2MF2A

Structural and biophysical characterization of the mrna interferase samazf from staphylococcus aureus.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'GSSHHHHHHSQDPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 29
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mf2A00
5CCAA 5HK0A 5CQYA 5CKDA 3G7ZA 4MZMA 2C06A 1VUBA 4MZPA 5CKHA 1X75C 4ME7A 3JSCA 4OF1A 4MZTA 2VUBA 5DLOA 5CO7A 5CQXA 4VUBA 5HK3A 4HKEA 5CK9A 1M1FA 5HKCA 5CKEA 4ELYC 5CR2A 2KMTA 1UB4A 3JRZA 5CKBA 5CKFA 4ELZC 2MF2A 3VUBA 3TCJA 4MDXA 3HPWA 1NE8A 3NFCA
chains in the Genus database with same CATH superfamily
2QXFA 4FYXB 4KGVB 3VKIA 3V8JA 3MKDA 1ZSZB 2KRMA 2Y90A 4M7AD 2X35A 3AHUA 3JCMX 2OTJQ 4M7DF 4N4IA 3SHWA 2DETA 2EQMA 3A8LB 5GAN7 1EIFA 2XD0A 1XOVA 1VQ7Q 1BBZA 1YJWQ 4EPCA 1WHGA 1M27C 4QW2A 2IIMA 1YNZA 2SRCA 1F1BB 2LDMA 1TU0B 5GMKi 3BDUA 1PM3A 2DJQA 1K8AU 4M7DA 4C92E 2XDDA 1ARKA 2SEMA 2XI9A 5GAOm 5FU6C 5EC7A 2RHXA 1QVFP 2MWOA 2GFAA 4O5VA 3VUBA 2OTJT 1QVFS 3NGPA 3PFSA 4B9WA 3G4SQ 3A8GB 2WSEE 1VQ7T 4OB1B 2DXCA 1OOTA 4HT8A 1YJWT 1ZA2B 4AG1C 4A4GA 3CCVQ 3QSUA 4DOVA 1UGVA 2E64A 2DE0X 2LCCA 2RB6A 4PJLA 2VKNA 2K6DA 2GNCA 1FMVA 2VYTA 3OYFA 2CP5A 5I21A 1M90U 3OYDA 3GLXA 3GNFB 1NJIU 1VA7A 3SD4A 1JXMA 3H0FA 4OGCA 4M77A 1IREB 2KRSA 4OB2B 3X26B 2R58A 5FWBA 3G4ST 2HQXA 2EQUA 3TSWA 2OI3A 1AWWA 2BUDA 3A98A 2YLBA 2YWWA 5D6XA 2DRMA 2OTLQ 2Y4YA 2V8JA 3HFNA 4X9DA 2QGGA 1N9SA 1EFNA 4FL6A 4J7FA 4XTUA 2E5KA 1PD1A 4MZMA 5CKHA 1Y7XA 1QLYA 3GPLA 4MZTA 3FB9A 2ZPHB 2A3LA 5DY9A 5KYXB 2BKDN 4F7UB 1JBMA 1S72Q 1IGQA 2EGCA 2VV5A 3IQLA 3MP1A 4UC4A 3CXCP 4LUEA 4RMOA 2GFUA 2RQRA 3M54A 1HSQA 2RHIA 2PVDB 4XU3A 4A4KA 2QEXA 2OTLT 3OYLA 3TQ7P 3EH2A 1JXOA 4RTUA 3LWIA 3MO8A 1W2BA 3VS1A 5KYYA 3OYMA 4MMKA 3QYHB 2G3RA 4QQGA 3FEOA 1KFZA 1YFNA 4PLLA 2QAZA 3RR6A 1IXDA 3LWHA 3CBMA 1S72T 1TWBA 3CD6Q 4CC2A 2BE9B 2NWMA 2X4WA 2LT4A 2JW4A 2KROA 4OMNA 4Z89A 5A0DA 2VXEA 4OVAA 1M3CA 1RADB 3ZFJA 1EZZB 5LL6S 2FRWA 4HT9A 3H6ZA 1NPPA 1VQOQ 4IUPA 3KXTA 2VXFA 3HTRA 3RESA 3KUFA 2HKNA 4II1A 1D0XA 1BIBA 3LH0A 2COWA 4HVUA 1NG2A 1SSHA 3JAME 1ZUYA 4FT4A 4ZGDB 3CD6T 3VS0A 4XTWA 3RKWA 1I5OB 3OS1A 2P0QA 4LDXA 2E5QA 1T0HA 1JO8A 3VYHB 4C92F 4DBQA 1VQOT 4M78E 5GAOn 4KUDK 3M4YA 4C92B 3QKJA 2NUZA 2DERA 2VUBA 1X6GA 4QQDA 5KE3A 1VQ8A 4A4HA 1VQLQ 4BACA 1WYXA 4ESRA 3NTKA 2A37A 1TUGB 2ABLA 1WJSA 2K9GA 2ZPEB 3OY9A 1KG1A 3M56A 4ME7A 1WPYA 1M8MA 2QQSA 2IPOB 2JUFA 4QKUA 1ABQA 1B34B 3BW1A 1BI2A 1X2KA 1VQLT 2M16A 1AEYA 2HKQB 2XHCA 1X6BA 4F14A 3CCRA 4C8QA 1Q81C 3OB9A 3JCMh 1M4ZA 5CVIA 3MEUA 3KBGA 2CDTA 1AWXA 1MMNA 3V7RA 1GCPA 1N6AA 3CMAA 2O2OA 4FU6A 2LZ6B 2KMTA 2CP7A 1K1ZA 4KULA 1D1AA 2LQNA 2O88A 2OAWA 4BI3A 1N9RA 5CIUA 4L6V5 3V7CA 2RI3A 2LQ8A 3L2WA 3G6EA 1Y71A 1Z9QA 4J8OA 2KSSA 5CQXA 2VC8A 5HK3A 2KYMA 2HBWA 2X4YA 5CK9A 2E3IA 2RI2A 1K73C 3CQTA 4XAXB 2IG0A 1V29B 5LJ3d 3SWNB 1VQ9Q 1YN8A 5I2SA 2YSQA 2O4XB 3QBYA 5GAOl 1JRIA 5IHKA 3CBOA 3M53A 4GBQA 2DXTA 2F69A 3L2VA 4EMKC 4DBHA 3CCLA 1XNIA 5GANe 2QGFB 3E19A 1SHGA 2KT8A 1HXDA 1NYFA 2RJFA 2E70A 5J3BA 3I35A 2DF6A 2VASA 2HSEB 2CUBA 4KGZB 3DB4A 3I55A 3FC3A 4PJOG 4JJDA 2M0OA 3PE0A 3HL8A 4R0KA 3VS5A 3I56A 1G5VA 1VQ9T 4J9HA 4VUBA 3JB9F 4E7ZA 1T0JA 2P84A 2PQWA 2BZYA 4C92D 2RPNA 1K9MU 2EBPA 3QPHA 2CYZB 2PUKB 2MK5A 3SEMA 1MHNA 2JM8A 1TSFA 3HSBA 5GAOp 4J6YA 1I81A 1H641 1RLPC 5CKDA 3EFRA 4AMCA 4BDZA 4NS5A 3OYBA 2KY9A 1G3WA 3JB9H 4B6MA 2RN8A 4X34A 3H0IA 1M9SA 1HD3A 3CCMA 2XMFA 2FRYA 4M78B 4GLMA 1YWPA 2RH2A 3CC4Q 2FO0A 4J7IA 2JTEA 2A28A 1Q81R 4FIBA 2MPXC 3L2QA 4XK8E 3SB2A 3QJ6A 4ATOA 1BI0A 4GLKA 3VYGA 2RJCA 4RKUE 2RJEA 2HMAA 5GAN3 2DTHA 4ELYC 1U3OA 1WXUA 3QXEB 4OMOA 4ZTFA 5FRMA 3HPWA 4RCBA 2YRDA 3L2UA 3EG9B 1JJ2S 2J6OA 4LN2A 3ZL7C 3X25B 3TSZA 4IUTA 3CC4T 1VQ4A 5IT9E 2DBMA 1Y96A 2E3HA 3X24B 3UPUA 4ORZA 3VS6A 2GTOA 1K73R 1BB9A 3JRZA 4M7AA 2RQTA 3JCMf 4DBRA 3RNJA 2CGHA 1AWOA 2JXBA 2JNGA 2AIRB 2EIFA 4PJJA 4E6RA 4AFUC 4PFOA 3VU3C 2LT1A 3OS5A 3OYEA 1WHJA 1UG1A 2EYZA 2K2VA 1ZQ1A 2XG8D 1Q86C 4JRQA 2B86A 2EJFA 4JRIA 1VIEA 4PJOB 4M75A 1J3TA 4M77E 3UATA 2EAYA 2K5LA 2FZKB 4E7SA 3REBB 2BZ8A 3EGXB 4M4ZA 3CC2A 1UHCA 2CH4W 4M7DG 3CCEA 4JUVA 3NTIA 5LJ5f 1MMAA 2DIQA 3A5ZB 2QQBA 3ZBDA 3S3NA 3QHSA 2LQKA 2D9TA 2D8JA 2EVRA 3A8HB 2ZPBB 2ZGWA 1TUDA 2HBPA 2ENMA 4RTWA 1W70A 4E7IA 4HVWA 2NUTB 4LD6A 2XDPA 2DXUA 5IHNA 1M1KU 3P8HA 4J6WA 1LJOA 1WQ7A 3RMSA 4JZ3A 2C0TA 3E1SA 2FG0A 1I1JA 2JOYA 5KE2A 1SF9A 2E6NA 1I4K1 1OYXA 2YRVA 2KXCA 3C0CA 1U8RA 2LJ3A 2KQWA 3CPFA 3OYGA 4RTTA 4M78D 1D3BB 3U23A 3M9QA 1QKWA 4J9FA 2JT4A 3M0UA 1BYMA 2DVEA 3OMGA 3JCMg 3I9QA 3V8KA 3DLLA 2C0IA 2QEXQ 2KNBB 3HRSA 2MCNA 4AG2C 4A54A 4ZN3A 4N0AA 4MDWA 1YCSB 3CPWP 3EFOB 3V7SA 3VS7A 1V76A 2D8HA 4FT2A 5CO7A 3P8BB 3WXMB 2A36A 3HHTB 2B8AA 3EGDA 1UEBA 4BY6C 4PFPA 3RUXA 3G71A 2HQHA 4PKCC 2DL7A 2FPFA 2L0AA 2XDBA 1M2VA 1G3SA 1ZSZA 2GTJA 3LGFA 3BY7A 2EKHA 5LJ5g 3HFOA 2QEXT 3S3OA 2QA4A 4F16A 4KRTA 2KEAA 2E6ZA 1M1FA 1Q86R 1MGQA 1BKBA 4JJNK 2DFUA 2JMCA 1H8KA 1PCXA 1U06A 1N8RU 2DZCA 3MJXA 1PSFA 1IO6A 1A0NB 2CUDA 2CP6A 2L3PA 1PSEA 2RHZA 1WI7A 3PIOA 2LQWA 4A4FA 4E7KA 2D6FA 5IXBA 3MEVA 2JVVA 3CCUA 1OI1A 5IAYA 2DL4A 2JJ9A 1RL2A 5CKFA 3ZEHA 4ELZC 4HA8A 4LDYA 2KE9A 1OU8A 1VQ8Q 2CP2A 1SSFA 2E4HA 3SWNC 2KAFA 2QK0A 3JCMV 4J9BA 4M77B 1TS9A 1W1FA 1WFWA 3DKMA 3EGUA 5A0GA 3PVLA 3OS0A 4RCCA 3L1AA 4N4GA 1VQMA 1KQ2A 2KRNA 1OX8A 1TTHB 1NEBA 1X2QA 2WACA 2DKGA 3EFSA 2GCXA 2CH4A 5EG2A 3E2UA 2C06A 5GAMh 3G1JA 7AT1B 1M3BA 4JS5A 2RO0A 2E12A 3OSVA 4LDWA 1VQ8T 1IGUA 2Y4XA 4F7UF 1QVGP 1CKBA 4PLIA 3M0RA 1RI9A 1UB4A 4XU1A 3CCRQ 4HXJA 1FXXA 4MMLA 2X51A 4L5GA 1WGSA 1KQSA 2RD1A 3NPFA 3CXCS 5GAN6 3CMAQ 2K3XA 1QMCA 1D1CA 1YJNA 3CBPA 4F7UA 2K3BA 2RNAA 4C5GA 3RERA 3O5ZA 1U1SA 2EGAA 1ACMB 3SFMA 2JM9A 1YJ9A 3G6EQ 4C8QG 5KYYB 5FU7B 4WCIA 2HAXA 5IXFA 3CCRT 2BIVA 4E7LA 4M78C 4OF1A 2EJGA 1Y0MA 3PT9A 1HK9A 3CMAT 4XTVA 1WA7A 2MOXA 1KC8C 1FMWA 5J26A 1MUZA 1OPKA 2YLCA 3CCLQ 3O8VA 1JJ2A 2KK4A 1GCQA 5CCAA 3N5BB 3QIIA 1XJWB 2CZ7B 3G7ZA 3G6ET 1VQNA 4KH1B 4A63B 5KH6A 3Q1JA 1G3YA 1NLPC 3NHNA 1QP2A 4RG2A 2XK0A 3I55Q 3V8LA 3I56Q 3QJYA 4OB0B 5AT1B 4OMLA 2AK5A 1B3QA 5CQYA 1VQ5A 2ZCFB 1O9SA 2GGRA 1PWTA 2QQ9A 3HRTA 3CCLT 2HL5C 2L3RA 5DLOA 2R5AA 4PK4A 1YIJA 2XU8A 2JTFA 