2MF9A

Solution structure of the n-terminal domain of human fkbp38 (fkbp38ntd)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
157
structure length
157
Chain Sequence
MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional role of the flexible N-terminal extension of FKBP38 in catalysis.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP8
molecule tags Apoptosis, isomerase
source organism Homo sapiens
total genus 30
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mf9A00
1F8AB 4DRKA 5HW6A 1D6OA 2LGOA 1W26A 1D7JA 2ZR5A 2XP6A 4JFLA 2XPAA 1NSGA 5D75A 4DRPA 2LPVA 3KADA 1FJDA 1P5QA 2M08A 1C9HA 1N1AA 2ZQTA 2UZ5A 3O5PA 3O5RA 4GIVA 2FAPA 4JFIA 5HW7A 1YATA 2F21A 3I6CA 3KACA 3MDYB 4IPXA 1Y0OA 4W9OA 4LAVA 5DIVA 2DG9A 1D7HA 4LAYA 2L2SA 3O5DA 2M1IA 3O5KA 5DIUA 1B6CA 2Y78A 1FKTA 3TC5A 1T11A 1FKHA 1FKDA 4DRMA 2AWGA 4LAWA 2KFWA 2LJ4A 3OOBA 5GPGA 1JNTA 4C02B 1J6YA 2MNTA 4ITZA 4DIPA 1JNSA 2ZQSA 2MF9A 5HUAA 4J4NA 3KAHA 4TYOA 2KGJA 4BF8A 4DZ2A 4TNSA 3UQBA 1HXVA 4DH0A 1U79A 1QPLA 1FD9A 2XPBA 2ZR4A 2Q5AA 4G50A 3O5LA 3RGCA 1BKFA 3O5JA 3PA7A 3O5QA 2RUQA 1BL4A 2PV1A 1FKBA 1FKLA 2KR7A 4U85A 4ODRA 3ODKA 2RQSA 1Q6HA 1FKSA 1TCOC 3O5OA 3PRDA 4ODNA 1FKKA 2MPHA 2PPOA 2K8IA 1J4HA 2F2DA 3EY6A 3JXVA 3O5EA 4DRJA 5HT1A 1EYMA 3PRBA 3TCZA 4ODPA 1FKFA 4JFJA 3NI6A 2M2AA 1D7IA 4DRHA 4QIBA 1NMVA 3CGMA 3UI5A 2OFNA 2MLZA 4JYSA 1QZ2A 2LKNA 1KT0A 1Q1CA 2KI3A 3IKDA 1JVWA 3LUOA 3O5GA 3O5FA 4TW6A 3B7XA 1FAPA 1YW5A 1ZK6A 2XP5A 4GGQA 5DITA 4R0XA 3NTPA 3JYJA 4LAXA 4ODMA 4QT2A 4DT4A 4G2PA 5HWCA 4U84A 3O5IA 3UQIA 1ZCNA 2PBCA 3O5MA 3VAWA 1Q6UA 3KAIA 2DG3A 3IKGA 2RURA 2N87A 1NMWA 1J4RA 3UQAA 4ODKA 4DROA 4DRQA 4DRNA 5HWBA 2MLXA 3KZ7A 1FKJA 3WH0A 2RUDA 1ROUA 2KE0A 2ZR6A 3IK8A 1FKRA 3KAGA 4QT3A 1Q6IA 2VCDA 2FKEA 4MSPA 4DZ3A 1J4IA 2XP4A 2XP7A 5HKGA 2RUCA 2VN1A 3KAFA 1PBKA 3NRKA 3IHZA 4IQ2A 2JZVA 4DRIA 4TX0A 5HTGA 3JYMA 1FKGA 2F4EA 2PPPA 2RSEA 1FKIA 3H9RB 2PV2A 4O2TA 5J6EA 3KCEA 4U86A 3UI6A 2IF4A 2ZQVA 2D9FA 2XP8A 5I98A 2DG4A 1PINA 2ITKA 3UF8A 1M5YA 2XP9A 2XP3A 4IQCA 1R9HA 4NNRA 4ODLA 4JFMA 1L1PA 4TW8A 4JFKA 3GPKA 4TW7A 4J4OA 4FAPA 1EQ3A 1KT1A 4FN2A 2KO7A 4W9PA 3FAPA 2MLYA 2PV3A 5HW8A 3CGNA 2PPNA 1ROTA 1QPFA 4ODOA 3UI4A 3KABA 5B8IC 5BXJA 4W9QA 4ODQA 4MGVA 3RFWA 3TDBA 1F40A 1A7XA 2ZQUA 4N19A
chains in the Genus database with same CATH superfamily
