2MF6A

Solution nmr structure of chimeric avidin, chiavd(i117y), in the biotin bound form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
129
structure length
129
Chain Sequence
b'QTVARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVADNPGNITLSPLLGIQHKRASQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGYNIFTRLRTQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin, Avidin-related protein 4/5
publication title Chimeric Avidin - NMR Structure and Dynamics of a 56 kDa Homotetrameric Thermostable Protein
pubmed doi rcsb
source organism Gallus gallus
molecule tags Biotin binding protein
total genus 24
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2mf6A00
2IZLB 3RE6A 4BJ8A 1VWOB 2G5LA 2IZFB 4CPHA 1IJ8A 2IZEB 1VWRB 1MM9A 3RDQA 3WYQA 5CSEA 5JD2A 5K68A 2RTFB 1LCVA 3VHMA 2AVIA 4JNJA 4CPHB 1VYOA 2Y3EA 2RTGB 3WZNA 4CPEA 3VGWA 2IZGB 1LDQA 3T6FA 1AVEA 1SRJA 1WBIA 4I60A 1SWBA 1SWTA 3MM0A 2GH7A 1SWUA 2RTMA 4Y59A 4GGTA 2A5CA 1RXJA 3VHHA 1VWCB 1SRFA 2MF6A 4U46A 1SWKA 1LUQA 3SZJA 4Z6JA 1SLFB 1KL3A 1VWQB 1VWAB 4CPFA 1RSTB 1PTSA 1SLDB 1SWRA 2OFAA 2Y32A 4Z27A 1LELA 2RTAA 1VWIB 1Y52X 2IZCB 1MK5A 1HXLA 2UYWA 2BC3A 3RY1A 2IZJA 4Z2VA 1STPA 5IRUA 1LDOA 4BX7B 2FHLA 2IZKA 2C4IA 2RTBB 4YVBA 1SWCA 2RTPB 2RTNB 1SWNA 1RSUB 2OFBA 1N43A 4Y5DA 2RTOB 1VWMB 5IRAA 2RTDB 1HQQA 1DF8A 1SRIA 1STSB 1NDJA 1LCZA 2JGSA 4GDAA 1Y53X 3PK2A 2RTRB 5F2BA 1KL5A 5CHKA 1RAVA 4EKVA 1SWEA 3T6LA 5L3YA 1AVDA 1KL4A 1SWQA 1VWHB 3RDSA 1SLEB 3FDCA 3RDOA 1VWPB 2RTJA 1SWFA 3RY2A 4BCSA 1SWGA 2FHNX 2WPUA 5IRWA 3SZHA 3WZQA 4BX5A 1SRHA 1SWHA 3X00A 3RDUA 1NQMA 1VWGB 1N7YA 1VWNB 1SWLA 4GJVA 1NQNA 2IZAA 1RXKA 4GGRA 1SWAA 1MEPA 3RE5A 2RTEB 1Y55X 1HY2A 2ZSCA 2UZ2A 1N4JA 1SWDA 3T2WA 3EW1A 4BBOA 2OF9A 3EW2A 1N9MA 4Z2OA 4DNEA 1VWFB 1RXHA 5B5GA 1I9HA 2IZDB 3WZOA 1SWJA 1SRGA 5B5FA 2Y3FA 1VWEB 2A8GA 2CAMA 2RTIB 4BX6A 2IZHB 3T2XA 1NC9A 2OF8A 2C1SA 4IRWA 1N9YA 3SZIA 2F01A 4GGZA 4BX6B 1VWKB 1VWDB 4JHQA 5K67A 3RDXA 2QCBA 2RTQB 3VHIA 4Z2PA 3MG5A 1SWOA 3RDMA 3WZPA 4JO6A 2RTCB 2RTHB 4BX5B 2RTLA 4GJSA 1VWJB 2IZBA 2IZIA 1LCWA 4GD9A 3WYPA 4CPIA 2RTKA 1SWPA 1KFFA 1STRB 4OKAA 1MOYA 4Z28A 4BX7A 1HXZA 1VWLB 2C1QA 1NBXA 1SLGB 1VWBB 1SWSA 2A5BA 1SREA
chains in the Genus database with same CATH superfamily
1LIBA 2WUTA 3U03A 2IZLB 1KOIA 2BS5A 3C77X 5HAEA 3FEKA 4KIIA 3WJEA 4MIRA 2RTFB 1LCVA 2CZUA 5DPQA 3RBYA 1GXAA 1YP6A 5HZ8A 1O8VA 2Y3EA 2RTGB 4Y0RA 1SY0A 5HCEC 3T6FA 2A13A 2OL7A 1SRJA 3D97A 3S5XA 2OY1O 4I60A 4LKPA 4EFGA 1SWBA 1SWTA 2GH7A 1HBPA 4ALOA 3B2IA 4GGTA 2HZRA 1SXXA 2LBVA 1RXJA 4QGXA 3WJGA 1SRFA 2MF6A 4IBAA 3NQ3A 4IB7A 3PH5A 1SLFB 1ZRYA 1QY1A 4YGZA 1VWQB 3IFBA 4YFQA 2CBRA 4GE1A 4IMNA 4YMYA 2RCTA 4D6AA 1IFCA 2AT8X 3SLJA 2JW1A 4TKBA 2RTAA 1OBPA 1Y52X 2JU3A 4PJ2A 3SLOA 1CBRA 3P6FA 1X8QA 2BC3A 1FEMA 3WJCA 3NX1A 1I78A 1QY0A 2X32A 3RKGA 4O4UA 3ZW0A 2EU7X 2C4IA 2RTBB 1KZWA 2OFMX 1Z24A 2LA7A 2LB6A 1JMZA 2RTNB 2OFBA 2RTPB 5IRAA 4A1HA 1LIEA 2BHVA 2RTDB 4NYQA 1CBQA 4YKOA 2GTLN 2MJIA 1CRBA 4QYPA 4YKMA 5H9KA 3AEHA 3OJYC 2FR2A 2RTRB 3I17A 4QGVA 4NW4A 3ZQ3A 5IO6A 3G7XA 4A8ZA 1RAVA 3DSZA 4OELA 3HWFA 4GUZA 5L3YA 4LQZA 2ACOA 2FGSA 4ES7A 2NNDA 4O3WA 4MEEA 4ZH9A 1G74A 1P6PA 1QFTA 4FQBB 2FTBA 4HPAA 1ALBA 1Y0GA 2L9CA 3APXA 4ZGFA 1ZNEA 1SWGA 1ZNLA 3U9PC 1QABE 3BLGA 4I6SA 1Y9LA 1HQPA 1NQMA 3HWGA 1N7YA 1DZPA 2R73A 3FA8A 3KVNA 4B55A 2IZAA 4GH7A 