2DX1A 3EHQA 2I0NA 1GRIA 1UDLA 2CP3A 1TOVA 4V2SA 1R77A 2V8IA 4M77D 1YI2A 3VRZA 4C92A 2FEIA 4PJOC 5HY6A 3OW2A 3OMCA 4R55A 2EQJA 2HCKA 3I55T 2KDSA 3TREA 4DOWA 3LH5A 3LYIA 1IRXA 3M0TA 3I56T 1NYGA 1WHLA 4IUVA 4BY6B 3INZA 5C6SA 3CCMQ 1Q82C 3CCSA 2VGMA 2AHJB 3X20B 1UTIA 1YHQA 2D0NA 4OMQA 1W6XA 2HDAA 3JCMJ 1AD5A 1RABB 3JB9G 1SHFA 2F5KA 2ROTA 3OYIA 3H41A 2FPDA 4FCYA 3TEEA 1KSWA 2E41A 3REAB 2K3YA 4C5HA 4FYWB 4JLIA 2PUOB 5DM7R 2AZSA 3SDZA 5GANd 1R8OB 3FLGA 1SKUB 1ZBXA 2RJDA 1PC0A 5GAMf 3CCMT 1UHFA 4PJOE 5ECAA 3URGA 2BE7D 2PVOB 2LNVA 3M57A 3QYGB 3QDFA 1VQ4Q 1MV0B 5I22A 3NMZC 4DA4A 3JCMb 3CMEA 3JCMd 1ABOA 3EG0A 3NTHA 3QO3A 5LJ3h 2ZPGB 2DD5A 5GJWB 2ATCB 1Q7YC 1KC8R 1MNEA 2QQAA 1H92A 5LJ5h 2VWFA 2EQIA 1VQKA 3EAEA 4DEXA 1X69A 2QQRA 4C5EA 3JSCA 3EG3A 2LJ1A 2HNIA 2QDLA 1NM7A 3M5AA 3OYCA 4M7AG 1VQ4T 3QZ5B 1QQJA 3QUIA 2O4XA 4E7JA 3CC2Q 2MWPA 3PGGA 5DLQE 3CCEQ 4Y92A 5GAMj 4PL6A 2GQIA 1Z9ZA 3JCMe 1GBQA 2O9SA 1UE9A 5KYUA 2HSPA 1C1AA 2K4YA 4QT7A 4M75G 4AFQC 1HJDA 4F17A 3GOXA 1CSKA 3CCQT 1UGPB 4JS4A 1ZSGA 5CKBA 4E2FB 1MMDA 3L42A 5KYNA 2CSIA 2CZ1B 1QVFA 4M7DC 1TH7A 2DAQA 4KUIA 4BDYA 1KHIA 3FJ5A 5CAIA 3CC2T 4WF2A 2WSFE 3CCET 1KQ1A 2LP5A 1QWEA 1WZOA 2HEQA 1GFDA 2MYSA 1WIEA 3MHXA 1JQQA 1K0XA 5GMKm 1Q82R 5GAMg 3RDVA 1RAHB 2O01E 2FZCB 5LJ5e 1K8AC 4X1VA 4M78F 1OV3A 1ZUUA 1CKAA 2NUPA 4J9DA 1XTDA 2F2WA 1W4SA 4GY5A 3PTAA 4ANJA 1M8VA 2ZPIB 4NOYA 1X01A 2D1XA 3C94A 3KFVA 5A2QE 2K5FA 1W2BP 2M02A 2EGEA 3LGLA 1IHVA 1M3AA 1RAGB 1W2BS 5CR2A 4M78A 2A08A 3X28B 2OJ2A 2XICA 1OPLA 4M77C 2CSQA 4ZNXA 4D6WA 3DLMA 4M7DE 2LX9A 1VQ6A 2QTXA 4RUGA 1R0BG 4QVZA 2CP0A 4XU0A 2RM4A 4C0DC 2OAUA 2KVQG 1PG5B 2AZVA 3QDRB 1G8XA 1WXBA 4JDSA 3G71Q 1M90C 4IUQA 2EJ9A 1NJIC 2DK3A 3OYYA 2NYSA 1D09B 5IH2A 2DRKA 1OULA 1Q7YR 1Q95G 2QA4Q 5GMKh 2DYIA 5KCOA 3OBYA 3CXCA 4Z88A 3ME9A 2D0QB 2I2LA 4R56A 3ER0A 4IURA 2NLUA 2BZXA 4FYYB 1SG5A 3OYAA 4PJOF 1UJYA 2FL7A 2V8KA 3CCQA 2X3XD 2RHUA 4NL2A 4LDUA 3JCMQ 3CCJA 4TVRA 3G71T 2DPPB 1B07A 2JS0A 3BDLA 4M75B 5KYWA 1YITA 2LVMA 2X9HA 3LLRA 2ZPFB 5LJ3f 1OEBA 2QA4T 3CCUQ 5FU7C 1LVKA 4QVCA 1N5ZA 1YWOA 3VRYA 4DQ2A 2O31A 4FW2A 2GBQA 3VS4A 4XTXA 3CC7A 1Q81U 3EGXA 4PNOA 2JS2A 4B9XA 1UECA 1VIFA 2YRCA 8AT1B 5I11A 3M58A 4HCCA 1VQMQ 1VYTA 1U5SA 2E10A 2MI6A 3M4GA 4FM4B 4JJBA 2FVUA 3CCUT 1LNXA 1BIAA 2L2PA 4AFSC 5GMKe 3META 4MDXA 4LUDA 1PRLC 1ZX6A 4PJMA 1K73U 4MZPA 1GBRA 2YT6A 5D6WA 1G3TA 1WHMA 2K2MA 2EKOA 1WHHA 1PNJA 1AWJA 4EMGA 3T9NA 4J9CA 3C95A 5LJ5j 2DD4A 1VQMT 3OYNA 3JV3A 2DLPA 1ZA1B 1YJNQ 5FROA 1D3BA 4CC4B 2HL3A 1VUBA 3CPWS 1YJ9Q 1KHCA 3FJPA 1M90R 4ZGJB 1JEGA 2EFIA 1NJIR 4EMKA 2J7IA 2LJ0A 1M30A 3THKA 2ED1A 3TU4K 1AT1B 3FRNA 4C0ZA 4A4EA 1I5LA 2CZ0B 1VQPA 5LJ3g 3A8MB 3JB9J 3S6WA 2LCSA 3WVDB 4F7UG 1M2VB 3PVQA 3H0HA 2VVKA 1SEMA 1YJNT 4X9CA 3H8ZA 4YTLA 1LPLA 2AT1B 2ED0A 2H3JA 4C8QC 4KT0E 4CI0C 2QDYB 5A0LA 4M7DB 1YJ9T 2EQKA 4EMHA 1VQNQ 1KK7A 2X3WD 1WLPB 2R5MA 4PJOD 2X4XA 4M75D 1SRLA 1NZ9A 4LNPA 3L2RA 1QCFA 2RMOA 1WDXA 2A7YA 1YCYA 1BCMA 2J06A 3J80E 1FMKA 2JMAA 2LC4A 4C0FA 3I5RA 4JRPA 3I5SA 1QP3A 3L2ZA 1VQ5Q 3OQ5A 4J9GA 2L3QA 2YUNA 4XU2A 1YIJQ 1OU9A 1ZLMA 2ECZA 1VQNT 2YUQA 2KGTA 4OGEA 4M77F 2FPEA 2KT1A 4JLGA 1WXTA 1YI2Q 1MV3A 4C8QE 2PZ1A 1IB8A 2GQVA 4LE9A 2ROLA 2DILA 1UUEA 2AKKA 2F2VA 4C0DB 5GMKl 3UA6A 1LCKA 3CCSQ 3D7SB 1VQ5T 1VYUA 2RK1A 1YIJT 2P0PA 1YHQQ 3EH1A 2DXBA 2M51A 5IN1A 1OZ3A 4IIOA 1QVGS 4C92G 5GMKj 1RACB 3CCVT 2DTOA 1WJRA 3VUZA 1WQWA 1YI2T 3QWXX 1UFFA 1Q86U 4AT1B 4BE2A 2RA2A 2DIGA 2H8HA 3OYJA 3VS3A 5KYXA 2DL5A 2ZZDA 3OBWA 3PNWC 3FIFA 2YXYA 4BI8B 1K9AA 5GAMd 1VYVA 3M0QA 4OB3B 3CCST 2MMPA 1FX7A 5FRNA 2ZAEA 3R6OA 1WX6A 1K0SA 1YHQT 2DBKA 2EYYA 2P4TA 2YUOA 4OMPA 1E6GA 3LW5E 1PRMC 3CMEQ 2E1HA 1K9MC 2X4JA 4ZN1A 1SRMA 2RK2A 1H3ZA 4XQ3A 1PKSA 3RMQA 5GJVB 2EW3A 2P0KA 2V1RA 4WTOB 2CT4A 1VQKQ 1FWZA 2OTJA 2DEUA 1QKXA 4FSXA 2OX7A 4M7DD 1R0CB 2XIDA 1I8FA 1VQ7A 4EIKA 1TG0A 1X75C 5GAMe 1YJWA 4F04B 1RAIB 1GL5A 4CC7A 3R6NA 2QTVA 3CMET 3A8OB 2KI7A 5L23A 3MP6A 4EDUA 1PKTA 2CZ6B 4Y91A 6AT1B 2DNUA 1G2BA 4JRKA 2KYBA 9ATCB 3QG1A 5GAOq 2L3SA 3VV0A 4JJCA 1QWFA 2K5IA 4FW1A 3M55A 1S1NA 1UJ0A 1VQKT 1KIKA 4NL3A 3PIPA 3S3MA 1WNLA 4M7AC 4N4HA 2PVGB 3G4SA 2H3EB 1P92A 5GAN8 3OYKA 4LD9K 4IKFA 4IUUA 4DBFA 1KD1C 3QWYA 2LCLA 3GF5A 2HZYA 3MEWA 4J6XA 3CCVA 1BU1A 5I2MA 4OP0A 1NPRA 4KBMB 1QCNA 1RLQC 4OMFB 3E9GA 2CT3A 2DM1A 4M75C 2EYXA 2MIOA 1RAEB 1JU5C 1NBEB 2C0OA 2LX7A 1OQKA 4HCZA 1WJQA 1O75A 4RG8A 5FW9A 8ATCB 2VGNA 1QW1A 5KCHA 4Y28E 2K79A 4LXCA 2OTLA 1OX9A 1X43A 2ESWA 4C8QF 4M7AE 1B34A 3EHRA 5GANh 1X6OA 4C8QB 4RTZA 3EG1A 2EPDA 3MP8A 1TUCA 2EYWA 1ZHIA 2F2XA 4KGXB 3OS2A 1VQ6Q 3OA6A 2EWNA 5L8RE 3UWNA 1VOMA 5D6YA 3EG2A 4D8DA 4HVVA 1LOJA 2COZA 1S72A 4K11A 1K9MR 4M75E 3BFMA 1YP5A 2PNIA 5FU6B 3UDCA 4J83A 3WVEB 4M78G 2EYQA 1K4US 5HKCA 1QCOA 4P5NA 1M1KC 2HQEA 2O9VA 2P4RA 3MEAA 3VS2A 3ULRB 4A53A 4CRIA 1X27A 3OSSC 3PMTA 3JCMP 5FWCA 3NFCA 1VQ6T 4BUGA 2PTKA 3CPWA 4Z8AA 3C12A 1M5Q1 3CCQQ 3PMIA 3CCJQ 3CD6A 4RTYA 3C4SA 3GBQA 3M59A 2F1LA 3A1PA 1YITQ 3SWNA 4N0AC 2CKKA 2V1QA 4C0GA 2JTMA 2DTIA 2IVWA 4HCBA 3JCMc 1VQOA 4LDVA 1BK2A 5AYFA 5LJ5d 5GAN2 4CC3A 2GF7A 2LNHB 2M9UA 1NEGA 3CC7Q 2Z0WA 2BTTA 1PHTA 2CS7A 4RTVA 4BE1A 4RTXA 5KYUB 1ZSZC 2W0ZA 3HKSA 1KD1R 4FYVB 3CCJT 2YHTA 4Q5WA 3UF4A 1Y57A 1YITT 1IZ6A 4C5IA 1MMGA 1AZGB 1NLOC 1U1TA 1D0YA 2COYA 1G83A 2K57A 3OYHA 4J5YA 2QYZA 4JZ4A 2HD0A 5LJ3e 5HCKA 3CC7T 3QZ9B 4HCKA 1AHJB 3HP9A 2DZ9A 4J9IA 1VQLA 3UA7A 1RAAB 1GFCA 1T3SA 3GNGA 1KQSP 1AOJA 2FHDA 4E47A 1KQSS 3BE3A 2NUPB 2J05A 2LMJA 2M0YA 2G6FX 1KC8U 2PU9B 1M1GA 1N8RC 2RI5A 3FDRA 1ZBJA 5CKEA 1H3HA 2AKLA 3RKXA 5M9OA 2RQUA 5IHIA 4C8QD 2VB6A 4DEYA 1N27A 2QASA 4ZTJA 2V26A 1SPKA 1UGSB 2F5TX 3MCAB 3F70A 2FYKA 1AVZC 4D8KA 1IHWA 1RUWA 4O6JA 2J6KA 2QG9B 4IIMA 2JZ2A 1UGQB 3RKYA 1C6VX 1VQPQ 1QVGA 2LTOA 2YDLA 2DEQA 3EG9A 1M1KR 4ZGEB 2LRQA 1WHKA 1JJ2P 4M7AF 5D7UA 1Y96B 3TCJA 2M1HA 1E6HA 2JN0A 1BI1A 5GANf 1DJ7B 2K7AA 4M7AB 5HK0A 1UGRB 4OMMA 1YBYA 3JCMW 3H9NA 1KD1U 3VJPA 5GAN5 1T3LA 2W10A 1BCOA 2L5QA 2MF2A 4M75F 1AZEA 2FB7A 4QQ6A 2KR3A 3UT1A 4Z02A 2E65A 1VQPT 3E9FA 1Q82U 2A0FB 3M0PA 3J81E 5KYWB 2YUPA 1VQ9A 1M2OA 2L8DA 2RHYA 4PJOA 4QVDA 3M0SA 2DL3A 1XQHA 3DB3A 4KH0B 2R57A 1Y07A 4J9EA 2MAMA 3OW2P 1OZ2A 2KXDA 4BI4A 5J39A 1NE8A 3ASKA 3OW2S 1KJWA 2DO3A 4XTYA 2DA9A 2DVJA 2DYBA 3J7AF 1RAFB 5GANj 1D0ZA 1ZUKA 2RQWA 2FZGB 2DL8A 4L59A 4HKEA 3JB9I 1GCQC 3RBBB 4JPBW 2NUTA 1HYOA 4FSSA 1V1CA 4BE0A 4F7UE 3JB9D 1K8AR 1TXQA 4BD3A 1MNDA 4E7HA 5GAN4 5GAOr 2RF0A 1Q7YU 1FYNA 2RQVA 1I0CA 1N8RR 1K76A 3AT1B 2L89A 5LJ3j 3HRUA 2QI2A 1E7OA 1RI0A 5C0MA 1JB0E 3CEYA 2WSCE 3P8DA 5GANg 1C0MA 3GIBA 1GXIE 2DJZA 4M77G 4XTZA 2J6FA 2CREA 4PJNA 4AFZC 2DMOA 1EX4A 1I07A 1PD0A 3CC4A 3GP8A 5FLXE 4C92C 2XKOC 3TVTA 1QVPA 1B7TA 2KBTA 4PFZA 3RIRA 1D1BA 3EFOA 4EMKB 3EGDB 3MPUB 1BI3A 4BB7A 3LX7A
