YARA 3JXDL 1ZZ9A 2KEIA 4IWRA 4YBAA 2JCGA 2GRLA 2R1JL 1QQAA 4J1XA 4X4CA 4I6TA 3VK0A 2EWTA 2HSGA 2WUSR 3SCFA 3SCHA 4GQMA 1UXCA 3LFPA 4Z5CA 2IVQA 4X4BA 1WH6A 4X4DA 2KEKA 1PNRA 3JXBC 2PUDA 3JXCL 2EBYA 2JVLA 1E3OC 1VPWA 2PE5A 1RZRA 1PERL 3H5TA 1IC8A 4FBIA 3BS3A 1PRAA 3OMTA 3UFDA 4Z58A 3OQNA 1LCCA 1ZZBA 4PU7A 1WH8A 2FJRA 3RZZA 1X2LA 2GRMA 4JCYA 1Y9QA 2LYSA 1JH9A 2XSDC 2PUGA 2BJCA 4PU8A 1ZZ8A 2PUBA 2CSFA 2OFYA 3FYMA 4Z59A 2PUFA 1WETA 1PRVA 3S8QA 4JCXA 2A6CA 2EF8A 1QP4A 1RPEL 3D1NI 3FMYA 3G5GA 3IVPA 2IVBA 1AU7A 4MCXA 4X4EA 3GN5B 2LYRA 2MQKA 1CQTA 1BDIA 1ZS4A 3G7DA 3KZ3A 1ZAYA 4YG4A 2L8NA 4OB4A 2H8RA 1EFAA 2O49A 1GT0C 2BNNA 2KEJA 2R63A 3B7HA 2BNOA 2IUOA 1UXDA 3ZHIA 1RZRD 3OP9A 4Z5HA 2PUCA 4X4GA 1DWKA 3QF3A 1POUA 1HF0A 1LCDA 1PRUA 1ZVVA 5A7LA 3OQMA 4GHJA 2PUAA 1OSLA 3DNVB 2BNMA 1SQ8A 3LISA 2PUEA 1O4XA 1ZZ7A 1RIOA 3GBFA 1ZPQA 3KXAA 3BDNA 1JFTA 2B5AA 2AW6A 2KPJA 2CROA 2IU7A 1UTXA 2XI8A 3F52A 3R1FA 3MLFA 4YG1A 3O9XA 3QYXA 4JQDA 2LYLA 1DW9A 2L49A 2PIJA 4I6RA 5K98B 1QQBA 4J1WA 1LLIA 1Y7YA 3EUSA 1XWRA 2MEZA 2LCVA 2IV1A 3HZIB 2AXUA 3KJXA 3QWGA 4IVZA 4X4HA 1R69A 2AXVA 2WIUB 3U3WA 3ZKCA 2O4AA 2HINA 3CROL 1QPZA 2LYQA 1ZZ6A 4Y42A 4X4IA 2KZ8A 1B0NA 3OQOA 1JFSA 2AXZA 4O8BA 4IA8A 1CJGA 4NDWA 1NERA 1BDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O38 A;  2LYK A;  2ICP A;  3TRB A;  1YSE A;  2OR1 L;  3CEC A;  1LQC A;  1ADR A;  3PXP A;  4FN3 A;  2XJ3 A;  1R63 A;  2AWI A;  4MCT A;  4I8T A;  1ZZC A;  3L1P A;  3F6W A;  2LYJ A;  3SCG A;  1WIZ A;  4F8D A;  1X57 A;  1OCT C;  1RZS A;  1NEQ A;  4Z5D A;  1LMB 3;  2ICT A;  1S7E A;  2LYP A;  4I6U A;  3GN5 A;  2GZU A;  1QP0 A;  3ZHM A;  1ZUG A;  3BD1 A;  2XCJ A;  4PU4 C;  4X4F A;  3QQ6 A;  1QP7 A;  2XIU A;  4PU3 C;  2D5V A;  3FYA A;  2AUW A;  2PPX A;  4YG7 B;  2IVG A;  1L1M A;  3CLC A;  3F51 A;  1JWL A;  4YAR A;  3JXD L;  1ZZ9 A;  2KEI A;  4IWR A;  4YBA A;  2JCG A;  2GRL A;  2R1J L;  1QQA A;  4J1X A;  4X4C A;  4I6T A;  3VK0 A;  2EWT A;  2HSG A;  2WUS R;  3SCF A;  3SCH A;  4GQM A;  1UXC A;  3LFP A;  4Z5C A;  2IVQ A;  4X4B A;  1WH6 A;  4X4D A;  2KEK A;  1PNR A;  3JXB C;  2PUD A;  3JXC L;  2EBY A;  2JVL A;  1E3O C;  1VPW A;  2PE5 A;  1RZR A;  1PER L;  3H5T A;  1IC8 A;  4FBI A;  3BS3 A;  1PRA A;  3OMT A;  3UFD A;  4Z58 A;  3OQN A;  1LCC A;  1ZZB A;  4PU7 A;  1WH8 A;  2FJR A;  3RZZ A;  1X2L A;  2GRM A;  4JCY A;  1Y9Q A;  2LYS A;  1JH9 A;  2XSD