5HBSA 5BYPA 4WBKA 4ZCBA 1SWAA 1HMSA 1MEPA 2KTSA 2RTEB 4MVKA 2P8GA 1B56A 1N4JA 4TQ2A 3CQNA 4NP1A 1W5RA 3JS1A 5B3MO 1BSQA 3EW1A 2PI3O 3WJFA 2OF9A 3ZUIA 3FR2A 3TZSA 4L1NA 2LBAA 4ZR2A 1N9MA 4K19A 4YCHA 2W2BA 5LJEA 1DF3A 3CWKA 1K24A 3APWA 3DTQA 2G8CO 1I9HA 2AT5X 1FENA 1W4TA 3P6CA 2Y3FA 5EZ2A 1SY1A 2K62A 5LJBA 1IKJA 4BX6A 1SMPI 5IXGA 1PMPA 3NQ9A 4O49A 3VPJE 3CQRA 1VWDB 2JU7A 3RDXA 2CZTA 4QGWA 1EQDA 1S44A 4Z2PA 1SWOA 1TVQA 1DFVA 2O62A 4LKTA 1U0XA 4U8UO 1JJJA 3O19A 1GX3A 2KTDA 3F9DA 1JMXA 3FW4A 2IZIA 3NR3A 4MVLA 5BVQA 5IO7A 3OE3A 1GX8A 1UYNX 2POAA 1S2PA 1SWPA 2RTKA 2MM3A 2YG2A 4OKAA 2HZQA 4Z28A 4Y0PA 1VWLB 2KT4B 2OYBO 2C1QA 4DQ3A 2Q9SA 1KT5A 3STKA 1SLGB 3CKFA 3PQUA 5LJGA 2FWVA 1MUPA 2XSTA 4ON1A 3LTWA 4ZHHA 5HZ6A 2WR6A 2QOMA 5HA1A 1CJ5A 1ERXA 2R74A 1E02A 1VWRB 4M7MA 4HPBA 5K68A 3MBTA 3VHMA 2WEXA 4ZHDA 2LFOA 1IKEA 4CPHB 4MISA 4EQAC 4XMHA 2RCQA 1FDQA 1YWAA 1LKEA 1YWDA 1VPRA 1LDQA 2FS7A 2IZGB 2FR3A 3HTYA 1YUPA 2X56A 4GDZA 4XMFA 4EXZA 1SWUA 1HBQA 4XMCA 5KICA 1BLRA 4Y59A 1U17A 2A5CA 5D48A 4YCEA 3VHHA 3B2JA 4U46A 1LUQA 4Z6JA 2K23A 1TXLA 3FW5A 3FENA 4MVEA 4OMWA 5HCCC 4ORSA 2OFAA 4DCBA 2Y32A 3EBWA 3LV4A 4O4SA 3CBSA 4GRJA 1VWIB 4AZMA 2G79A 3QQ2A 4GZVA 4A60A 1Y9TA 5HTDA 1HXLA 2G7BA 2GTLM 2UYWA 3P6HA 4R0BA 1B4MA 2IZJA 1E06A 4QNIA 1BJ7A 5IRUA 4ORYA 4CSBA 4XMDA 4ZHFA 4Y0QA 4IAWA 1QWDA 3UEVA 1HN2A 2DJFA 2WQAE 3C76X 2RTOB 4KCAA 2X8TA 1HQQA 1OEJA 3KQ0A 1NDJA 5LJHA 2JGSA 2X55A 1ERBA 3GE2A 4CK4A 5FQ7E 4YFRA 4HPCA 1VYGA 1B0OA 2OVAA 2W2FA 3CR6A 3PDFA 4EKVA 1SWEA 4YBUA 4HFOA 2X45A 2GTFX 3T6LA 3NADA 2AL0X 3WJBA 5H8TA 1AVDA 4ZHGA 3N91A 1VWHB 3BDRA 3APVA 1GM6A 3FDCA 2IFBA 1S7DA 2FS6A 5IRWA 5D4AA 5FFHA 5AJBA 1SRHA 1SWHA 3STNA 3X00A 1VWGB 1KGLA 2HNXA 2QOSC 4WHIA 2OVEA 1MDCA 2ASNX 4FBVA 2WWPA 3RE5A 1HY2A 1R0UA 2QO6A 3T2WA 4LZVA 2Q2MA 2FKGA 2OY8A 3BS2A 4IAXA 5AJCA 2QO5A 5D45A 3ZW1B 4BBOA 1OBQA 2NP1A 4YBPA 1YIVA 1U18A 3KZAA 4O9SA 1VWFB 2FT9A 3FA9A 4O3XB 4DNEA 4Z2OA 3U0DA 3JQOA 4CDDA 1KZXA 3NQKA 3CMPA 1NGLA 2IZDB 2L67A 4NNTA 3VU1A 1TOWA 1MX8A 2OY7A 3RDSA 1VWEB 2A8GA 5F1EA 2CAMA 2IZHB 4O3YA 2X8FA 5F6ZA 4HPDA 3V8UA 3VG3A 4INNA 4IRWA 4IMOA 1X71A 4BOEA 1N9YA 4ORWA 2F01A 5B27A 5LJDA 2BLGA 1AB0A 1FTPA 1KT7A 3P24A 5K67A 2AT0X 2RTQB 3RDMA 3HOLA 4JO6A 4AW8A 1ML7A 2RTLA 4FGIB 4KT5A 3SAOA 1I4UA 4GK9A 2IZBA 3STMX 4YGHA 1ICNA 4QAEA 3SOTA 3VG7A 1LCWA 5D8JA 5HA0A 4CPIA 3B2KA 1ZNDA 1NP1A 3EBKA 1STRB 2FRSA 1OPBA 2PY1A 1MOYA 5D47A 5H9AA 1HXZA 1NBXA 2KD2A 2LKKA 1X89A 2OFRX 2RA6A 1A2DA 1CBSA 2NNQA 4NLJA 4NV8A 4O3ZA 4QQ1A 2X34A 4I95A 4UU3A 1D2UA 2RN4A 4U3QA 1SXYA 4U8UN 4BX7B 3RE6A 2FKJA 1VWOB 3C78X 1IJ8A 1I05A 3UEWA 4D6BA 4BGFA 1MM9A 2YMSA 3WYQA 1JZUA 2NNEA 4GNYA 1IFBA 5JD2A 2F73A 4PSQA 2AVIA 4OS8A 1VYOA 2JN3A 3WZNA 3MX7A 4CPEA 2Q39A 3QKGA 4O4OA 1L6MA 2Q4NA 3ZW2A 2Q2PA 3ZZVA 1X8UA 1E2TA 4KH8A 4CV7A 4O4XA 1SY3A 3MM0A 5F7GA 1JV4A 2RTMA 1JJXA 1EPBA 1WUBA 1NP4A 5KIDA 5FQ6E 2VFBA 1SWKA 2HMBA 3SZJA 4TKJA 1JBHA 3VG6A 4TNNA 1KL3A 1VWAB 1BM5A 1RSTB 1PTSA 3FMZA 1VYFA 2M4LA 3Q6LA 4YDBA 2ACPX 1HMTA 2OZQA 1OBUA 3PH6A 4Z27A 2IZCB 5LKEA 1CBIA 1MK5A 1BEBA 1O1UA 2ZAGA 4Z2VA 1STPA 3UEUA 1LDOA 4CDEA 4YVBA 2MO5A 5H9LA 4Y5DA 1RSUB 5CE4A 1FJ1E 1VWMB 1EXSA 2KW1A 3KFHA 4TJZA 1DF8A 2G78A 2I5ZO 1A18A 3EC5A 4JGLA 3TF6A 4ZHCA 5FAZA 1Y53X 5L8OA 5LJCA 1OSPO 4GU8A 5F2BA 4ID2A 5BVTA 1JJUA 5EPQA 4TKHA 4COTA 1JQPA 2AH7X 2DM5A 4FBOA 3E3CA 1OEEA 1KL4A 