chains in the Genus database with same CATH topology
2QXFA 2E1HA 1K9MC 2LNVA 3M57A 3QYGB 2X4JA 3VKIA 4ZN1A 3V8JA 2RK2A 1H3ZA 4DA4A 3X25B 4XQ3A 2Y90A 4IUTA 3JCMb 2X35A 3CMEA 3RMQA 3JCMX 3JCMd 3CC4T 3AHUA 4M7AD 2P0KA 1VQ4A 5IT9E 3NTHA 1G5VA 1Y96A 3UPUA 3X24B 3QO3A 5LJ3h 4M7DF 4N4IA 2ZPGB 2DD5A 3JRZA 4M7AA 1Q7YC 2EQMA 3A8LB 5GAN7 1EIFA 3JCMf 2XD0A 1XOVA 1FWZA 2QQAA 5LJ5h 2OTJA 2CGHA 4FSXA 4EPCA 2JNGA 2EIFA 4QW2A 4M7DD 2XIDA 1I8FA 1VQKA 2LDMA 3EAEA 1VQ7A 2QQRA 1X75C 3VU3C 4C5EA 2LT1A 3JSCA 3BDUA 3OS5A 5GAMe 2K2VA 5GMKi 3OYEA 1YJWA 2HNIA 1K8AU 1ZQ1A 2XG8D 4M7DA 3CMET 1Q86C 3A8OB 3M5AA 4C92E 2XDDA 3OYCA 4M7AG 4JRQA 1VQ4T 2EJFA 2XI9A 3MP6A 3QZ5B 4JRIA 5FU6C 1VIEA 4EDUA 3QUIA 4M75A 2CZ6B 2O4XA 4PJOB 4E7JA 4M77E 4Y91A 2RHXA 2MWPA 2EAYA 2K5LA 2MWOA 2GFAA 4O5VA 3PGGA 4JRKA 5DLQE 3VUBA 1I5LA 1QVFS 2OTJT 3QG1A 3PFSA 5GAOq 4B9WA 3VV0A 5GAMj 2K5IA 3A8GB 4PL6A 3CC2A 2WSEE 3M55A 3JCMe 1VQKT 4M7DG 4NL3A 1VQ7T 4OB1B 3PIPA 2DXCA 3S3MA 4HT8A 3CCEA 1WNLA 4JUVA 3NTIA 1YJWT 4M7AC 4N4HA 2PVGB 2K4YA 5LJ5f 3G4SA 2DIQA 4M75G 4A4GA 3A5ZB 3QSUA 1P92A 2QQBA 3ZBDA 5GAN8 3OYKA 4LD9K 3S3NA 4DOVA 3GOXA 3QHSA 4IUUA 4IKFA 2LQKA 2E64A 2D9TA 3CCQT 1UGPB 4JS4A 1KD1C 2LCCA 3A8HB 2LCLA 2RB6A 2ZGWA 2ZPBB 3GF5A 2HBPA 3MEWA 4J6XA 5CKBA 3CCVA 4E7IA 5I2MA 3L42A 1QVFA 2CZ1B 4OP0A 2VYTA 1NPRA 4M7DC 3OYFA 4LD6A 5I21A 4KBMB 1TH7A 2DAQA 4KUIA 1M90U 3OYDA 3GLXA 1KHIA 3GNFB 4OMFB 2XDPA 5CAIA 2DXUA 3SD4A 4BDYA 1NJIU 3CC2T 4WF2A 2WSFE 3E9GA 4M75C 3P8HA 4J6WA 4M77A 4OGCA 1M1KU 1IREB 1LJOA 1WQ7A 3RMSA 3CCET 4OB2B 1KQ1A 3X26B 2R58A 3LW5E 3G4ST 2HQXA 3E1SA 2EQUA 3MHXA 5GMKm 2BUDA 5GAMg 2JOYA 2YLBA 2O01E 4HCZA 5KE2A 1WJQA 5LJ5e 2E6NA 1I4K1 5D6XA 1O75A 1K8AC 4M78F 4RG8A 2Y4YA 2V8JA 1OYXA 3HFNA 4X9DA 1XTDA 1W4SA 1N9SA 2VGNA 4GY5A 1QW1A 3PTAA 5KCHA 2YRVA 4FL6A 4Y28E 4J7FA 1U8RA 4XTUA 2OTLA 4MZMA 2KQWA 3CPFA 1Y7XA 5CKHA 3OYGA 4C8QF 1M8VA 2ZPIB 3GPLA 4NOYA 4M7AE 1B34A 1X01A 3C94A 4M78D 1D3BB 4MZTA 3FB9A 5A2QE 2K5FA 2ZPHB 3M9QA 5GANh 1X6OA 4C8QB 3LGLA 2A3LA 3MP8A 5DY9A 1BYMA 2DVEA 3OMGA 1W2BS 3JCMg 2BKDN 5CR2A 4M78A 1ZHIA 3OS2A 4F7UB 1JBMA 3V8KA 3OA6A 2EWNA 3X28B 3DLLA 5L8RE 2XICA 3UWNA 4M77C 2VV5A 3HRSA 3MP1A 4UC4A 5D6YA 4D6WA 3DLMA 4M7DE 1LOJA 2LX9A 4A54A 4RMOA 2QTXA 1VQ6A 2GFUA 3M54A 4ZN3A 1S72A 2RHIA 2PVDB 4N0AA 4XU3A 4MDWA 4A4KA 2QEXA 4QVZA 3V7SA 4XU0A 4M75E 2OTLT 3OYLA 3BFMA 2RM4A 4C0DC 2OAUA 2KVQG 4FT2A 5CO7A 5FU6B 3UDCA 3QDRB 4J83A 3WVEB 4M78G 3P8BB 4JDSA 2EYQA 3WXMB 4IUQA 1M90C 2EJ9A 3LWIA 3MO8A 1NJIC 2DK3A 3HHTB 5HKCA 1W2BA 2B8AA 3OYYA 4P5NA 1UEBA 1M1KC 4BY6C 3OYMA 4MMKA 3QYHB 3RUXA 3G71A 4PKCC 2HQEA 2G3RA 4QQGA 3FEOA 4CRIA 3MEAA 4A53A 2XDBA 4PLLA 5GMKh 1G3SA 3LWHA 3OSSC 3PMTA 3LGFA 3CBMA 3JCMP 3NFCA 5KCOA 1VQ6T 4BUGA 3OBYA 3CXCA 1S72T 3BY7A 3ME9A 5LJ5g 3HFOA 2QEXT 3S3OA 2QA4A 2D0QB 3CPWA 2I2LA 2X4WA 2LT4A 3C12A 1M5Q1 4R56A 3ER0A 4IURA 2NLUA 3PMIA 2E6ZA 5A0DA 3CD6A 2VXEA 3C4SA 4OVAA 3OYAA 1M1FA 3M59A 1MGQA 4PJOF 3ZFJA 1BKBA 5LL6S 4HT9A 2FL7A 3SWNA 3H6ZA 4N0AC 2V8KA 1NPPA 3CCQA 4JJNK 2RHUA 2CKKA 4IUPA 4NL2A 4LDUA 3JCMQ 3KXTA 3CCJA 4TVRA 4C0GA 3G71T 2JTMA 2DPPB 2DTIA 2IVWA 1N8RU 4HCBA 3BDLA 2DZCA 4M75B 1YITA 2VXFA 1PSFA 2LVMA 3JCMc 1VQOA 4LDVA 3RESA 5AYFA 5LJ5d 3LLRA 5GAN2 2GF7A 3KUFA 2M9UA 1PSEA 2RHZA 2ZPFB 4II1A 5LJ3f 1BIBA 2QA4T 3LH0A 3PIOA 5FU7C 4QVCA 4DQ2A 4A4FA 3JAME 4FT4A 4ZGDB 4E7KA 2D6FA 2CS7A 3CD6T 4BE1A 4XTXA 3CC7A 3HKSA 2JVVA 3MEVA 3CCUA 4XTWA 1OI1A 5IAYA 3RKWA 1Q81U 1RL2A 4PNOA 5CKFA 3ZEHA 4ELZC 4HA8A 3CCJT 4LDYA 4B9XA 2YHTA 3OS1A 4Q5WA 2P0QA 1VIFA 1YITT 4LDXA 1IZ6A 2E5QA 3VYHB 4C92F 4C5IA 1VQOT 1SSFA 4M78E 5GAOn 3SWNC 4KUDK 1U1TA 2KAFA 3M58A 3M4YA 3QKJA 4C92B 2VUBA 4QQDA 5KE3A 2K57A 4HCCA 3JCMV 4A4HA 3OYHA 1VQ8A 2E10A 2MI6A 4BACA 4J5YA 4M77B 3M4GA 2HD0A 3DKMA 5LJ3e 4FM4B 2FVUA 5A0GA 3CC7T 3QZ9B 3OS0A 1LNXA 1AHJB 1BIAA 4RCCA 3CCUT 3HP9A 2DZ9A 3L1AA 3NTKA 4N4GA 1VQMA 1KQ2A 1VQLA 5GMKe 3META 1WJSA 3GNGA 4MDXA 2WACA 2DKGA 2FHDA 2ZPEB 4E47A 3OY9A 1KQSS 3EFSA 2GCXA 5EG2A 1KG1A 1K73U 2C06A 4MZPA 1KC8U 3M56A 2PU9B 4ME7A 5GAMh 1M1GA 4JS5A 5D6WA 1WPYA 2RO0A 2E12A 3OSVA 1N8RC 1G3TA 2RI5A 2EKOA 2QQSA 4LDWA 1VQ8T 2Y4XA 2JUFA 3FDRA 1B34B 4F7UF 4PLIA 5CKEA 4EMGA 3T9NA 3C95A 1UB4A 3BW1A 4XU1A 3RKXA 5LJ5j 1BI2A 5M9OA 1FXXA 2DD4A 4C8QD 3OYNA 1VQMT 1VQLT 4MMLA 2M16A 1N27A 2XHCA 4ZTJA 4L5GA 1UGSB 5FROA 1D3BA 1WGSA 1KQSA 2F5TX 3CCRA 2RD1A 3MCAB 4C8QA 5GAN6 3CXCS 3F70A 3OB9A 1Q81C 2K3XA 3JCMh 1M4ZA 1VUBA 2FYKA 3MEUA 5CVIA 3KBGA 3CPWS 1YJNA 3CBPA 4O6JA 4F7UA 3V7RA 1N6AA 4C5GA 3CMAA 1KHCA 3RERA 1U1SA 2JZ2A 1UGQB 3FJPA 4FU6A 4ZGJB 3RKYA 2EFIA 3SFMA 2KMTA 4EMKA 1QVGA 2LTOA 4KULA 3URGA 2DEQA 1YJ9A 4ZGEB 2LRQA 4M7AF 4BI3A 1N9RA 1Y96B 3FRNA 5CIUA 3TCJA 2M1HA 4C0ZA 4A4EA 4C8QG 4L6V5 2CZ0B 2JN0A 3V7CA 5FU7B 3A8MB 1BI1A 5LJ3g 1VQPA 5GANf 1DJ7B 4M7AB 3S6WA 5HK0A 3JB9J 2HAXA 2RI3A 3CCRT 2BIVA 1UGRB 2LQ8A 3WVDB 1YBYA 4F7UG 3L2WA 3G6EA 4E7LA 3JCMW 1KD1U 3VJPA 4M78C 1Y71A 4OF1A 4J8OA 2KSSA 2EJGA 5CQXA 1YJNT 3PT9A 2VC8A 5HK3A 5GAN5 4X9CA 1HK9A 3H8ZA 2X4YA 4YTLA 3CMAT 4XTVA 5CK9A 2RI2A 1K73C 2H3JA 1KC8C 4XAXB 4C8QC 4KT0E 4CI0C 2L5QA 2QDYB 2IG0A 1V29B 5A0LA 4M7DB 1YJ9T 2EQKA 2MF2A 4M75F 5J26A 4EMHA 2FB7A 2YLCA 5LJ3d 3SWNB 3O8VA 4QQ6A 1JJ2A 3UT1A 2KK4A 4Z02A 2O4XB 5I2SA 2E65A 1VQPT 2R5MA 3E9FA 3QBYA 3N5BB 5CCAA 1JRIA 5GAOl 4PJOD 3QIIA 2X4XA 3CBOA 1Q82U 3M53A 2CZ7B 3G7ZA 2DXTA 2F69A 3G6ET 3J81E 3L2VA 1VQNA 4EMKC 3CCLA 1VQ9A 1XNIA 4M75D 2L8DA 1NZ9A 2RHYA 3L2RA 1JJ2S 5KH6A 3Q1JA 5GANe 4PJOA 1G3YA 1YCYA 2A7YA 3J80E 3E19A 4QVDA 2LC4A 1HXDA 4C0FA 1XQHA 3DB3A 1QP2A 2RJFA 4RG2A 2E70A 2XK0A 5J3BA 