C;  2PUG A;  2BJC A;  4PU8 A;  1ZZ8 A;  2PUB A;  2CSF A;  2OFY A;  3FYM A;  4Z59 A;  2PUF A;  1WET A;  1PRV A;  3S8Q A;  4JCX A;  2A6C A;  2EF8 A;  1QP4 A;  1RPE L;  3D1N I;  3FMY A;  3G5G A;  3IVP A;  2IVB A;  1AU7 A;  4MCX A;  4X4E A;  3GN5 B;  2LYR A;  2MQK A;  1CQT A;  1BDI A;  1ZS4 A;  3G7D A;  3KZ3 A;  1ZAY A;  4YG4 A;  2L8N A;  4OB4 A;  2H8R A;  1EFA A;  2O49 A;  1GT0 C;  2BNN A;  2KEJ A;  2R63 A;  3B7H A;  2BNO A;  2IUO A;  1UXD A;  3ZHI A;  1RZR D;  3OP9 A;  4Z5H A;  2PUC A;  4X4G A;  1DWK A;  3QF3 A;  1POU A;  1HF0 A;  1LCD A;  1PRU A;  1ZVV A;  5A7L A;  3OQM A;  4GHJ A;  2PUA A;  1OSL A;  3DNV B;  2BNM A;  1SQ8 A;  3LIS A;  2PUE A;  1O4X A;  1ZZ7 A;  1RIO A;  3GBF A;  1ZPQ A;  3KXA A;  3BDN A;  1JFT A;  2B5A A;  2AW6 A;  2KPJ A;  2CRO A;  2IU7 A;  1UTX A;  2XI8 A;  3F52 A;  3R1F A;  3MLF A;  4YG1 A;  3O9X A;  3QYX A;  4JQD A;  2LYL A;  1DW9 A;  2L49 A;  2PIJ A;  4I6R A;  5K98 B;  1QQB A;  4J1W A;  1LLI A;  1Y7Y A;  3EUS A;  1XWR A;  2MEZ A;  2LCV A;  2IV1 A;  3HZI B;  2AXU A;  3KJX A;  3QWG A;  4IVZ A;  4X4H A;  1R69 A;  2AXV A;  2WIU B;  3U3W A;  3ZKC A;  2O4A A;  2HIN A;  3CRO L;  1QPZ A;  2LYQ A;  1ZZ6 A;  4Y42 A;  4X4I A;  2KZ8 A;  1B0N A;  3OQO A;  1JFS A;  2AXZ A;  4O8B A;  4IA8 A;  1CJG A;  4NDW A;  1NER A;  1BDH A; 
#chains in the Genus database with same CATH topology
 2ICP A;  1ADR A;  2LLV A;  4I8T A;  3F6W A;  1OCT C;  1LMB 3;  5DTR A;  3QQ6 A;  1QP7 A;  3NRO A;  4PU3 C;  3F51 A;  3JXD L;  1ZZ9 A;  4IWR A;  2JCG A;  1QQA A;  4J1X A;  2EWT A;  3SCF A;  4X4B A;  2JVL A;  2PXU A;  1LCC A;  3UFD A;  4Z58 A;  4PU7 A;  4ER5 A;  3TEP A;  2FJR A;  1Y9Q A;  2PUG A;  2PUB A;  4PU8 A;  2CSF A;  3FYM A;  4JCX A;  3GZD C;  4DE8 A;  2A6C A;  2EF8 A;  1QP4 A;  3D1N I;  4X4E A;  2LYR A;  1BDI A;  3G7D A;  3KZ3 A;  2L8N A;  2H8R A;  4EQZ A;  1QB2 A;  2KEJ A;  3B7H A;  3R09 A;  3OWQ A;  3QOX A;  3ZHI A;  3OP9 A;  2PUC A;  3QF3 A;  2PUA A;  1OSL A;  2BNM A;  3LIS A;  2PXF A;  3KXA A;  2B5A A;  1UTX A;  3R1F A;  3MLF A;  3QYX A;  2L49 A;  5K98 B;  1QQB A;  3LQX A;  4EK9 A;  1NW3 A;  3ZKC A;  2O4A A;  3GZC A;  1QPZ A;  4Y42 A;  3OQO A;  1JFS A;  2AXZ A;  2O38 A;  3OKZ A;  2LYK A;  1YSE A;  2OR1 L;  1LQC A;  2XJ3 A;  4MCT A;  4ER7 A;  1WIZ A;  4F8D A;  1RZS A;  3DM5 A;  4Z5D A;  2ICT A;  1S7E A;  3ME5 A;  2LYP A;  4I6U A;  2GZU A;  3ZHM A;  1ZUG A;  4X4F A;  