1T0VA 1SWQA 4OEMA 1DV9A 4AYHA 3AKMA 3RDOA 3S60A 1VWPB 2RTJA 1SWFA 1YWCA 5HZ9A 5HTEA 2FHNX 4OS3A 1KT6A 4QYNA 3SZHA 3WZQA 1KT3A 1T8VA 1X8NA 2X4MA 1BRPA 3RSWA 1UREA 1PEEA 2HYSA 3K3LA 3P6EA 1RXKA 3FR4A 1G85A 2CM9A 1KQWA 1SWDA 3VG5A 1EI5A 3BSZE 3AKNA 1GGLA 2RD7C 3IA8A 4RUUA 2HKDA 2MHDA 2WSJA 1UYOX 1X8OA 3KFIA 2X8SA 5F58A 5HZQA 1GX9A 3S26A 3S5VA 5B5GA 3FA6A 4NYRA 1SWJA 3WZOA 1PM1X 1BRQA 2JU8A 3VE2A 3T2XA 4Y0SA 1NC9A 1PBYA 3EMMA 3D96A 2OF8A 3SLTA 2C1SA 4QZUA 3SZIA 3Q34A 4NNSA 3O2YA 4GGZA 3WVMA 4BX6B 4I3DA 1HMRA 3L4RA 3H3IA 4JHQA 2A2UA 3VHIA 2BSZA 2E4JA 2GJ5A 3MG5A 4EDEA 3JSQA 3PEDA 5IO5A 2CM4A 1EW3A 4KC8A 1IW2A 2WQ9A 3UAQA 4AZOA 4BX5B 3MVFA 4GJSA 4AZRA 1GT5A 3KFGA 1VWJB 4U8UM 1TOUA 2A2GA 3ZUOA 2OY5O 3WBGA 3ELXA 1BWYA 3HPEA 4FBRA 3FR5A 4GD9A 2ALLX 5K06A 1EIOA 3ZI8A 4IB9A 3BRNA 3BY0A 3HWDA 4ORUA 4WFUA 3ELZA 1LFOA 2QMIA 4CDFA 4U9CA 1VWBB 1SWSA 2A5BA 4GETA 1XKIA 1EPAA 1GT4A 3PECA 1H91A 4ORRA 2R56A 2QM9A 2DJGA 2G5LA 2IZFB 3LHNA 4BJ8A 1ZNGA 2IZEB 4CPHA 2RQ0A 3RDQA 2AMMX 1K3BA 4YGGA 1LICA 5FQ8E 3NX2A 5CSEA 4EEJA 1G5WA 2JMBA 3FEPA 3D4RA 2QO4A 3EM0A 4JNJA 4ZGUA 5B2AO 3FYFA 5FENA 5EDCA 1MVGA 1BBPA 1B8EA 4ORXA 3VGWA 5HZ5A 1AVEA 1WBIA 3BU1A 3CKGA 4ZFXA 3F8AA 3HOEA 4IB6A 4M6SA 3B2HA 1XCAA 1MX7A 4ZJ0A 5LKFA 1JIWI 1JYDA 5C0NA 1KT4A 1VWCB 1SA8A 3HK1A 1DZKA 5EEDA 1QG5A 4OMXA 1SLDB 3WJDA 1SWRA 1RLBE 3OBLA 4CPFA 5H9NA 4YDAA 3EYCA 3PQSA 2BS6A 2AF5A 1LELA 4IABA 4QZTA 4NV7A 3VG2A 1GKAB 2GTLO 2XKLA 5AQ6A 5BVSA 2VDFA 3FELA 3RY1A 3B2LA 4WFVA 4ZH6A 1PBOA 2OL8O 1ZNKA 3BU9A 5F6BA 4AZQA 2OVSA 1EALA 2FLJA 1JYJA 2FHLA 2IZKA 1UZ2X 4HWMA 4RUNA 1N0SA 1QFVA 2BT9A 1OPAA 1SWCA 3APUA 1LIFA 5JR8A 1SWNA 2N93A 3TGAA 1FE3A 1N43A 1ZNHA 1D3SA 1ACDA 1STSB 1SRIA 2I5VO 1A3YA 4L3RA 2A0AA 1LCZA 4AZPA 4UU2A 4GDAA 2CBSA 4AZNA 2X46A 5B11O 1G7NA 2AKQA 3PK2A 1BSYA 3CBCA 1KL5A 4I3BA 2GC9A 3VE1A 5CHKA 3RZYA 1GT3A 1KQXA 4N7DA 1DZJA 1QY2A 3FA7A 4GKCA 1A57A 1EIIA 1BSOA 3BX7A 3T1DA 2WEWA 1SLEB 1I06A 4BCSA 3RY2A 4N7CA 1YWBA 4ARHA 1ICMA 2WPUA 3F6ZB 4BQUA 3D95A 4BX5A 1QQSA 3FIDA 3RDUA 3TGBA 1AELA 3OD9A 1VWNB 2HLVA 1TW4A 1SWLA 2W2AA 4GJVA 1NQNA 2AT3X 4I9RA 3ZW1A 5KHPA 2OL6O 4GGRA 1O1VA 3P6GA 1LPJA 4GNWA 1ADLA 1Y55X 1AVGI 2ZSCA 2UZ2A 4I3CA 1GT1A 1OEKA 4CDCA 5L8NA 1DZMA 3KFFA 3ZW0B 2F09A 1SXWA 5L8IA 4C5PA 2ANSA 3AUMO 3EW2A 5EEEA 5B10O 3FLLA 1RXHA 3TGCA 1DC9A 3D9WA 3HWEA 3PPTA 4NLIA 3VG4A 4XMGA 1SRGA 1LIDA 4ML7B 1SY2A 4ODDA 5B5FA 4I9SA 1E5PA 2RTIB 2ZAIA 1X8PA 3NPOA 3ZWEA 2OVDA 2MWHA 5EDBA 2AT6X 2JOZA 5HWZA 4ALBA 1W6FA 3O22A 3UEXA 4BVMA 2A3FX 5DG4A 4IB8A 2Z4HA 1VWKB 3P02A 2QCBA 4KC7A 3I0AA 3WZPA 4A1YA 4DQ4A 2L5PA 4XMEA 1RBPA 3NP1A 3NBXX 2RTCB 2RTHB 4LZUA 5CYBA 2VFCA 2Z4IA 4OS0A 5AEOA 1EUOA 4MVIA 4TLJA 1I04A 3FIQA 1LF7A 3PP6A 1YP7A 2L68A 3WOVA 5HCDC 1KXOA 1SXUA 4QRLA 3WYPA 1LNMA 1E00A 1KFFA 1T68X 1GKAA 1IIUA 3GAQA 4BX7A 3WXQA 3BX8A 4YFPA 3P6DA 4YH0A 3RWXA 5B29A 1AQBA 5LJKA 1FELA 1SREA
chains in the Genus database with same CATH topology