1QP3A 2R57A 4JRPA 1Y07A 2MAMA 3L2ZA 3V8LA 3OQ5A 1OZ2A 3QJYA 4XU2A 4BI4A 4OB0B 1NE8A 3ASKA 5J39A 3OW2S 2DO3A 4XTYA 5CQYA 3DB4A 3I55A 3FC3A 1VQ5A 4PJOG 2M0OA 2ZCFB 1O9SA 2QQ9A 3HL8A 3HRTA 3I56A 5GANj 4OGEA 3CCLT 1VQNT 1VQ9T 3J7AF 2L3RA 5DLOA 2R5AA 4VUBA 1YIJA 2XU8A 4M77F 3JB9F 4JLGA 2JTFA 4L59A 4HKEA 2PQWA 3JB9I 4C92D 4C8QE 1K9MU 3QPHA 4V2SA 2CYZB 2PUKB 2GQVA 2V8IA 4BE0A 1MHNA 4M77D 4F7UE 3JB9D 1YI2A 4C92A 3HSBA 4BD3A 5GAOp 5GAOm 4J6YA 4PJOC 5HY6A 1I81A 3OMCA 4C0DB 5GMKl 1H641 3OW2A 4R55A 2EQJA 5CKDA 3EFRA 4BDZA 3I55T 1VQ5T 2KDSA 4NS5A 3TREA 4DOWA 3OYBA 4E7HA 5GAN4 5GAOr 3LYIA 2RK1A 3I56T 2KY9A 1Q7YU 1G3WA 3JB9H 1YIJT 4IUVA 4BY6B 2P0PA 2L89A 3INZA 5C6SA 5LJ3j 3HRUA 3CCSA 1Q82C 2DXBA 2QI2A 4X34A 2VGMA 1RI0A 5IN1A 5C0MA 1OZ3A 1JB0E 3CEYA 1QVGS 2AHJB 2WSCE 4C92G 5GMKj 3P8DA 1M9SA 3X20B 5GANg 3CCVT 3CCMA 2DTOA 1YHQA 3GIBA 1WJRA 3VUZA 3JCMJ 1GXIE 1WQWA 1YI2T 4M78B 2DJZA 4M77G 3JB9G 2RH2A 4XTZA 1Q86U 4J7IA 4BE2A 2RA2A 2DIGA 3OYJA 2F5KA 4FIBA 3OYIA 3L2QA 4XK8E 3SB2A 3TEEA 3QJ6A 2E41A 4ATOA 1BI0A 2ZZDA 3OBWA 3FIFA 3PNWC 3CC4A 4BI8B 4GLKA 3GP8A 3VYGA 2RJCA 4RKUE 2K3YA 2RJEA 5FLXE 4C5HA 4C92C 5GAMd 4JLIA 5GAN3 2XKOC 2PUOB 2DTHA 1QVPA 2MMPA 4OB3B 1FX7A 4ELYC 5DM7R 3CCST 3TU4K 5FRNA 3R6OA 3SDZA 5GANd 1R8OB 3FLGA 3QXEB 3RIRA 1ZBXA 2RJDA 4ZTFA 5GAMf 3CCMT 1YHQT 4EMKB 2P4TA 3HPWA 5FRMA 4PJOE 4RCBA 1BI3A 3L2UA 4BB7A 3LX7A 2PVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  5HK0 A;  5CQY A;  5CKD A;  3G7Z A;  4MZM A;  2C06 A;  1VUB A;  4MZP A;  5CKH A;  1X75 C;  4ME7 A;  3JSC A;  4OF1 A;  4MZT A;  2VUB A;  5DLO A;  5CO7 A;  5CQX A;  4VUB A;  5HK3 A;  4HKE A;  5CK9 A;  1M1F A;  5HKC A;  5CKE A;  4ELY C;  5CR2 A;  2KMT A;  1UB4 A;  3JRZ A;  5CKB A;  5CKF A;  4ELZ C;  2MF2 A;  3VUB A;  3TCJ A;  4MDX A;  3HPW A;  1NE8 A;  3NFC A; 
#chains in the Genus database with same CATH topology
 2QXF A;  4FYX B;  4KGV B;  3VKI A;  3V8J A;  3MKD A;  1ZSZ B;  2KRM A;  2Y90 A;  4M7A D;  2X35 A;  3AHU A;  3JCM X;  2OTJ Q;  4M7D F;  4N4I A;  3SHW A;  2DET A;  2EQM A;  3A8L B;  5GAN 7;  1EIF A;  2XD0 A;  1XOV A;  1VQ7 Q;  1BBZ A;  1YJW Q;  4EPC A;  1WHG A;  1M27 C;  4QW2 A;  2IIM A;  1YNZ A;  2SRC A;  1F1B B;  2LDM A;  1TU0 B;  5GMK i;  3BDU A;  1PM3 A;  2DJQ A;  1K8A U;  4M7D A;  4C92 E;  2XDD A;  1ARK A;  2SEM A;  2XI9 A;  5GAO m;  5FU6 C;  5EC7 A;  2RHX A;  1QVF P;  2MWO A;  2GFA A;  4O5V A;  3VUB A;  2OTJ T;  1QVF S;  3NGP A;  3PFS A;  4B9W A;  3G4S Q;  3A8G B;  2WSE E;  1VQ7 T;  4OB1 B;  2DXC A;  1OOT A;  4HT8 A;  1YJW T;  1ZA2 B;  4AG1 C;  4A4G A;  3CCV Q;  3QSU A;  4DOV A;  1UGV A;  2E64 A;  2DE0 X;  2LCC A;  2RB6 A;  4PJL A;  2VKN A;  2K6D A;  2GNC A;  1FMV A;  2VYT A;  3OYF A;  2CP5 A;  5I21 A;  1M90 U;  3OYD A;  3GLX A;  3GNF B;  1NJI U;  1VA7 A;  3SD4 A;  1JXM A;  3H0F A;  4OGC A;  4M77 A;  1IRE B;  2KRS A;  4OB2 B;  3X26 B;  2R58 A;  5FWB A;  3G4S T;  2HQX A;  2EQU A;  3TSW A;  2OI3 A;  1AWW A;  2BUD A;  3A98 A;  2YLB A;  2YWW A;  5D6X A;  2DRM A;  2OTL Q;  2Y4Y A;  2V8J A;  3HFN A;  4X9D A;  2QGG A;  1N9S A;  1EFN A;  4FL6 A;  4J7F A;  4XTU A;  2E5K A;  1PD1 A;  4MZM A;  5CKH A;  1Y7X A;  1QLY A;  3GPL A;  4MZT A;  3FB9 A;  2ZPH B;  2A3L A;  5DY9 A;  5KYX B;  2BKD N;  4F7U B;  1JBM A;  1S72 Q;  1IGQ A;  2EGC A;  2VV5 A;  3IQL A;  3MP1 A;  4UC4 A;  3CXC P;  4LUE A;  4RMO A;  2GFU A;  2RQR A;  3M54 A;  1HSQ A;  2RHI A;  2PVD B;  4XU3 A;  4A4K A;  2QEX A;  2OTL T;  3OYL A;  3TQ7 P;  3EH2 A;  1JXO A;  4RTU A;  3LWI A;  3MO8 A;  1W2B A;  3VS1 A;  5KYY A;  3OYM A;  4MMK A;  3QYH B;  2G3R A;  4QQG A;  3FEO A;  1KFZ A;  1YFN A;  4PLL A;  2QAZ A;  3RR6 A;  1IXD A;  3LWH A;  3CBM A;  1S72 T;  1TWB A;  3CD6 Q;  4CC2 A;  2BE9 B;  2NWM A;  2X4W A;  2LT4 A;  2JW4 A;  2KRO A;  4OMN A;  4Z89 A;  5A0D A;  2VXE A;  4OVA A;  1M3C A;  1RAD B;  3ZFJ A;  1EZZ B;  5LL6 S;  2FRW A;  4HT9 A;  3H6Z A;  1NPP A;  1VQO Q;  4IUP A;  3KXT A;  2VXF A;  3HTR A;  3RES A;  3KUF A;  2HKN A;  4II1 A;  1D0X A;  1BIB A;  3LH0 A;  2COW A;  4HVU A;  1NG2 A;  1SSH A;  3JAM E;  1ZUY A;  4FT4 A;  4ZGD B;  3CD6 T;  3VS0 A;  4XTW A;  3RKW A;  1I5O B;  3OS1 A;  2P0Q A;  4LDX A;  2E5Q A;  1T0H A;  1JO8 A;  3VYH B;  4C92 F;  4DBQ A;  1VQO T;  4M78 E;  5GAO n;  4KUD K;  3M4Y A;  4C92 B;  3QKJ A;  2NUZ A;  2DER A;  2VUB A;  1X6G A;  4QQD A;  5KE3 A;  1VQ8 A;  4A4H A;  1VQL Q;  4BAC A;  1WYX A;  4ESR A;  3NTK A;  2A37 A;  1TUG B;  2ABL A;  1WJS A;  2K9G A;  2ZPE B;  3OY9 A;  1KG1 A;  3M56 A;  4ME7 A;  1WPY A;  1M8M A;  2QQS A;  2IPO B;  2JUF A;  4QKU A;  1ABQ A;  1B34 B;  3BW1 A;  1BI2 A;  1X2K A;  1VQL T;  2M16 A;  1AEY A;  2HKQ B;  2XHC A;  1X6B A;  4F14 A;  3CCR A;  4C8Q A;  1Q81 C;  3OB9 A;  3JCM h;  1M4Z A;  5CVI A;  3MEU A;  3KBG A;  2CDT A;  1AWX A;  1MMN A;  3V7R A;  1GCP A;  1N6A A;  3CMA A;  2O2O A;  4FU6 A;  2LZ6 B;  2KMT A;  2CP7 A;  1K1Z A;  4KUL A;  1D1A A;  2LQN A;  2O88 A;  2OAW A;  4BI3 A;  1N9R A;  5CIU A;  4L6V 5;  3V7C A;  2RI3 A;  2LQ8 A;  3L2W A;  3G6E A;  1Y71 A;  1Z9Q A;  4J8O A;  2KSS A;  5CQX A;  2VC8 A;  5HK3 A;  2KYM A;  2HBW A;  2X4Y A;  5CK9 A;  2E3I A;  2RI2 A;  1K73 C;  3CQT A;  4XAX B;  2IG0 A;  1V29 B;  5LJ3 d;  3SWN B;  1VQ9 Q;  1YN8 A;  5I2S A;  2YSQ A;  2O4X B;  3QBY A;  5GAO l;  1JRI A;  5IHK A;  3CBO A;  3M53 A;  4GBQ A;  2DXT A;  2F69 A;  3L2V A;  4EMK C;  4DBH A;  3CCL A;  1XNI A;  5GAN e;  2QGF B;  3E19 A;  1SHG A;  2KT8 A;  1HXD A;  1NYF A;  2RJF A;  2E70 A;  5J3B A;  3I35 A;  2DF6 A;  2VAS A;  2HSE B;  2CUB A;  4KGZ B;  3DB4 A;  3I55 A;  3FC3 A;  4PJO G;  4JJD A;  2M0O A;  3PE0 A;  3HL8 A;  4R0K A;  3VS5 A;  3I56 A;  1G5V A;  1VQ9 T;  4J9H A;  4VUB A;  3JB9 F;  4E7Z A;  1T0J A;  2P84 A;  2PQW A;  2BZY A;  4C92 D;  2RPN A;  1K9M U;  2EBP A;  3QPH A;  2CYZ B;  2PUK B;  2MK5 A;  3SEM A;  1MHN A;  2JM8 A;  1TSF A;  3HSB A;  5GAO p;  4J6Y A;  1I81 A;  1H64 1;  1RLP C;  5CKD A;  3EFR A;  4AMC A;  4BDZ A;  4NS5 A;  3OYB A;  2KY9 A;  1G3W A;  3JB9 H;  4B6M A;  2RN8 A;  4X34 A;  3H0I A;  1M9S A;  1HD3 A;  3CCM A;  2XMF A;  2FRY A;  4M78 B;  4GLM A;  1YWP A;  2RH2 A;  3CC4 Q;  2FO0 A;  4J7I A;  