3UWP A;  2XIU A;  2D5V A;  3FYA A;  4YG7 B;  2IVG A;  3PE5 A;  3CLC A;  1JWL A;  4YAR A;  2KEI A;  4Q2J A;  3VK0 A;  4GQM A;  4Z5C A;  2KEK A;  3JXB C;  5JUW A;  1VPW A;  1RZR A;  1PER L;  3H5T A;  1IC8 A;  2MXD A;  3OMT A;  4FBI A;  5DTQ A;  3VWS A;  1ZZB A;  3ZPX A;  5DRT A;  4JCY A;  2LLW A;  1JH9 A;  1ZZ8 A;  2OFY A;  4Z59 A;  2PXT A;  1PRV A;  1RPE L;  3IVP A;  3M9L A;  1ZS4 A;  1ZAY A;  4OB4 A;  1GT0 C;  2BNN A;  2ODR D;  1RZR D;  4X4G A;  2VEO A;  1SQ8 A;  2PUE A;  4EZI A;  3GBF A;  2CRO A;  4ER6 A;  3O9X A;  4JQD A;  1DW9 A;  2JQE A;  2PIJ A;  4I6R A;  4J1W A;  2PXV A;  1XWR A;  5DRY A;  2PXD A;  3QWG A;  4X4H A;  3U3W A;  3GUU A;  2PXK A;  3A9Y A;  3GZD A;  3HZI B;  3NDB B;  3CEC A;  3PXP A;  1R63 A;  3SCG A;  1X57 A;  2J7W A;  1HQ1 A;  2XCJ A;  1L1M A;  2PPX A;  4X4C A;  2HSG A;  2WUS R;  1UXC A;  3LFP A;  1PNR A;  2EBY A;  5DTM A;  2M4H A;  1WH8 A;  3QFI A;  2GRM A;  2LYS A;  2PXB A;  2HFZ A;  2PUF A;  2IVB A;  1AU7 A;  4MCX A;  3GN5 B;  2MQK A;  1CQT A;  2R63 A;  2PXL A;  2BNO A;  3A9Z A;  2XXQ A;  1UXD A;  4Z5H A;  1DWK A;  1LCD A;  1HF0 A;  1PRU A;  3A9X A;  3DNV B;  1O4X A;  1ZZ7 A;  4YG1 A;  3F52 A;  2LYL A;  1LLI A;  1Y7Y A;  3EUS A;  2MEZ A;  2LCV A;  5DT2 A;  2IV1 A;  2FFH A;  3KJX A;  1R69 A;  2AXV A;  2WIU B;  2PXP A;  4ER3 A;  2KZ8 A;  2YBD A;  1CJG A;  4EKI A;  4NDW A;  1NER A;  3TRB A;  3SR4 A;  4FN3 A;  2AWI A;  1ZZC A;  3L1P A;  4EKG A;  2LYJ A;  1MFQ C;  3QOW A;  3TFL A;  1NEQ A;  3GN5 A;  1QP0 A;  3BD1 A;  4PU4 C;  1QZX A;  2AUW A;  4YBA A;  2GRL A;  3MEJ A;  2R1J L;  2PXE A;  4I6T A;  4WVL A;  3SCH A;  4X4D A;  2IVQ A;  1WH6 A;  2PUD A;  3JXC L;  2HCS A;  1E3O C;  2PE5 A;  2XXA A;  2V3C C;  3BS3 A;  1PRA A;  3OQN A;  3RZZ A;  1X2L A;  2L1P A;  2XSD C;  2BJC A;  1WET A;  3S8Q A;  3FMY A;  3G5G A;  2HCN A;  3KL4 A;  4DE9 A;  2J7U A;  4YG4 A;  1EFA A;  2O49 A;  3NZL A;  2IUO A;  5GAH i;  3G0T A;  3NXH A;  1POU A;  1ZVV A;  5A7L A;  3OQM A;  4GHJ A;  1RIO A;  1ZPQ A;  3BDN A;  1JFT A;  2AW6 A;  2KPJ A;  2XI8 A;  2IU7 A;  5GAG i;  3SX0 A;  1DUL A;  2LNM A;  2AXU A;  4ER0 A;  4IVZ A;  3TEL A;  4HRA A;  5DSX A;  2HIN A;  3CRO L;  2LYQ A;  1U2Z A;  1ZZ6 A;  2XXP A;  4X4I A;  2PXQ A;  1B0N A;  4O8B A;  4IA8 A;  1BDH A;  4OBM A; 
#chains in the Genus database with same CATH homology