2IZLB 3RE6A 4BJ8A 1VWOB 2G5LA 2IZFB 4CPHA 1IJ8A 2IZEB 1VWRB 1MM9A 3RDQA 3WYQA 5CSEA 5JD2A 5K68A 2RTFB 1LCVA 3VHMA 2AVIA 4JNJA 4CPHB 1VYOA 2Y3EA 2RTGB 3WZNA 4CPEA 3VGWA 2IZGB 1LDQA 3T6FA 1AVEA 1SRJA 1WBIA 4I60A 1SWBA 1SWTA 3MM0A 2GH7A 1SWUA 2RTMA 4Y59A 4GGTA 2A5CA 1RXJA 3VHHA 1VWCB 1SRFA 2MF6A 4U46A 1SWKA 1LUQA 3SZJA 4Z6JA 1SLFB 1KL3A 1VWQB 1VWAB 4CPFA 1RSTB 1PTSA 1SLDB 1SWRA 2OFAA 2Y32A 4Z27A 1LELA 2RTAA 1VWIB 1Y52X 2IZCB 1MK5A 1HXLA 2UYWA 2BC3A 3RY1A 2IZJA 4Z2VA 1STPA 5IRUA 1LDOA 4BX7B 2FHLA 2IZKA 2C4IA 2RTBB 4YVBA 1SWCA 2RTPB 2RTNB 1SWNA 1RSUB 2OFBA 1N43A 4Y5DA 2RTOB 1VWMB 5IRAA 2RTDB 1HQQA 1DF8A 1SRIA 1STSB 1NDJA 1LCZA 2JGSA 4GDAA 1Y53X 3PK2A 2RTRB 5F2BA 1KL5A 5CHKA 1RAVA 4EKVA 1SWEA 3T6LA 5L3YA 1AVDA 1KL4A 1SWQA 1VWHB 3RDSA 1SLEB 3FDCA 3RDOA 1VWPB 2RTJA 1SWFA 3RY2A 4BCSA 1SWGA 2FHNX 2WPUA 5IRWA 3SZHA 3WZQA 4BX5A 1SRHA 1SWHA 3X00A 3RDUA 1NQMA 1VWGB 1N7YA 1VWNB 1SWLA 4GJVA 1NQNA 2IZAA 1RXKA 4GGRA 1SWAA 1MEPA 3RE5A 2RTEB 1Y55X 1HY2A 2ZSCA 2UZ2A 1N4JA 1SWDA 3T2WA 3EW1A 4BBOA 2OF9A 3EW2A 1N9MA 4Z2OA 4DNEA 1VWFB 1RXHA 5B5GA 1I9HA 2IZDB 3WZOA 1SWJA 1SRGA 5B5FA 2Y3FA 1VWEB 2A8GA 2CAMA 2RTIB 4BX6A 2IZHB 3T2XA 1NC9A 2OF8A 2C1SA 4IRWA 1N9YA 3SZIA 2F01A 4GGZA 4BX6B 1VWKB 1VWDB 4JHQA 5K67A 3RDXA 2QCBA 2RTQB 3VHIA 4Z2PA 3MG5A 1SWOA 3RDMA 3WZPA 4JO6A 2RTCB 2RTHB 4BX5B 2RTLA 4GJSA 1VWJB 2IZBA 2IZIA 1LCWA 4GD9A 3WYPA 4CPIA 2RTKA 1SWPA 1KFFA 1STRB 4OKAA 1MOYA 4Z28A 4BX7A 1HXZA 1VWLB 2C1QA 1NBXA 1SLGB 1VWBB 1SWSA 2A5BA 1SREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZL B;  3RE6 A;  4BJ8 A;  1VWO B;  2G5L A;  2IZF B;  4CPH A;  1IJ8 A;  2IZE B;  1VWR B;  1MM9 A;  3RDQ A;  3WYQ A;  5CSE A;  5JD2 A;  5K68 A;  2RTF B;  1LCV A;  3VHM A;  2AVI A;  4JNJ A;  4CPH B;  1VYO A;  2Y3E A;  2RTG B;  3WZN A;  4CPE A;  3VGW A;  2IZG B;  1LDQ A;  3T6F A;  1AVE A;  1SRJ A;  1WBI A;  4I60 A;  1SWB A;  1SWT A;  3MM0 A;  2GH7 A;  1SWU A;  2RTM A;  4Y59 A;  4GGT A;  2A5C A;  1RXJ A;  3VHH A;  1VWC B;  1SRF A;  2MF6 A;  4U46 A;  1SWK A;  1LUQ A;  3SZJ A;  4Z6J A;  1SLF B;  1KL3 A;  1VWQ B;  1VWA B;  4CPF A;  1RST B;  1PTS A;  1SLD B;  1SWR A;  2OFA A;  2Y32 A;  4Z27 A;  1LEL A;  2RTA A;  1VWI B;  1Y52 X;  2IZC B;  1MK5 A;  1HXL A;  2UYW A;  2BC3 A;  3RY1 A;  2IZJ A;  4Z2V A;  1STP A;  5IRU A;  1LDO A;  4BX7 B;  2FHL A;  2IZK A;  2C4I A;  2RTB B;  4YVB A;  1SWC A;  2RTP B;  2RTN B;  1SWN A;  1RSU B;  2OFB A;  1N43 A;  4Y5D A;  2RTO B;  1VWM B;  5IRA A;  2RTD B;  1HQQ A;  1DF8 A;  1SRI A;  1STS B;  1NDJ A;  1LCZ A;  2JGS A;  4GDA A;  1Y53 X;  3PK2 A;  2RTR B;  5F2B A;  1KL5 A;  5CHK A;  1RAV A;  4EKV A;  1SWE A;  3T6L A;  5L3Y A;  1AVD A;  1KL4 A;  1SWQ A;  1VWH B;  3RDS A;  1SLE B;  3FDC A;  3RDO A;  1VWP B;  2RTJ A;  1SWF A;  3RY2 A;  4BCS A;  1SWG A;  2FHN X;  2WPU A;  5IRW A;  3SZH A;  3WZQ A;  4BX5 A;  1SRH A;  1SWH A;  3X00 A;  3RDU A;  1NQM A;  1VWG B;  1N7Y A;  1VWN B;  1SWL A;  4GJV A;  1NQN A;  2IZA A;  1RXK A;  4GGR A;  1SWA A;  1MEP A;  3RE5 A;  2RTE B;  1Y55 X;  1HY2 A;  2ZSC A;  2UZ2 A;  1N4J A;  1SWD A;  3T2W A;  3EW1 A;  4BBO A;  2OF9 A;  3EW2 A;  1N9M A;  4Z2O A;  4DNE A;  1VWF B;  1RXH A;  5B5G A;  1I9H A;  2IZD B;  3WZO A;  1SWJ A;  1SRG A;  5B5F A;  2Y3F A;  1VWE B;  2A8G A;  2CAM A;  2RTI B;  4BX6 A;  2IZH B;  3T2X A;  1NC9 A;  2OF8 A;  2C1S A;  4IRW A;  1N9Y A;  3SZI A;  2F01 A;  4GGZ A;  4BX6 B;  1VWK B;  1VWD B;  4JHQ A;  5K67 A;  3RDX A;  2QCB A;  2RTQ B;  3VHI A;  4Z2P A;  3MG5 A;  1SWO A;  3RDM A;  3WZP A;  4JO6 A;  2RTC B;  2RTH B;  4BX5 B;  2RTL A;  4GJS A;  1VWJ B;  2IZB A;  2IZI A;  1LCW A;  4GD9 A;  3WYP A;  4CPI A;  2RTK A;  1SWP A;  1KFF A;  1STR B;  4OKA A;  1MOY A;  4Z28 A;  4BX7 A;  1HXZ A;  1VWL B;  2C1Q A;  1NBX A;  1SLG B;  1VWB B;  1SWS A;  2A5B A;  1SRE A; 