2JTE A;  2A28 A;  1Q81 R;  4FIB A;  2MPX C;  3L2Q A;  4XK8 E;  3SB2 A;  3QJ6 A;  4ATO A;  1BI0 A;  4GLK A;  3VYG A;  2RJC A;  4RKU E;  2RJE A;  2HMA A;  5GAN 3;  2DTH A;  4ELY C;  1U3O A;  1WXU A;  3QXE B;  4OMO A;  4ZTF A;  5FRM A;  3HPW A;  4RCB A;  2YRD A;  3L2U A;  3EG9 B;  1JJ2 S;  2J6O A;  4LN2 A;  3ZL7 C;  3X25 B;  3TSZ A;  4IUT A;  3CC4 T;  1VQ4 A;  5IT9 E;  2DBM A;  1Y96 A;  2E3H A;  3X24 B;  3UPU A;  4ORZ A;  3VS6 A;  2GTO A;  1K73 R;  1BB9 A;  3JRZ A;  4M7A A;  2RQT A;  3JCM f;  4DBR A;  3RNJ A;  2CGH A;  1AWO A;  2JXB A;  2JNG A;  2AIR B;  2EIF A;  4PJJ A;  4E6R A;  4AFU C;  4PFO A;  3VU3 C;  2LT1 A;  3OS5 A;  3OYE A;  1WHJ A;  1UG1 A;  2EYZ A;  2K2V A;  1ZQ1 A;  2XG8 D;  1Q86 C;  4JRQ A;  2B86 A;  2EJF A;  4JRI A;  1VIE A;  4PJO B;  4M75 A;  1J3T A;  4M77 E;  3UAT A;  2EAY A;  2K5L A;  2FZK B;  4E7S A;  3REB B;  2BZ8 A;  3EGX B;  4M4Z A;  3CC2 A;  1UHC A;  2CH4 W;  4M7D G;  3CCE A;  4JUV A;  3NTI A;  5LJ5 f;  1MMA A;  2DIQ A;  3A5Z B;  2QQB A;  3ZBD A;  3S3N A;  3QHS A;  2LQK A;  2D9T A;  2D8J A;  2EVR A;  3A8H B;  2ZPB B;  2ZGW A;  1TUD A;  2HBP A;  2ENM A;  4RTW A;  1W70 A;  4E7I A;  4HVW A;  2NUT B;  4LD6 A;  2XDP A;  2DXU A;  5IHN A;  1M1K U;  3P8H A;  4J6W A;  1LJO A;  1WQ7 A;  3RMS A;  4JZ3 A;  2C0T A;  3E1S A;  2FG0 A;  1I1J A;  2JOY A;  5KE2 A;  1SF9 A;  2E6N A;  1I4K 1;  1OYX A;  2YRV A;  2KXC A;  3C0C A;  1U8R A;  2LJ3 A;  2KQW A;  3CPF A;  3OYG A;  4RTT A;  4M78 D;  1D3B B;  3U23 A;  3M9Q A;  1QKW A;  4J9F A;  2JT4 A;  3M0U A;  1BYM A;  2DVE A;  3OMG A;  3JCM g;  3I9Q A;  3V8K A;  3DLL A;  2C0I A;  2QEX Q;  2KNB B;  3HRS A;  2MCN A;  4AG2 C;  4A54 A;  4ZN3 A;  4N0A A;  4MDW A;  1YCS B;  3CPW P;  3EFO B;  3V7S A;  3VS7 A;  1V76 A;  2D8H A;  4FT2 A;  5CO7 A;  3P8B B;  3WXM B;  2A36 A;  3HHT B;  2B8A A;  3EGD A;  1UEB A;  4BY6 C;  4PFP A;  3RUX A;  3G71 A;  2HQH A;  4PKC C;  2DL7 A;  2FPF A;  2L0A A;  2XDB A;  1M2V A;  1G3S A;  1ZSZ A;  2GTJ A;  3LGF A;  3BY7 A;  2EKH A;  5LJ5 g;  3HFO A;  2QEX T;  3S3O A;  2QA4 A;  4F16 A;  4KRT A;  2KEA A;  2E6Z A;  1M1F A;  1Q86 R;  1MGQ A;  1BKB A;  4JJN K;  2DFU A;  2JMC A;  1H8K A;  1PCX A;  1U06 A;  1N8R U;  2DZC A;  3MJX A;  1PSF A;  1IO6 A;  1A0N B;  2CUD A;  2CP6 A;  2L3P A;  1PSE A;  2RHZ A;  1WI7 A;  3PIO A;  2LQW A;  4A4F A;  4E7K A;  2D6F A;  5IXB A;  3MEV A;  2JVV A;  3CCU A;  1OI1 A;  5IAY A;  2DL4 A;  2JJ9 A;  1RL2 A;  5CKF A;  3ZEH A;  4ELZ C;  4HA8 A;  4LDY A;  2KE9 A;  1OU8 A;  1VQ8 Q;  2CP2 A;  1SSF A;  2E4H A;  3SWN C;  2KAF A;  2QK0 A;  3JCM V;  4J9B A;  4M77 B;  1TS9 A;  1W1F A;  1WFW A;  3DKM A;  3EGU A;  5A0G A;  3PVL A;  3OS0 A;  4RCC A;  3L1A A;  4N4G A;  1VQM A;  1KQ2 A;  2KRN A;  1OX8 A;  1TTH B;  1NEB A;  1X2Q A;  2WAC A;  2DKG A;  3EFS A;  2GCX A;  2CH4 A;  5EG2 A;  3E2U A;  2C06 A;  5GAM h;  3G1J A;  7AT1 B;  1M3B A;  4JS5 A;  2RO0 A;  2E12 A;  3OSV A;  4LDW A;  1VQ8 T;  1IGU A;  2Y4X A;  4F7U F;  1QVG P;  1CKB A;  4PLI A;  3M0R A;  1RI9 A;  1UB4 A;  4XU1 A;  3CCR Q;  4HXJ A;  1FXX A;  4MML A;  2X51 A;  4L5G A;  1WGS A;  1KQS A;  2RD1 A;  3NPF A;  3CXC S;  5GAN 6;  3CMA Q;  2K3X A;  1QMC A;  1D1C A;  1YJN A;  3CBP A;  4F7U A;  2K3B A;  2RNA A;  4C5G A;  3RER A;  3O5Z A;  1U1S A;  2EGA A;  1ACM B;  3SFM A;  2JM9 A;  1YJ9 A;  3G6E Q;  4C8Q G;  5KYY B;  5FU7 B;  4WCI A;  2HAX A;  5IXF A;  3CCR T;  2BIV A;  4E7L A;  4M78 C;  4OF1 A;  2EJG A;  1Y0M A;  3PT9 A;  1HK9 A;  3CMA T;  4XTV A;  1WA7 A;  2MOX A;  1KC8 C;  1FMW A;  5J26 A;  1MUZ A;  1OPK A;  2YLC A;  3CCL Q;  3O8V A;  1JJ2 A;  2KK4 A;  1GCQ A;  5CCA A;  3N5B B;  3QII A;  1XJW B;  2CZ7 B;  3G7Z A;  3G6E T;  1VQN A;  4KH1 B;  4A63 B;  5KH6 A;  3Q1J A;  1G3Y A;  1NLP C;  3NHN A;  1QP2 A;  4RG2 A;  2XK0 A;  3I55 Q;  3V8L A;  3I56 Q;  3QJY A;  4OB0 B;  5AT1 B;  4OML A;  2AK5 A;  1B3Q A;  5CQY A;  1VQ5 A;  2ZCF B;  1O9S A;  2GGR A;  1PWT A;  2QQ9 A;  3HRT A;  3CCL T;  2HL5 C;  2L3R A;  5DLO A;  2R5A A;  4PK4 A;  1YIJ A;  2XU8 A;  2JTF A;  2DX1 A;  3EHQ A;  2I0N A;  1GRI A;  1UDL A;  2CP3 A;  1TOV A;  4V2S A;  1R77 A;  2V8I A;  4M77 D;  1YI2 A;  3VRZ A;  4C92 A;  2FEI A;  4PJO C;  5HY6 A;  3OW2 A;  3OMC A;  4R55 A;  2EQJ A;  2HCK A;  3I55 T;  2KDS A;  3TRE A;  4DOW A;  3LH5 A;  3LYI A;  1IRX A;  3M0T A;  3I56 T;  1NYG A;  1WHL A;  4IUV A;  4BY6 B;  3INZ A;  5C6S A;  3CCM Q;  1Q82 C;  3CCS A;  2VGM A;  2AHJ B;  3X20 B;  1UTI A;  1YHQ A;  2D0N A;  4OMQ A;  1W6X A;  2HDA A;  3JCM J;  1AD5 A;  1RAB B;  3JB9 G;  1SHF A;  2F5K A;  2ROT A;  3OYI A;  3H41 A;  2FPD A;  4FCY A;  3TEE A;  1KSW A;  2E41 A;  3REA B;  2K3Y A;  4C5H A;  4FYW B;  4JLI A;  2PUO B;  5DM7 R;  2AZS A;  3SDZ A;  5GAN d;  1R8O B;  3FLG A;  1SKU B;  1ZBX A;  2RJD A;  1PC0 A;  5GAM f;  3CCM T;  1UHF A;  4PJO E;  5ECA A;  3URG A;  2BE7 D;  2PVO B;  2LNV A;  3M57 A;  3QYG B;  3QDF A;  1VQ4 Q;  1MV0 B;  5I22 A;  3NMZ C;  4DA4 A;  3JCM b;  3CME A;  3JCM d;  1ABO A;  3EG0 A;  3NTH A;  3QO3 A;  5LJ3 h;  2ZPG B;  2DD5 A;  5GJW B;  2ATC B;  1Q7Y C;  1KC8 R;  1MNE A;  2QQA A;  1H92 A;  5LJ5 h;  2VWF A;  2EQI A;  1VQK A;  3EAE A;  4DEX A;  1X69 A;  2QQR A;  4C5E A;  3JSC A;  3EG3 A;  2LJ1 A;  2HNI A;  2QDL A;  1NM7 A;  3M5A A;  3OYC A;  4M7A G;  1VQ4 T;  3QZ5 B;  1QQJ A;  3QUI A;  2O4X A;  4E7J A;  3CC2 Q;  2MWP A;  3PGG A;  5DLQ E;  3CCE Q;  4Y92 A;  5GAM j;  4PL6 A;  2GQI A;  1Z9Z A;  3JCM e;  1GBQ A;  2O9S A;  1UE9 A;  5KYU A;  2HSP A;  1C1A A;  2K4Y A;  4QT7 A;  4M75 G;  4AFQ C;  1HJD A;  4F17 A;  3GOX A;  1CSK A;  3CCQ T;  1UGP B;  4JS4 A;  1ZSG A;  5CKB A;  4E2F B;  1MMD A;  3L42 A;  5KYN A;  2CSI A;  2CZ1 B;  1QVF A;  4M7D C;  1TH7 A;  2DAQ A;  4KUI A;  4BDY A;  1KHI A;  3FJ5 A;  5CAI A;  3CC2 T;  4WF2 A;  2WSF E;  3CCE T;  1KQ1 A;  2LP5 A;  1QWE A;  1WZO A;  2HEQ A;  1GFD A;  2MYS A;  1WIE A;  3MHX A;  1JQQ A;  1K0X A;  5GMK m;  1Q82 R;  5GAM g;  3RDV A;  1RAH B;  2O01 E;  2FZC B;  5LJ5 e;  1K8A C;  4X1V A;  4M78 F;  1OV3 A;  1ZUU A;  1CKA A;  2NUP A;  4J9D A;  1XTD A;  2F2W A;  1W4S A;  4GY5 A;  3PTA A;  4ANJ A;  1M8V A;  2ZPI B;  4NOY A;  1X01 A;  2D1X A;  3C94 A;  