 2O38 A;  2LYK A;  2ICP A;  3TRB A;  1YSE A;  2OR1 L;  3CEC A;  1LQC A;  1ADR A;  3PXP A;  4FN3 A;  2XJ3 A;  1R63 A;  2AWI A;  4MCT A;  4I8T A;  1ZZC A;  3L1P A;  3F6W A;  2LYJ A;  3SCG A;  1WIZ A;  4F8D A;  1X57 A;  1OCT C;  1RZS A;  1NEQ A;  4Z5D A;  1LMB 3;  2ICT A;  1S7E A;  2LYP A;  4I6U A;  3GN5 A;  2GZU A;  1QP0 A;  3ZHM A;  1ZUG A;  3BD1 A;  2XCJ A;  4PU4 C;  4X4F A;  3QQ6 A;  1QP7 A;  2XIU A;  4PU3 C;  2D5V A;  3FYA A;  2AUW A;  2PPX A;  4YG7 B;  2IVG A;  1L1M A;  3CLC A;  3F51 A;  1JWL A;  4YAR A;  3JXD L;  1ZZ9 A;  2KEI A;  4IWR A;  4YBA A;  2JCG A;  2GRL A;  2R1J L;  1QQA A;  4J1X A;  4X4C A;  4I6T A;  3VK0 A;  2EWT A;  2HSG A;  2WUS R;  3SCF A;  3SCH A;  4GQM A;  1UXC A;  3LFP A;  4Z5C A;  2IVQ A;  4X4B A;  1WH6 A;  4X4D A;  2KEK A;  1PNR A;  3JXB C;  2PUD A;  3JXC L;  2EBY A;  2JVL A;  1E3O C;  1VPW A;  2PE5 A;  1RZR A;  1PER L;  3H5T A;  1IC8 A;  4FBI A;  3BS3 A;  1PRA A;  3OMT A;  3UFD A;  4Z58 A;  3OQN A;  1LCC A;  1ZZB A;  4PU7 A;  1WH8 A;  2FJR A;  3RZZ A;  1X2L A;  2GRM A;  4JCY A;  1Y9Q A;  2LYS A;  1JH9 A;  2XSD C;  2PUG A;  2BJC A;  4PU8 A;  1ZZ8 A;  2PUB A;  2CSF A;  2OFY A;  3FYM A;  4Z59 A;  2PUF A;  1WET A;  1PRV A;  3S8Q A;  4JCX A;  2A6C A;  2EF8 A;  1QP4 A;  1RPE L;  3D1N I;  3FMY A;  3G5G A;  3IVP A;  2IVB A;  1AU7 A;  4MCX A;  4X4E A;  3GN5 B;  2LYR A;  2MQK A;  1CQT A;  1BDI A;  1ZS4 A;  3G7D A;  3KZ3 A;  1ZAY A;  4YG4 A;  2L8N A;  4OB4 A;  2H8R A;  1EFA A;  2O49 A;  1GT0 C;  2BNN A;  2KEJ A;  2R63 A;  3B7H A;  2BNO A;  2IUO A;  1UXD A;  3ZHI A;  1RZR D;  3OP9 A;  4Z5H A;  2PUC A;  4X4G A;  1DWK A;  3QF3 A;  1POU A;  1HF0 A;  1LCD A;  1PRU A;  1ZVV A;  5A7L A;  3OQM A;  4GHJ A;  2PUA A;  1OSL A;  3DNV B;  2BNM A;  1SQ8 A;  3LIS A;  2PUE A;  1O4X A;  1ZZ7 A;  1RIO A;  3GBF A;  1ZPQ A;  3KXA A;  3BDN A;  1JFT A;  2B5A A;  2AW6 A;  2KPJ A;  2CRO A;  2IU7 A;  1UTX A;  2XI8 A;  3F52 A;  3R1F A;  3MLF A;  4YG1 A;  3O9X A;  3QYX A;  4JQD A;  2LYL A;  1DW9 A;  2L49 A;  2PIJ A;  4I6R A;  5K98 B;  1QQB A;  4J1W A;  1LLI A;  1Y7Y A;  3EUS A;  1XWR A;  2MEZ A;  2LCV A;  2IV1 A;  3HZI B;  2AXU A;  3KJX A;  3QWG A;  4IVZ A;  4X4H A;  1R69 A;  2AXV A;  2WIU B;  3U3W A;  3ZKC A;  2O4A A;  2HIN A;  3CRO L;  1QPZ A;  2LYQ A;  1ZZ6 A;  4Y42 A;  4X4I A;  2KZ8 A;  1B0N A;  3OQO A;  1JFS A;  2AXZ A;  4O8B A;  4IA8 A;  1CJG A;  4NDW A;  1NER A;  1BDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...