#chains in the Genus database with same CATH topology
 1LIB A;  2WUT A;  3U03 A;  2IZL B;  1KOI A;  2BS5 A;  3C77 X;  5HAE A;  3FEK A;  4KII A;  3WJE A;  4MIR A;  2RTF B;  1LCV A;  2CZU A;  5DPQ A;  3RBY A;  1GXA A;  1YP6 A;  5HZ8 A;  1O8V A;  2Y3E A;  2RTG B;  4Y0R A;  1SY0 A;  5HCE C;  3T6F A;  2A13 A;  2OL7 A;  1SRJ A;  3D97 A;  3S5X A;  2OY1 O;  4I60 A;  4LKP A;  4EFG A;  1SWB A;  1SWT A;  2GH7 A;  1HBP A;  4ALO A;  3B2I A;  4GGT A;  2HZR A;  1SXX A;  2LBV A;  1RXJ A;  4QGX A;  3WJG A;  1SRF A;  2MF6 A;  4IBA A;  3NQ3 A;  4IB7 A;  3PH5 A;  1SLF B;  1ZRY A;  1QY1 A;  4YGZ A;  1VWQ B;  3IFB A;  4YFQ A;  2CBR A;  4GE1 A;  4IMN A;  4YMY A;  2RCT A;  4D6A A;  1IFC A;  2AT8 X;  3SLJ A;  2JW1 A;  4TKB A;  2RTA A;  1OBP A;  1Y52 X;  2JU3 A;  4PJ2 A;  3SLO A;  1CBR A;  3P6F A;  1X8Q A;  2BC3 A;  1FEM A;  3WJC A;  3NX1 A;  1I78 A;  1QY0 A;  2X32 A;  3RKG A;  4O4U A;  3ZW0 A;  2EU7 X;  2C4I A;  2RTB B;  1KZW A;  2OFM X;  1Z24 A;  2LA7 A;  2LB6 A;  1JMZ A;  2RTN B;  2OFB A;  2RTP B;  5IRA A;  4A1H A;  1LIE A;  2BHV A;  2RTD B;  4NYQ A;  1CBQ A;  4YKO A;  2GTL N;  2MJI A;  1CRB A;  4QYP A;  4YKM A;  5H9K A;  3AEH A;  3OJY C;  2FR2 A;  2RTR B;  3I17 A;  4QGV A;  4NW4 A;  3ZQ3 A;  5IO6 A;  3G7X A;  4A8Z A;  1RAV A;  3DSZ A;  4OEL A;  3HWF A;  4GUZ A;  5L3Y A;  4LQZ A;  2ACO A;  2FGS A;  4ES7 A;  2NND A;  4O3W A;  4MEE A;  4ZH9 A;  1G74 A;  1P6P A;  1QFT A;  4FQB B;  2FTB A;  4HPA A;  1ALB A;  1Y0G A;  2L9C A;  3APX A;  4ZGF A;  1ZNE A;  1SWG A;  1ZNL A;  3U9P C;  1QAB E;  3BLG A;  4I6S A;  1Y9L A;  1HQP A;  1NQM A;  3HWG A;  1N7Y A;  1DZP A;  2R73 A;  3FA8 A;  3KVN A;  4B55 A;  2IZA A;  4GH7 A;  5HBS A;  5BYP A;  4WBK A;  4ZCB A;  1SWA A;  1HMS A;  1MEP A;  2KTS A;  2RTE B;  4MVK A;  2P8G A;  1B56 A;  1N4J A;  4TQ2 A;  3CQN A;  4NP1 A;  1W5R A;  3JS1 A;  5B3M O;  1BSQ A;  3EW1 A;  2PI3 O;  3WJF A;  2OF9 A;  3ZUI A;  3FR2 A;  3TZS A;  4L1N A;  2LBA A;  4ZR2 A;  1N9M A;  4K19 A;  4YCH A;  2W2B A;  5LJE A;  1DF3 A;  3CWK A;  1K24 A;  3APW A;  3DTQ A;  2G8C O;  1I9H A;  2AT5 X;  1FEN A;  1W4T A;  3P6C A;  2Y3F A;  5EZ2 A;  1SY1 A;  2K62 A;  5LJB A;  1IKJ A;  4BX6 A;  1SMP I;  5IXG A;  1PMP A;  3NQ9 A;  4O49 A;  3VPJ E;  3CQR A;  1VWD B;  2JU7 A;  3RDX A;  2CZT A;  4QGW A;  1EQD A;  1S44 A;  4Z2P A;  1SWO A;  1TVQ A;  1DFV A;  2O62 A;  4LKT A;  1U0X A;  4U8U O;  1JJJ A;  3O19 A;  1GX3 A;  2KTD A;  3F9D A;  1JMX A;  3FW4 A;  2IZI A;  3NR3 A;  4MVL A;  5BVQ A;  5IO7 A;  3OE3 A;  1GX8 A;  1UYN X;  2POA A;  1S2P A;  1SWP A;  2RTK A;  2MM3 A;  2YG2 A;  4OKA A;  2HZQ A;  4Z28 A;  4Y0P A;  1VWL B;  2KT4 B;  2OYB O;  2C1Q A;  4DQ3 A;  2Q9S A;  1KT5 A;  3STK A;  1SLG B;  3CKF A;  3PQU A;  5LJG A;  2FWV A;  1MUP A;  2XST A;  4ON1 A;  3LTW A;  4ZHH A;  5HZ6 A;  2WR6 A;  2QOM A;  5HA1 A;  1CJ5 A;  1ERX A;  2R74 A;  1E02 A;  1VWR B;  4M7M A;  4HPB A;  5K68 A;  3MBT A;  3VHM A;  2WEX A;  4ZHD A;  2LFO A;  1IKE A;  4CPH B;  4MIS A;  4EQA C;  4XMH A;  2RCQ A;  1FDQ A;  1YWA A;  1LKE A;  1YWD A;  1VPR A;  1LDQ A;  2FS7 A;  2IZG B;  2FR3 A;  3HTY A;  1YUP A;  2X56 A;  4GDZ A;  4XMF A;  4EXZ A;  1SWU A;  1HBQ A;  4XMC A;  5KIC A;  1BLR A;  4Y59 A;  1U17 A;  2A5C A;  5D48 A;  4YCE A;  3VHH A;  3B2J A;  4U46 A;  1LUQ A;  4Z6J A;  2K23 A;  1TXL A;  3FW5 A;  3FEN A;  4MVE