3KFV A;  5A2Q E;  2K5F A;  1W2B P;  2M02 A;  2EGE A;  3LGL A;  1IHV A;  1M3A A;  1RAG B;  1W2B S;  5CR2 A;  4M78 A;  2A08 A;  3X28 B;  2OJ2 A;  2XIC A;  1OPL A;  4M77 C;  2CSQ A;  4ZNX A;  4D6W A;  3DLM A;  4M7D E;  2LX9 A;  1VQ6 A;  2QTX A;  4RUG A;  1R0B G;  4QVZ A;  2CP0 A;  4XU0 A;  2RM4 A;  4C0D C;  2OAU A;  2KVQ G;  1PG5 B;  2AZV A;  3QDR B;  1G8X A;  1WXB A;  4JDS A;  3G71 Q;  1M90 C;  4IUQ A;  2EJ9 A;  1NJI C;  2DK3 A;  3OYY A;  2NYS A;  1D09 B;  5IH2 A;  2DRK A;  1OUL A;  1Q7Y R;  1Q95 G;  2QA4 Q;  5GMK h;  2DYI A;  5KCO A;  3OBY A;  3CXC A;  4Z88 A;  3ME9 A;  2D0Q B;  2I2L A;  4R56 A;  3ER0 A;  4IUR A;  2NLU A;  2BZX A;  4FYY B;  1SG5 A;  3OYA A;  4PJO F;  1UJY A;  2FL7 A;  2V8K A;  3CCQ A;  2X3X D;  2RHU A;  4NL2 A;  4LDU A;  3JCM Q;  3CCJ A;  4TVR A;  3G71 T;  2DPP B;  1B07 A;  2JS0 A;  3BDL A;  4M75 B;  5KYW A;  1YIT A;  2LVM A;  2X9H A;  3LLR A;  2ZPF B;  5LJ3 f;  1OEB A;  2QA4 T;  3CCU Q;  5FU7 C;  1LVK A;  4QVC A;  1N5Z A;  1YWO A;  3VRY A;  4DQ2 A;  2O31 A;  4FW2 A;  2GBQ A;  3VS4 A;  4XTX A;  3CC7 A;  1Q81 U;  3EGX A;  4PNO A;  2JS2 A;  4B9X A;  1UEC A;  1VIF A;  2YRC A;  8AT1 B;  5I11 A;  3M58 A;  4HCC A;  1VQM Q;  1VYT A;  1U5S A;  2E10 A;  2MI6 A;  3M4G A;  4FM4 B;  4JJB A;  2FVU A;  3CCU T;  1LNX A;  1BIA A;  2L2P A;  4AFS C;  5GMK e;  3MET A;  4MDX A;  4LUD A;  1PRL C;  1ZX6 A;  4PJM A;  1K73 U;  4MZP A;  1GBR A;  2YT6 A;  5D6W A;  1G3T A;  1WHM A;  2K2M A;  2EKO A;  1WHH A;  1PNJ A;  1AWJ A;  4EMG A;  3T9N A;  4J9C A;  3C95 A;  5LJ5 j;  2DD4 A;  1VQM T;  3OYN A;  3JV3 A;  2DLP A;  1ZA1 B;  1YJN Q;  5FRO A;  1D3B A;  4CC4 B;  2HL3 A;  1VUB A;  3CPW S;  1YJ9 Q;  1KHC A;  3FJP A;  1M90 R;  4ZGJ B;  1JEG A;  2EFI A;  1NJI R;  4EMK A;  2J7I A;  2LJ0 A;  1M30 A;  3THK A;  2ED1 A;  3TU4 K;  1AT1 B;  3FRN A;  4C0Z A;  4A4E A;  1I5L A;  2CZ0 B;  1VQP A;  5LJ3 g;  3A8M B;  3JB9 J;  3S6W A;  2LCS A;  3WVD B;  4F7U G;  1M2V B;  3PVQ A;  3H0H A;  2VVK A;  1SEM A;  1YJN T;  4X9C A;  3H8Z A;  4YTL A;  1LPL A;  2AT1 B;  2ED0 A;  2H3J A;  4C8Q C;  4KT0 E;  4CI0 C;  2QDY B;  5A0L A;  4M7D B;  1YJ9 T;  2EQK A;  4EMH A;  1VQN Q;  1KK7 A;  2X3W D;  1WLP B;  2R5M A;  4PJO D;  2X4X A;  4M75 D;  1SRL A;  1NZ9 A;  4LNP A;  3L2R A;  1QCF A;  2RMO A;  1WDX A;  2A7Y A;  1YCY A;  1BCM A;  2J06 A;  3J80 E;  1FMK A;  2JMA A;  2LC4 A;  4C0F A;  3I5R A;  4JRP A;  3I5S A;  1QP3 A;  3L2Z A;  1VQ5 Q;  3OQ5 A;  4J9G A;  2L3Q A;  2YUN A;  4XU2 A;  1YIJ Q;  1OU9 A;  1ZLM A;  2ECZ A;  1VQN T;  2YUQ A;  2KGT A;  4OGE A;  4M77 F;  2FPE A;  2KT1 A;  4JLG A;  1WXT A;  1YI2 Q;  1MV3 A;  4C8Q E;  2PZ1 A;  1IB8 A;  2GQV A;  4LE9 A;  2ROL A;  2DIL A;  1UUE A;  2AKK A;  2F2V A;  4C0D B;  5GMK l;  3UA6 A;  1LCK A;  3CCS Q;  3D7S B;  1VQ5 T;  1VYU A;  2RK1 A;  1YIJ T;  2P0P A;  1YHQ Q;  3EH1 A;  2DXB A;  2M51 A;  5IN1 A;  1OZ3 A;  4IIO A;  1QVG S;  4C92 G;  5GMK j;  1RAC B;  3CCV T;  2DTO A;  1WJR A;  3VUZ A;  1WQW A;  1YI2 T;  3QWX X;  1UFF A;  1Q86 U;  4AT1 B;  4BE2 A;  2RA2 A;  2DIG A;  2H8H A;  3OYJ A;  3VS3 A;  5KYX A;  2DL5 A;  2ZZD A;  3OBW A;  3PNW C;  3FIF A;  2YXY A;  4BI8 B;  1K9A A;  5GAM d;  1VYV A;  3M0Q A;  4OB3 B;  3CCS T;  2MMP A;  1FX7 A;  5FRN A;  2ZAE A;  3R6O A;  1WX6 A;  1K0S A;  1YHQ T;  2DBK A;  2EYY A;  2P4T A;  2YUO A;  4OMP A;  1E6G A;  3LW5 E;  1PRM C;  3CME Q;  2E1H A;  1K9M C;  2X4J A;  4ZN1 A;  1SRM A;  2RK2 A;  1H3Z A;  4XQ3 A;  1PKS A;  3RMQ A;  5GJV B;  2EW3 A;  2P0K A;  2V1R A;  4WTO B;  2CT4 A;  1VQK Q;  1FWZ A;  2OTJ A;  2DEU A;  1QKX A;  4FSX A;  2OX7 A;  4M7D D;  1R0C B;  2XID A;  1I8F A;  1VQ7 A;  4EIK A;  1TG0 A;  1X75 C;  5GAM e;  1YJW A;  4F04 B;  1RAI B;  1GL5 A;  4CC7 A;  3R6N A;  2QTV A;  3CME T;  3A8O B;  2KI7 A;  5L23 A;  3MP6 A;  4EDU A;  1PKT A;  2CZ6 B;  4Y91 A;  6AT1 B;  2DNU A;  1G2B A;  4JRK A;  2KYB A;  9ATC B;  3QG1 A;  5GAO q;  2L3S A;  3VV0 A;  4JJC A;  1QWF A;  2K5I A;  4FW1 A;  3M55 A;  1S1N A;  1UJ0 A;  1VQK T;  1KIK A;  4NL3 A;  3PIP A;  3S3M A;  1WNL A;  4M7A C;  4N4H A;  2PVG B;  3G4S A;  2H3E B;  1P92 A;  5GAN 8;  3OYK A;  4LD9 K;  4IKF A;  4IUU A;  4DBF A;  1KD1 C;  3QWY A;  2LCL A;  3GF5 A;  2HZY A;  3MEW A;  4J6X A;  3CCV A;  1BU1 A;  5I2M A;  4OP0 A;  1NPR A;  4KBM B;  1QCN A;  1RLQ C;  4OMF B;  3E9G A;  2CT3 A;  2DM1 A;  4M75 C;  2EYX A;  2MIO A;  1RAE B;  1JU5 C;  1NBE B;  2C0O A;  2LX7 A;  1OQK A;  4HCZ A;  1WJQ A;  1O75 A;  4RG8 A;  5FW9 A;  8ATC B;  2VGN A;  1QW1 A;  5KCH A;  4Y28 E;  2K79 A;  4LXC A;  2OTL A;  1OX9 A;  1X43 A;  2ESW A;  4C8Q F;  4M7A E;  1B34 A;  3EHR A;  5GAN h;  1X6O A;  4C8Q B;  4RTZ A;  3EG1 A;  2EPD A;  3MP8 A;  1TUC A;  2EYW A;  1ZHI A;  2F2X A;  4KGX B;  3OS2 A;  1VQ6 Q;  3OA6 A;  2EWN A;  5L8R E;  3UWN A;  1VOM A;  5D6Y A;  3EG2 A;  4D8D A;  4HVV A;  1LOJ A;  2COZ A;  1S72 A;  4K11 A;  1K9M R;  4M75 E;  3BFM A;  1YP5 A;  2PNI A;  5FU6 B;  3UDC A;  4J83 A;  3WVE B;  4M78 G;  2EYQ A;  1K4U S;  5HKC A;  1QCO A;  4P5N A;  1M1K C;  2HQE A;  2O9V A;  2P4R A;  3MEA A;  3VS2 A;  3ULR B;  4A53 A;  4CRI A;  1X27 A;  3OSS C;  3PMT A;  3JCM P;  5FWC A;  3NFC A;  1VQ6 T;  4BUG A;  2PTK A;  3CPW A;  4Z8A A;  3C12 A;  1M5Q 1;  3CCQ Q;  3PMI A;  3CCJ Q;  3CD6 A;  4RTY A;  3C4S A;  3GBQ A;  3M59 A;  2F1L A;  3A1P A;  1YIT Q;  3SWN A;  4N0A C;  2CKK A;  2V1Q A;  4C0G A;  2JTM A;  2DTI A;  2IVW A;  4HCB A;  3JCM c;  1VQO A;  4LDV A;  1BK2 A;  5AYF A;  5LJ5 d;  5GAN 2;  4CC3 A;  2GF7 A;  2LNH B;  2M9U A;  1NEG A;  3CC7 Q;  2Z0W A;  2BTT A;  1PHT A;  2CS7 A;  4RTV A;  4BE1 A;  4RTX A;  5KYU B;  1ZSZ C;  2W0Z A;  3HKS A;  1KD1 R;  4FYV B;  3CCJ T;  2YHT A;  4Q5W A;  3UF4 A;  1Y57 A;  1YIT T;  1IZ6 A;  4C5I A;  1MMG A;  1AZG B;  1NLO C;  1U1T A;  1D0Y A;  2COY A;  1G83 A;  2K57 A;  3OYH A;  4J5Y A;  2QYZ A;  4JZ4 A;  2HD0 A;  5LJ3 e;  5HCK A;  3CC7 T;  3QZ9 B;  4HCK A;  1AHJ B;  3HP9 A;  2DZ9 A;  4J9I A;  1VQL A;  3UA7 A;  1RAA B;  1GFC A;  1T3S A;  3GNG A;  1KQS P;  1AOJ A;  2FHD A;  4E47 A;  1KQS S;  3BE3 A;  2NUP B;  2J05 A;  2LMJ A;  2M0Y A;  2G6F X;  1KC8 U;  2PU9 B;  1M1G A;  1N8R C;  2RI5 A;  3FDR A;  1ZBJ A;  5CKE A;  1H3H A;  2AKL A;  3RKX A;  5M9O A;  2RQU A;  5IHI A;  4C8Q D;  2VB6 A;  4DEY A;  1N27 A;  2QAS A;  4ZTJ A;  2V26 A;  1SPK A;  1UGS B;  2F5T X;  3MCA B;  3F70 A;  2FYK A;  1AVZ C;  4D8K A;  1IHW A;  1RUW A;  4O6J A;  2J6K A;  2QG9 B;  4IIM A;  2JZ2 A;  1UGQ B;  3RKY A;  1C6V X;  1VQP Q;  1QVG A;  2LTO A;  2YDL A;  2DEQ A;  3EG9 A;  1M1K R;  4ZGE B;  2LRQ A;  1WHK A;  1JJ2 P;  4M7A F;  5D7U A;  1Y96 B;  3TCJ A;  2M1H A;  1E6H A;  2JN0 A;  1BI1 A;  5GAN f;  1DJ7 B;  2K7A A;  4M7A B;  5HK0 A;  1UGR B;  4OMM A;  1YBY A;  3JCM W;  3H9N A;  1KD1 U;  3VJP A;  5GAN 5;  1T3L A;  2W10 A;  1BCO A;  2L5Q A;  2MF2 A;  4M75 F;  1AZE A;  2FB7 A;  4QQ6 A;  2KR3 A;  3UT1 A;  4Z02 A;  2E65 A;  1VQP T;  3E9F A;  1Q82 U;  2A0F B;  3M0P A;  3J81 E;  5KYW B;  2YUP A;  1VQ9 A;  1M2O A;  2L8D A;  2RHY A;  4PJO A;  4QVD A;  3M0S A;  2DL3 A;  1XQH A;  3DB3 A;  4KH0 B;  2R57 A;  1Y07 A;  4J9E A;  2MAM A;  3OW2 P;  1OZ2 A;  2KXD A;  4BI4 A;  5J39 A;  1NE8 A;  3ASK A;  3OW2 S;  1KJW A;  2DO3 A;  4XTY A;  2DA9 A;  2DVJ A;  2DYB A;  3J7A F;  1RAF B;  5GAN j;  1D0Z A;  1ZUK A;  2RQW A;  2FZG B;  2DL8 A;  4L59 A;  4HKE A;  3JB9 I;  1GCQ C;  3RBB B;  4JPB W;  2NUT A;  1HYO A;  4FSS A;  1V1C A;  4BE0 A;  4F7U E;  3JB9 D;  1K8A R;  1TXQ A;  4BD3 A;  1MND A;  4E7H A;  5GAN 4;  5GAO r;  2RF0 A;  1Q7Y U;  1FYN A;  2RQV A;  1I0C A;  1N8R R;  1K76 A;  3AT1 B;  2L89 A;  5LJ3 j;  3HRU A;  2QI2 A;  1E7O A;  1RI0 A;  5C0M A;  1JB0 E;  3CEY A;  2WSC E;  3P8D A;  5GAN g;  1C0M A;  3GIB A;  1GXI E;  2DJZ A;  4M77 G;  4XTZ A;  2J6F A;  2CRE A;  4PJN A;  4AFZ C;  2DMO A;  1EX4 A;  1I07 A;  1PD0 A;  3CC4 A;  3GP8 A;  5FLX E;  4C92 C;  2XKO C;  3TVT A;  1QVP A;  1B7T A;  2KBT A;  4PFZ A;  3RIR A;  1D1B A;  3EFO A;  4EMK B;  3EGD B;  3MPU B;  1BI3 A;  4BB7 A;  3LX7 A; 
#chains in the Genus database with same CATH homology
 2QXF A;  2E1H A;  1K9M C;  2LNV A;  3M57 A;  3QYG B;  2X4J A;  3VKI A;  4ZN1 A;  3V8J A;  2RK2 A;  1H3Z A;  4DA4 A;  3X25 B;  4XQ3 A;  2Y90 A;  4IUT A;  3JCM b;  2X35 A;  3CME A;  3RMQ A;  3JCM X;  3JCM d;  3CC4 T;  3AHU A;  4M7A D;  2P0K A;  1VQ4 A;  5IT9 E;  3NTH A;  1G5V A;  1Y96 A;  3UPU A;  3X24 B;  3QO3 A;  5LJ3 h;  4M7D F;  4N4I A;  2ZPG B;  2DD5 A;  3JRZ A;  4M7A A;  1Q7Y C;  2EQM A;  3A8L B;  5GAN 7;  1EIF A;  3JCM f;  2XD0 A;  1XOV A;  1FWZ A;  2QQA A;  5LJ5 h;  2OTJ A;  2CGH A;  4FSX A;  4EPC A;  2JNG A;  2EIF A;  4QW2 A;  4M7D D;  2XID A;  1I8F A;  1VQK A;  2LDM A;  3EAE A;  1VQ7 A;  2QQR A;  1X75 C;  3VU3 C;  4C5E A;  2LT1 A;  3JSC A;  3BDU A;  3OS5 A;  5GAM e;  2K2V A;  5GMK i;  3OYE A;  1YJW A;  2HNI A;  1K8A U;  1ZQ1 A;  2XG8 D;  4M7D A;  3CME T;  1Q86 C;  3A8O B;  3M5A A;  4C92 E;  2XDD A;  3OYC A;  4M7A G;  4JRQ A;  1VQ4 T;  2EJF A;  2XI9 A;  3MP6 A;  3QZ5 B;  4JRI A;  5FU6 C;  1VIE A;  4EDU A;  3QUI A;  4M75 A;  2CZ6 B;  2O4X A;  4PJO B;  4E7J A;  4M77 E;  4Y91 A;  2RHX A;  2MWP A;  2EAY A;  2K5L A;  2MWO A;  2GFA A;  4O5V A;  3PGG A;  4JRK A;  5DLQ E;  3VUB A;  1I5L A;  1QVF S;  2OTJ T;  3QG1 A;  3PFS A;  5GAO q;  4B9W A;  3VV0 A;  5GAM j;  2K5I A;  3A8G B;  4PL6 A;  3CC2 A;  2WSE E;  3M55 A;  3JCM e;  1VQK T;  4M7D G;  4NL3 A;  1VQ7 T;  4OB1 B;  3PIP A;  2DXC A;  3S3M A;  4HT8 A;  3CCE A;  1WNL A;  4JUV A;  3NTI A;  1YJW T;  4M7A C;  4N4H A;  2PVG B;  2K4Y A;  5LJ5 f;  3G4S A;  2DIQ A;  4M75 G;  4A4G A;  3A5Z B;  3QSU A;  1P92 A;  2QQB A;  3ZBD A;  5GAN 8;  3OYK A;  4LD9 K;  3S3N A;  4DOV A;  3GOX A;  3QHS A;  4IUU A;  4IKF A;  2LQK A;  2E64 A;  2D9T A;  3CCQ T;  1UGP B;  4JS4 A;  1KD1 C;  2LCC A;  3A8H B;  2LCL A;  2RB6 A;  2ZGW A;  2ZPB B;  3GF5 A;  2HBP A;  3MEW A;  4J6X A;  5CKB A;  3CCV A;  4E7I A;  5I2M A;  3L42 A;  1QVF A;  2CZ1 B;  4OP0 A;  2VYT A;  1NPR A;  4M7D C;  3OYF A;  4LD6 A;  5I21 A;  4KBM B;  1TH7 A;  2DAQ A;  4KUI A;  1M90 U;  3OYD A;  3GLX A;  1KHI A;  3GNF B;  4OMF B;  2XDP A;  5CAI A;  2DXU A;  3SD4 A;  4BDY A;  1NJI U;  3CC2 T;  4WF2 A;  2WSF E;  3E9G A;  4M75 C;  3P8H A;  4J6W A;  4M77 A;  4OGC A;  1M1K U;  1IRE B;  1LJO A;  1WQ7 A;  3RMS A;  3CCE T;  4OB2 B;  1KQ1 A;  3X26 B;  2R58 A;  3LW5 E;  3G4S T;  2HQX A;  3E1S A;  2EQU A;  3MHX A;  5GMK m;  2BUD A;  5GAM g;  2JOY A;  2YLB A;  2O01 E;  4HCZ A;  5KE2 A;  1WJQ A;  5LJ5 e;  2E6N A;  1I4K 1;  5D6X A;  1O75 A;  1K8A C;  4M78 F;  4RG8 A;  2Y4Y A;  2V8J A;  1OYX A;  3HFN A;  4X9D A;  1XTD A;  1W4S A;  1N9S A;  2VGN A;  4GY5 A;  1QW1 A;  3PTA A;  5KCH A;  2YRV A;  4FL6 A;  4Y28 E;  4J7F A;  1U8R A;  4XTU A;  2OTL A;  4MZM A;  2KQW A;  3CPF A;  1Y7X A;  5CKH A;  3OYG A;  4C8Q F;  1M8V A;  2ZPI B;  3GPL A;  4NOY A;  4M7A E;  1B34 A;  1X01 A;  3C94 A;  4M78 D;  1D3B B;  4MZT A;  3FB9 A;  5A2Q E;  2K5F A;  2ZPH B;  3M9Q A;  5GAN h;  1X6O A;  4C8Q B;  3LGL A;  2A3L A;  3MP8 A;  5DY9 A;  1BYM A;  2DVE A;  3OMG A;  1W2B S;  3JCM g;  2BKD N;  5CR2 A;  4M78 A;  1ZHI A;  3OS2 A;  4F7U B;  1JBM A;  3V8K A;  3OA6 A;  2EWN A;  3X28 B;  3DLL A;  5L8R E;  2XIC A;  3UWN A;  4M77 C;  2VV5 A;  3HRS A;  3MP1 A;  4UC4 A;  5D6Y A;  4D6W A;  3DLM A;  4M7D E;  1LOJ A;  2LX9 A;  4A54 A;  4RMO A;  2QTX A;  1VQ6 A;  2GFU A;  3M54 A;  4ZN3 A;  1S72 A;  2RHI A;  2PVD B;  4N0A A;  4XU3 A;  4MDW A;  4A4K A;  2QEX A;  4QVZ A;  3V7S A;  4XU0 A;  4M75 E;  2OTL T;  3OYL A;  3BFM A;  2RM4 A;  4C0D C;  2OAU A;  2KVQ G;  4FT2 A;  5CO7 A;  5FU6 B;  3UDC A;  3QDR B;  4J83 A;  3WVE B;  4M78 G;  3P8B B;  4JDS A;  2EYQ A;  3WXM B;  4IUQ A;  1M90 C;  2EJ9 A;  3LWI A;  3MO8 A;  1NJI C;  2DK3 A;  3HHT B;  5HKC A;  1W2B A;  2B8A A;  3OYY A;  4P5N A;  1UEB A;  1M1K C;  4BY6 C;  3OYM A;  4MMK A;  3QYH B;  3RUX A;  3G71 A;  4PKC C;  2HQE A;  2G3R A;  4QQG A;  3FEO A;  4CRI A;  3MEA A;  4A53 A;  2XDB A;  4PLL A;  5GMK h;  1G3S A;  3LWH A;  3OSS C;  3PMT A;  3LGF A;  3CBM A;  3JCM P;  3NFC A;  5KCO A;  1VQ6 T;  4BUG A;  3OBY A;  3CXC A;  1S72 T;  3BY7 A;  3ME9 A;  5LJ5 g;  3HFO A;  2QEX T;  3S3O A;  2QA4 A;  2D0Q B;  3CPW A;  2I2L A;  2X4W A;  2LT4 A;  3C12 A;  1M5Q 1;  4R56 A;  3ER0 A;  4IUR A;  2NLU A;  3PMI A;  2E6Z A;  5A0D A;  3CD6 