A;  4OMW A;  5HCC C;  4ORS A;  2OFA A;  4DCB A;  2Y32 A;  3EBW A;  3LV4 A;  4O4S A;  3CBS A;  4GRJ A;  1VWI B;  4AZM A;  2G79 A;  3QQ2 A;  4GZV A;  4A60 A;  1Y9T A;  5HTD A;  1HXL A;  2G7B A;  2GTL M;  2UYW A;  3P6H A;  4R0B A;  1B4M A;  2IZJ A;  1E06 A;  4QNI A;  1BJ7 A;  5IRU A;  4ORY A;  4CSB A;  4XMD A;  4ZHF A;  4Y0Q A;  4IAW A;  1QWD A;  3UEV A;  1HN2 A;  2DJF A;  2WQA E;  3C76 X;  2RTO B;  4KCA A;  2X8T A;  1HQQ A;  1OEJ A;  3KQ0 A;  1NDJ A;  5LJH A;  2JGS A;  2X55 A;  1ERB A;  3GE2 A;  4CK4 A;  5FQ7 E;  4YFR A;  4HPC A;  1VYG A;  1B0O A;  2OVA A;  2W2F A;  3CR6 A;  3PDF A;  4EKV A;  1SWE A;  4YBU A;  4HFO A;  2X45 A;  2GTF X;  3T6L A;  3NAD A;  2AL0 X;  3WJB A;  5H8T A;  1AVD A;  4ZHG A;  3N91 A;  1VWH B;  3BDR A;  3APV A;  1GM6 A;  3FDC A;  2IFB A;  1S7D A;  2FS6 A;  5IRW A;  5D4A A;  5FFH A;  5AJB A;  1SRH A;  1SWH A;  3STN A;  3X00 A;  1VWG B;  1KGL A;  2HNX A;  2QOS C;  4WHI A;  2OVE A;  1MDC A;  2ASN X;  4FBV A;  2WWP A;  3RE5 A;  1HY2 A;  1R0U A;  2QO6 A;  3T2W A;  4LZV A;  2Q2M A;  2FKG A;  2OY8 A;  3BS2 A;  4IAX A;  5AJC A;  2QO5 A;  5D45 A;  3ZW1 B;  4BBO A;  1OBQ A;  2NP1 A;  4YBP A;  1YIV A;  1U18 A;  3KZA A;  4O9S A;  1VWF B;  2FT9 A;  3FA9 A;  4O3X B;  4DNE A;  4Z2O A;  3U0D A;  3JQO A;  4CDD A;  1KZX A;  3NQK A;  3CMP A;  1NGL A;  2IZD B;  2L67 A;  4NNT A;  3VU1 A;  1TOW A;  1MX8 A;  2OY7 A;  3RDS A;  1VWE B;  2A8G A;  5F1E A;  2CAM A;  2IZH B;  4O3Y A;  2X8F A;  5F6Z A;  4HPD A;  3V8U A;  3VG3 A;  4INN A;  4IRW A;  4IMO A;  1X71 A;  4BOE A;  1N9Y A;  4ORW A;  2F01 A;  5B27 A;  5LJD A;  2BLG A;  1AB0 A;  1FTP A;  1KT7 A;  3P24 A;  5K67 A;  2AT0 X;  2RTQ B;  3RDM A;  3HOL A;  4JO6 A;  4AW8 A;  1ML7 A;  2RTL A;  4FGI B;  4KT5 A;  3SAO A;  1I4U A;  4GK9 A;  2IZB A;  3STM X;  4YGH A;  1ICN A;  4QAE A;  3SOT A;  3VG7 A;  1LCW A;  5D8J A;  5HA0 A;  4CPI A;  3B2K A;  1ZND A;  1NP1 A;  3EBK A;  1STR B;  2FRS A;  1OPB A;  2PY1 A;  1MOY A;  5D47 A;  5H9A A;  1HXZ A;  1NBX A;  2KD2 A;  2LKK A;  1X89 A;  2OFR X;  2RA6 A;  1A2D A;  1CBS A;  2NNQ A;  4NLJ A;  4NV8 A;  4O3Z A;  4QQ1 A;  2X34 A;  4I95 A;  4UU3 A;  1D2U A;  2RN4 A;  4U3Q A;  1SXY A;  4U8U N;  4BX7 B;  3RE6 A;  2FKJ A;  1VWO B;  3C78 X;  1IJ8 A;  1I05 A;  3UEW A;  4D6B A;  4BGF A;  1MM9 A;  2YMS A;  3WYQ A;  1JZU A;  2NNE A;  4GNY A;  1IFB A;  5JD2 A;  2F73 A;  4PSQ A;  2AVI A;  4OS8 A;  1VYO A;  2JN3 A;  3WZN A;  3MX7 A;  4CPE A;  2Q39 A;  3QKG A;  4O4O A;  1L6M A;  2Q4N A;  3ZW2 A;  2Q2P A;  3ZZV A;  1X8U A;  1E2T A;  4KH8 A;  4CV7 A;  4O4X A;  1SY3 A;  3MM0 A;  5F7G A;  1JV4 A;  2RTM A;  1JJX A;  1EPB A;  1WUB A;  1NP4 A;  5KID A;  5FQ6 E;  2VFB A;  1SWK A;  2HMB A;  3SZJ A;  4TKJ A;  1JBH A;  3VG6 A;  4TNN A;  1KL3 A;  1VWA B;  1BM5 A;  1RST B;  1PTS A;  3FMZ A;  1VYF A;  2M4L A;  3Q6L A;  4YDB A;  2ACP X;  1HMT A;  2OZQ A;  1OBU A;  3PH6 A;  4Z27 A;  2IZC B;  5LKE A;  1CBI A;  1MK5 A;  1BEB A;  1O1U A;  2ZAG A;  4Z2V A;  1STP A;  3UEU A;  1LDO A;  4CDE A;  4YVB A;  2MO5 A;  5H9L A;  4Y5D A;  1RSU B;  5CE4 A;  1FJ1 E;  1VWM B;  1EXS A;  2KW1 A;  3KFH A;  4TJZ A;  1DF8 A;  2G78 A;  2I5Z O;  1A18 A;  3EC5 A;  4JGL A;  3TF6 A;  4ZHC A;  5FAZ A;  1Y53 X;  5L8O A;  5LJC A;  1OSP O;  4GU8 A;  5F2B A;  4ID2 A;  5BVT A;  1JJU A;  5EPQ A;  4TKH A;  4COT A;  1JQP A;  2AH7 X;  2DM5 A;  4FBO A;  3E3C A;  1OEE A;  1KL4 A;  1T0V A;  1SWQ A;  4OEM A;  1DV9 A;  4AYH A;  3AKM A;  3RDO A;  3S60 A;  1VWP B;  2RTJ A;  1SWF A;  1YWC A;  5HZ9 A;  5HTE A;  2FHN X;  4OS3 A;  1KT6 A;  4QYN A;  3SZH A;  3WZQ A;  1KT3 A;  1T8V A;  1X8N A;  2X4M A;  1BRP A;  3RSW A;  1URE A;  1PEE A;  2HYS A;  3K3L A;  3P6E A;  1RXK A;  3FR4 A;  1G85 A;  2CM9 A;  1KQW A;  1SWD A;  3VG5 A;  1EI5 A;  3BSZ E;  3AKN A;  1GGL A;  2RD7 C;  3IA8 A;  4RUU A;  2HKD A;  2MHD A;  2WSJ A;  1UYO X;  1X8O A;  3KFI A;  2X8S A;  5F58 A;  5HZQ A;  1GX9 A;  3S26 A;  3S5V A;  5B5G A;  3FA6 A;  4NYR A;  1SWJ A;  3WZO A;  1PM1 X;  1BRQ A;  2JU8 A;  3VE2 A;  3T2X A;  4Y0S A;  1NC9 A;  1PBY A;  3EMM A;  3D96 A;  2OF8 A;  3SLT A;  2C1S A;  4QZU A;  3SZI A;  3Q34 A;  4NNS A;  3O2Y A;  4GGZ A;  3WVM A;  4BX6 B;  4I3D A;  1HMR A;  3L4R A;  3H3I A;  4JHQ A;  2A2U A;  3VHI A;  2BSZ A;  2E4J A;  2GJ5 A;  3MG5 A;  4EDE A;  3JSQ A;  3PED A;  5IO5 A;  2CM4 A;  1EW3 A;  4KC8 A;  1IW2 A;  2WQ9 A;  3UAQ A;  4AZO A;  4BX5 B;  3MVF A;  4GJS A;  4AZR A;  1GT5 A;  3KFG A;  1VWJ B;  4U8U M;  1TOU A;  2A2G A;  3ZUO A;  2OY5 O;  3WBG A;  3ELX A;  1BWY A;  3HPE A;  4FBR A;  3FR5 A;  4GD9 A;  2ALL X;  5K06 A;  1EIO A;  3ZI8 A;  4IB9 A;  3BRN A;  3BY0 A;  3HWD A;  4ORU A;  4WFU A;  3ELZ A;  1LFO A;  2QMI A;  4CDF A;  4U9C A;  1VWB B;  1SWS A;  2A5B A;  4GET A;  1XKI A;  1EPA A;  1GT4 A;  3PEC A;  1H91 A;  4ORR A;  2R56 A;  2QM9 A;  2DJG A;  2G5L A;  2IZF B;  3LHN A;  4BJ8 A;  1ZNG A;  2IZE B;  4CPH A;  2RQ0 A;  3RDQ A;  2AMM X;  1K3B A;  4YGG A;  1LIC A;  5FQ8 E;  3NX2 A;  5CSE A;  4EEJ A;  1G5W A;  2JMB A;  3FEP A;  3D4R A;  2QO4 A;  3EM0 A;  4JNJ A;  4ZGU A;  5B2A O;  3FYF A;  5FEN A;  5EDC A;  1MVG A;  1BBP A;  1B8E A;  4ORX A;  3VGW A;  5HZ5 A;  1AVE A;  1WBI A;  3BU1 A;  3CKG A;  4ZFX A;  3F8A A;  3HOE A;  4IB6 A;  4M6S A;  3B2H A;  1XCA A;  1MX7 A;  4ZJ0 A;  5LKF A;  1JIW I;  1JYD A;  5C0N A;  1KT4 A;  1VWC B;  1SA8 A;  3HK1 A;  1DZK A;  5EED A;  1QG5 A;  4OMX A;  1SLD B;  3WJD A;  1SWR A;  1RLB E;  3OBL A;  4CPF A;  5H9N A;  4YDA A;  3EYC A;  3PQS A;  2BS6 A;  2AF5 A;  1LEL A;  4IAB A;  4QZT A;  4NV7 A;  3VG2 A;  1GKA B;  2GTL O;  2XKL A;  5AQ6 A;  5BVS A;  2VDF A;  3FEL A;  3RY1 A;  3B2L A;  4WFV A;  4ZH6 A;  1PBO A;  2OL8 O;  1ZNK A;  3BU9 A;  5F6B A;  4AZQ A;  2OVS A;  1EAL A;  2FLJ A;  1JYJ A;  2FHL A;  2IZK A;  1UZ2 X;  4HWM A;  4RUN A;  1N0S A;  1QFV A;  2BT9 A;  1OPA A;  1SWC A;  3APU A;  1LIF A;  5JR8 A;  1SWN A;  2N93 A;  3TGA A;  1FE3 A;  1N43 A;  1ZNH A;  1D3S A;  1ACD A;  1STS B;  1SRI A;  2I5V O;  1A3Y A;  4L3R A;  2A0A A;  1LCZ A;  4AZP A;  4UU2 A;  4GDA A;  2CBS A;  4AZN A;  2X46 A;  5B11 O;  1G7N A;  2AKQ A;  3PK2 A;  1BSY A;  3CBC A;  1KL5 A;  4I3B A;  2GC9 A;  3VE1 A;  5CHK A;  3RZY A;  1GT3 A;  1KQX A;  4N7D A;  1DZJ A;  1QY2 A;  3FA7 A;  4GKC A;  1A57 A;  1EII A;  1BSO A;  3BX7 A;  3T1D A;  2WEW A;  1SLE B;  1I06 A;  4BCS A;  3RY2 A;  4N7C A;  1YWB A;  4ARH A;  1ICM A;  2WPU A;  3F6Z B;  4BQU A;  3D95 A;  4BX5 A;  1QQS A;  3FID A;  3RDU A;  3TGB A;  1AEL A;  3OD9 A;  1VWN B;  2HLV A;  1TW4 A;  1SWL A;  2W2A A;  4GJV A;  1NQN A;  2AT3 X;  4I9R A;  3ZW1 A;  5KHP A;  2OL6 O;  4GGR A;  1O1V A;  3P6G A;  1LPJ A;  4GNW A;  1ADL A;  1Y55 X;  1AVG I;  2ZSC A;  2UZ2 A;  4I3C A;  1GT1 A;  1OEK A;  4CDC A;  5L8N A;  1DZM A;  3KFF A;  3ZW0 B;  2F09 A;  1SXW A;  5L8I A;  4C5P A;  2ANS A;  3AUM O;  3EW2 A;  5EEE A;  5B10 O;  3FLL A;  1RXH A;  3TGC A;  1DC9 A;  3D9W A;  3HWE A;  3PPT A;  4NLI A;  3VG4 A;  4XMG A;  1SRG A;  1LID A;  4ML7 B;  1SY2 A;  4ODD A;  5B5F A;  4I9S A;  1E5P A;  2RTI B;  2ZAI A;  1X8P A;  3NPO A;  3ZWE A;  2OVD A;  2MWH A;  5EDB A;  2AT6 X;  2JOZ A;  5HWZ A;  4ALB A;  1W6F A;  3O22 A;  3UEX A;  4BVM A;  2A3F X;  5DG4 A;  4IB8 A;  2Z4H A;  1VWK B;  3P02 A;  2QCB A;  4KC7 A;  3I0A A;  3WZP A;  4A1Y A;  4DQ4 A;  2L5P A;  4XME A;  1RBP A;  3NP1 A;  3NBX X;  2RTC B;  2RTH B;  4LZU A;  5CYB A;  2VFC A;  2Z4I A;  4OS0 A;  5AEO A;  1EUO A;  4MVI A;  4TLJ A;  1I04 A;  3FIQ A;  1LF7 A;  3PP6 A;  1YP7 A;  2L68 A;  3WOV A;  5HCD C;  1KXO A;  1SXU A;  4QRL A;  3WYP A;  1LNM A;  1E00 A;  1KFF A;  1T68 X;  1GKA A;  1IIU A;  3GAQ A;  4BX7 A;  3WXQ A;  3BX8 A;  4YFP A;  3P6D A;  4YH0 A;  3RWX A;  5B29 A;  1AQB A;  5LJK A;  1FEL A;  1SRE A; 
#chains in the Genus database with same CATH homology
 2IZL B;  3RE6 A;  4BJ8 A;  1VWO B;  2G5L A;  2IZF B;  4CPH A;  1IJ8 A;  2IZE B;  1VWR B;  1MM9 A;  3RDQ A;  3WYQ A;  5CSE A;  5JD2 A;  5K68 A;  2RTF B;  1LCV A;  3VHM A;  2AVI A;  4JNJ A;  4CPH B;  1VYO A;  2Y3E A;  2RTG B;  3WZN A;  4CPE A;  3VGW A;  2IZG B;  1LDQ A;  3T6F A;  1AVE A;  1SRJ A;  1WBI A;  4I60 A;  1SWB A;  1SWT A;  3MM0 A;  2GH7 A;  1SWU A;  2RTM A;  4Y59 A;  4GGT A;  2A5C A;  1RXJ A;  3VHH A;  1VWC B;  1SRF A;  2MF6 A;  4U46 A;  1SWK A;  1LUQ A;  3SZJ A;  4Z6J A;  1SLF B;  1KL3 A;  1VWQ B;  1VWA B;  4CPF A;  1RST B;  1PTS A;  1SLD B;  1SWR A;  2OFA A;  2Y32 A;  4Z27 A;  1LEL A;  2RTA A;  1VWI B;  1Y52 X;  2IZC B;  1MK5 A;  1HXL A;  2UYW A;  2BC3 A;  3RY1 A;  2IZJ A;  4Z2V A;  1STP A;  5IRU A;  1LDO A;  4BX7 B;  2FHL A;  2IZK A;  2C4I A;  2RTB B;  4YVB A;  1SWC A;  2RTP B;  2RTN B;  1SWN A;  1RSU B;  2OFB A;  1N43 A;  4Y5D A;  2RTO B;  1VWM B;  5IRA A;  2RTD B;  1HQQ A;  1DF8 A;  1SRI A;  1STS B;  1NDJ A;  1LCZ A;  2JGS A;  4GDA A;  1Y53 X;  3PK2 A;  2RTR B;  5F2B A;  1KL5 A;  5CHK A;  1RAV A;  4EKV A;  1SWE A;  3T6L A;  5L3Y A;  1AVD A;  1KL4 A;  1SWQ A;  1VWH B;  3RDS A;  1SLE B;  3FDC A;  3RDO A;  1VWP B;  2RTJ A;  1SWF A;  3RY2 A;  4BCS A;  1SWG A;  2FHN X;  2WPU A;  5IRW A;  3SZH A;  3WZQ A;  4BX5 A;  1SRH A;  1SWH A;  3X00 A;  3RDU A;  1NQM A;  1VWG B;  1N7Y A;  1VWN B;  1SWL A;  4GJV A;  1NQN A;  2IZA A;  1RXK A;  4GGR A;  1SWA A;  1MEP A;  3RE5 A;  2RTE B;  1Y55 X;  1HY2 A;  2ZSC A;  2UZ2 A;  1N4J A;  1SWD A;  3T2W A;  3EW1 A;  4BBO A;  2OF9 A;  3EW2 A;  1N9M A;  4Z2O A;  4DNE A;  1VWF B;  1RXH A;  5B5G A;  1I9H A;  2IZD B;  3WZO A;  1SWJ A;  1SRG A;  5B5F A;  2Y3F A;  1VWE B;  2A8G A;  2CAM A;  2RTI B;  4BX6 A;  2IZH B;  3T2X A;  1NC9 A;  2OF8 A;  2C1S A;  4IRW A;  1N9Y A;  3SZI A;  2F01 A;  4GGZ A;  4BX6 B;  1VWK B;  1VWD B;  4JHQ A;  5K67 A;  3RDX A;  2QCB A;  2RTQ B;  3VHI A;  4Z2P A;  3MG5 A;  1SWO A;  3RDM A;  3WZP A;  4JO6 A;  2RTC B;  2RTH B;  4BX5 B;  2RTL A;  4GJS A;  1VWJ B;  2IZB A;  2IZI A;  1LCW A;  4GD9 A;  3WYP A;  4CPI A;  2RTK A;  1SWP A;  1KFF A;  1STR B;  4OKA A;  1MOY A;  4Z28 A;  4BX7 A;  1HXZ A;  1VWL B;  2C1Q A;  1NBX A;  1SLG B;  1VWB B;  1SWS A;  2A5B A;  1SRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...