A;  2VXE A;  3C4S A;  4OVA A;  3OYA A;  1M1F A;  3M59 A;  1MGQ A;  4PJO F;  3ZFJ A;  1BKB A;  5LL6 S;  4HT9 A;  2FL7 A;  3SWN A;  3H6Z A;  4N0A C;  2V8K A;  1NPP A;  3CCQ A;  4JJN K;  2RHU A;  2CKK A;  4IUP A;  4NL2 A;  4LDU A;  3JCM Q;  3KXT A;  3CCJ A;  4TVR A;  4C0G A;  3G71 T;  2JTM A;  2DPP B;  2DTI A;  2IVW A;  1N8R U;  4HCB A;  3BDL A;  2DZC A;  4M75 B;  1YIT A;  2VXF A;  1PSF A;  2LVM A;  3JCM c;  1VQO A;  4LDV A;  3RES A;  5AYF A;  5LJ5 d;  3LLR A;  5GAN 2;  2GF7 A;  3KUF A;  2M9U A;  1PSE A;  2RHZ A;  2ZPF B;  4II1 A;  5LJ3 f;  1BIB A;  2QA4 T;  3LH0 A;  3PIO A;  5FU7 C;  4QVC A;  4DQ2 A;  4A4F A;  3JAM E;  4FT4 A;  4ZGD B;  4E7K A;  2D6F A;  2CS7 A;  3CD6 T;  4BE1 A;  4XTX A;  3CC7 A;  3HKS A;  2JVV A;  3MEV A;  3CCU A;  4XTW A;  1OI1 A;  5IAY A;  3RKW A;  1Q81 U;  1RL2 A;  4PNO A;  5CKF A;  3ZEH A;  4ELZ C;  4HA8 A;  3CCJ T;  4LDY A;  4B9X A;  2YHT A;  3OS1 A;  4Q5W A;  2P0Q A;  1VIF A;  1YIT T;  4LDX A;  1IZ6 A;  2E5Q A;  3VYH B;  4C92 F;  4C5I A;  1VQO T;  1SSF A;  4M78 E;  5GAO n;  3SWN C;  4KUD K;  1U1T A;  2KAF A;  3M58 A;  3M4Y A;  3QKJ A;  4C92 B;  2VUB A;  4QQD A;  5KE3 A;  2K57 A;  4HCC A;  3JCM V;  4A4H A;  3OYH A;  1VQ8 A;  2E10 A;  2MI6 A;  4BAC A;  4J5Y A;  4M77 B;  3M4G A;  2HD0 A;  3DKM A;  5LJ3 e;  4FM4 B;  2FVU A;  5A0G A;  3CC7 T;  3QZ9 B;  3OS0 A;  1LNX A;  1AHJ B;  1BIA A;  4RCC A;  3CCU T;  3HP9 A;  2DZ9 A;  3L1A A;  3NTK A;  4N4G A;  1VQM A;  1KQ2 A;  1VQL A;  5GMK e;  3MET A;  1WJS A;  3GNG A;  4MDX A;  2WAC A;  2DKG A;  2FHD A;  2ZPE B;  4E47 A;  3OY9 A;  1KQS S;  3EFS A;  2GCX A;  5EG2 A;  1KG1 A;  1K73 U;  2C06 A;  4MZP A;  1KC8 U;  3M56 A;  2PU9 B;  4ME7 A;  5GAM h;  1M1G A;  4JS5 A;  5D6W A;  1WPY A;  2RO0 A;  2E12 A;  3OSV A;  1N8R C;  1G3T A;  2RI5 A;  2EKO A;  2QQS A;  4LDW A;  1VQ8 T;  2Y4X A;  2JUF A;  3FDR A;  1B34 B;  4F7U F;  4PLI A;  5CKE A;  4EMG A;  3T9N A;  3C95 A;  1UB4 A;  3BW1 A;  4XU1 A;  3RKX A;  5LJ5 j;  1BI2 A;  5M9O A;  1FXX A;  2DD4 A;  4C8Q D;  3OYN A;  1VQM T;  1VQL T;  4MML A;  2M16 A;  1N27 A;  2XHC A;  4ZTJ A;  4L5G A;  1UGS B;  5FRO A;  1D3B A;  1WGS A;  1KQS A;  2F5T X;  3CCR A;  2RD1 A;  3MCA B;  4C8Q A;  5GAN 6;  3CXC S;  3F70 A;  3OB9 A;  1Q81 C;  2K3X A;  3JCM h;  1M4Z A;  1VUB A;  2FYK A;  3MEU A;  5CVI A;  3KBG A;  3CPW S;  1YJN A;  3CBP A;  4O6J A;  4F7U A;  3V7R A;  1N6A A;  4C5G A;  3CMA A;  1KHC A;  3RER A;  1U1S A;  2JZ2 A;  1UGQ B;  3FJP A;  4FU6 A;  4ZGJ B;  3RKY A;  2EFI A;  3SFM A;  2KMT A;  4EMK A;  1QVG A;  2LTO A;  4KUL A;  3URG A;  2DEQ A;  1YJ9 A;  4ZGE B;  2LRQ A;  4M7A F;  4BI3 A;  1N9R A;  1Y96 B;  3FRN A;  5CIU A;  3TCJ A;  2M1H A;  4C0Z A;  4A4E A;  4C8Q G;  4L6V 5;  2CZ0 B;  2JN0 A;  3V7C A;  5FU7 B;  3A8M B;  1BI1 A;  5LJ3 g;  1VQP A;  5GAN f;  1DJ7 B;  4M7A B;  3S6W A;  5HK0 A;  3JB9 J;  2HAX A;  2RI3 A;  3CCR T;  2BIV A;  1UGR B;  2LQ8 A;  3WVD B;  1YBY A;  4F7U G;  3L2W A;  3G6E A;  4E7L A;  3JCM W;  1KD1 U;  3VJP A;  4M78 C;  1Y71 A;  4OF1 A;  4J8O A;  2KSS A;  2EJG A;  5CQX A;  1YJN T;  3PT9 A;  2VC8 A;  5HK3 A;  5GAN 5;  4X9C A;  1HK9 A;  3H8Z A;  2X4Y A;  4YTL A;  3CMA T;  4XTV A;  5CK9 A;  2RI2 A;  1K73 C;  2H3J A;  1KC8 C;  4XAX B;  4C8Q C;  4KT0 E;  4CI0 C;  2L5Q A;  2QDY B;  2IG0 A;  1V29 B;  5A0L A;  4M7D B;  1YJ9 T;  2EQK A;  2MF2 A;  4M75 F;  5J26 A;  4EMH A;  2FB7 A;  2YLC A;  5LJ3 d;  3SWN B;  3O8V A;  4QQ6 A;  1JJ2 A;  3UT1 A;  2KK4 A;  4Z02 A;  2O4X B;  5I2S A;  2E65 A;  1VQP T;  2R5M A;  3E9F A;  3QBY A;  3N5B B;  5CCA A;  1JRI A;  5GAO l;  4PJO D;  3QII A;  2X4X A;  3CBO A;  1Q82 U;  3M53 A;  2CZ7 B;  3G7Z A;  2DXT A;  2F69 A;  3G6E T;  3J81 E;  3L2V A;  1VQN A;  4EMK C;  3CCL A;  1VQ9 A;  1XNI A;  4M75 D;  2L8D A;  1NZ9 A;  2RHY A;  3L2R A;  1JJ2 S;  5KH6 A;  3Q1J A;  5GAN e;  4PJO A;  1G3Y A;  1YCY A;  2A7Y A;  3J80 E;  3E19 A;  4QVD A;  2LC4 A;  1HXD A;  4C0F A;  1XQH A;  3DB3 A;  1QP2 A;  2RJF A;  4RG2 A;  2E70 A;  2XK0 A;  5J3B A;  1QP3 A;  2R57 A;  4JRP A;  1Y07 A;  2MAM A;  3L2Z A;  3V8L A;  3OQ5 A;  1OZ2 A;  3QJY A;  4XU2 A;  4BI4 A;  4OB0 B;  1NE8 A;  3ASK A;  5J39 A;  3OW2 S;  2DO3 A;  4XTY A;  5CQY A;  3DB4 A;  3I55 A;  3FC3 A;  1VQ5 A;  4PJO G;  2M0O A;  2ZCF B;  1O9S A;  2QQ9 A;  3HL8 A;  3HRT A;  3I56 A;  5GAN j;  4OGE A;  3CCL T;  1VQN T;  1VQ9 T;  3J7A F;  2L3R A;  5DLO A;  2R5A A;  4VUB A;  1YIJ A;  2XU8 A;  4M77 F;  3JB9 F;  4JLG A;  2JTF A;  4L59 A;  4HKE A;  2PQW A;  3JB9 I;  4C92 D;  4C8Q E;  1K9M U;  3QPH A;  4V2S A;  2CYZ B;  2PUK B;  2GQV A;  2V8I A;  4BE0 A;  1MHN A;  4M77 D;  4F7U E;  3JB9 D;  1YI2 A;  4C92 A;  3HSB A;  4BD3 A;  5GAO p;  5GAO m;  4J6Y A;  4PJO C;  5HY6 A;  1I81 A;  3OMC A;  4C0D B;  5GMK l;  1H64 1;  3OW2 A;  4R55 A;  2EQJ A;  5CKD A;  3EFR A;  4BDZ A;  3I55 T;  1VQ5 T;  2KDS A;  4NS5 A;  3TRE A;  4DOW A;  3OYB A;  4E7H A;  5GAN 4;  5GAO r;  3LYI A;  2RK1 A;  3I56 T;  2KY9 A;  1Q7Y U;  1G3W A;  3JB9 H;  1YIJ T;  4IUV A;  4BY6 B;  2P0P A;  2L89 A;  3INZ A;  5C6S A;  5LJ3 j;  3HRU A;  3CCS A;  1Q82 C;  2DXB A;  2QI2 A;  4X34 A;  2VGM A;  1RI0 A;  5IN1 A;  5C0M A;  1OZ3 A;  1JB0 E;  3CEY A;  1QVG S;  2AHJ B;  2WSC E;  4C92 G;  5GMK j;  3P8D A;  1M9S A;  3X20 B;  5GAN g;  3CCV T;  3CCM A;  2DTO A;  1YHQ A;  3GIB A;  1WJR A;  3VUZ A;  3JCM J;  1GXI E;  1WQW A;  1YI2 T;  4M78 B;  2DJZ A;  4M77 G;  3JB9 G;  2RH2 A;  4XTZ A;  1Q86 U;  4J7I A;  4BE2 A;  2RA2 A;  2DIG A;  3OYJ A;  2F5K A;  4FIB A;  3OYI A;  3L2Q A;  4XK8 E;  3SB2 A;  3TEE A;  3QJ6 A;  2E41 A;  4ATO A;  1BI0 A;  2ZZD A;  3OBW A;  3FIF A;  3PNW C;  3CC4 A;  4BI8 B;  4GLK A;  3GP8 A;  3VYG A;  2RJC A;  4RKU E;  2K3Y A;  2RJE A;  5FLX E;  4C5H A;  4C92 C;  5GAM d;  4JLI A;  5GAN 3;  2XKO C;  2PUO B;  2DTH A;  1QVP A;  2MMP A;  4OB3 B;  1FX7 A;  4ELY C;  5DM7 R;  3CCS T;  3TU4 K;  5FRN A;  3R6O A;  3SDZ A;  5GAN d;  1R8O B;  3FLG A;  3QXE B;  3RIR A;  1ZBX A;  2RJD A;  4ZTF A;  5GAM f;  3CCM T;  1YHQ T;  4EMK B;  2P4T A;  3HPW A;  5FRM A;  4PJO E;  4RCB A;  1BI3 A;  3L2U A;  4BB7 A;  3LX7 A;  2PVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...