2A3EA 2YBUA 2G41A 2LGOA 4Z2KA 4UDMA 4ZPVR 5D75A 1H0GA 3PRAA 2LPVA 3KADA 1P5QA 4L3NA 5HW7A 3I6CA 3KACA 4IPXA 4W9OA 3WD1A 1HJWA 5DIVA 1WB0A 5DIUA 2G8ZA 1T11A 4DRMA 3OOBA 2LJ4A 1JNSA 1JNTA 2MNTA 4W5UA 4DIPA 1LJYA 2ZQSA 3B8SA 4DWSD 5HUAA 4J4NA 3KAHA 4TNSA 1U79A 2XPBA 1FD9A 1GUVA 2Q5AA 3RGCA 4P8XA 3O5JA 3O5QA 3ODKA 2RQSA 1K9TA 2DT2A 4MNJA 2F2DA 3EY6A 2ETNA 3PRBA 3CHCA 1JCHB 2LKNA 3LUOA 4TW6A 2KI3A 3O5GA 1FAPA 4S3KA 4LAXA 3JYJA 4DT4A 4Q7NA 1ZCNA 1ZL1A 2EULA 1Q6UA 3B9DA 3IKGA 3ARZA 1NMWA 3WD2A 1W1VA 4WJXA 1ROUA 2DT1A 4QT3A 4DZ3A 1Q6IA 4MSPA 2B5UB 1TFVA 2XP7A 4IQ2A 1FFRA 1FKIA 1WAWA 2XP8A 1PINA 1H0IA 2XP3A 4Z2HA 4ODLA 4NSBA 4DWSB 2WLZA 4WIWA 4Z2LA 4W9PA 2MLYA 2PV3A 5HW8A 3CGNA 2PPNA 3G6MA 4ODQA 3RFWA 4U84A 2ZQUA 1LL7A 2OLHA 4DRKA 1E44A 3ARRA 1OGGA 1D2KA 1W26A 2P4VA 2ZR5A 3AS3A 2XP6A 1NSGA 1FJDA 1OWQA 2M08A 1N1AA 3O5RA 4GIVA 4JFIA 2WM0A 3B9EA 1UR9A 1YATA 1Y0OA 4ZS6A 2DG9A 1X6LA 4LAYA 3O5DA 1B6CA 2Y78A 3TC5A 1FKDA 2A3CA 1OGBA 2AWGA 2DSWA 4P8WA 4ITZA 4Z2JA 2WLYA 2F23A 2MF9A 1W9PA 4BF8A 4DZ2A 1HKKA 1HXVA 4DH0A 4IT4A 4G50A 2ZR4A 2DSUA 1BL4A 4XAKA 3G6LA 1CTNA 2KR7A 4U85A 3WL1A 1Q6HA 4R5EA 3PRDA 1E6ZA 2MPHA 1UR8A 2PPOA 3GU0A 3B9AA 4Z2GA 5HT1A 1HKJA 1HJVA 4ODPA 2M2AA 1D7IA 1NMVA 3CGMA 3UI5A 4JYSA 3ALFA 3CH9A 1Q1CA 3IKDA 4WKHA 3B7XA 3EIPA 5DITA 1LG1A 3QOKA 4R0XA 3NTPA 4URIA 4ODMA 3WIJA 5HWCA 1NWSA 3UQIA 1W1PA 1WNOA 3KAIA 2PI6A 3BMBA 1J4RA 4ODKA 4ZPWR 4DROA 2MLXA 1ITXA 2KE0A 1LL6A 1FKRA 5HKGA 2AOSA 3NRKA 3WQVA 1E6NA 4O2TA 3H9RB 2A3BA 4DWSA 3AROA 4AY1A 1ZBVA 3KCEA 1RD6A 3UI6A 2ZQVA 2D9FA 2DG4A 1X6NA 3UF8A 3PR9A 2XP9A 3WD3A 2PN0A 4TW8A 1NWUA 3ARVA 4JFKA 4IT6A 3GPKA 1O6IA 4MNMA 2DPEA 4MAVA 3FY1A 4ODOA 3UI4A 5BXJA 3TDBA 1E9LA 3WL0A 1F40A 1L1PA 2RSEA 1A7XA 4N19A 5HW6A 1D6OA 1W9UA 4MPKA 3W4RA 4HBEA 2DSZA 4MTVA 4MNKA 2ZQTA 4Q22A 3RM9A 1ZBCA 3O5PA 2FAPA 3OA5A 4WK9A 2F21A 1E15A 2IUZA 4LAVA 1D7HA 4WKAA 1ZBWA 2L2SA 3O5KA 4NZCA 1FKTA 3ARTA 2B31A 4L72B 3AS1A 2KFWA 5GPGA 4C02B 1LL4A 1LQ0A 3O5LA 3WD4A 1BKFA 3PA7A 1HKMA 3RM4A 1FKSA 1TCOC 3O5OA 4ODNA 1J4HA 3JXVA 4DRJA 1EYMA 3TCZA 1ZB5A 4Z2IA 4LGXA 4JFJA 3NI6A 2DT3A 3AS0A 4ML4A 1NWRA 2MLZA 1QZ2A 3O5FA 1KT0A 1JVWA 1YW5A 2XP5A 3ALGA 2YBTA 4GGQA 4QT2A 4G2PA 2DT0A 3O5IA 2PBCA 2DSVA 2DG3A 5GQBA 3UQAA 5HWBA 3KZ7A 1FKJA 3WH0A 2RUDA 3IK8A 2VCDA 2FKEA 1J4IA 3ARWA 1LG2A 1W1YA 5JH8A 2RUCA 2VN1A 3IHZA 1JNDA 3CHEA 3FXYA 2JZVA 4P8VA 4DRIA 5HTGA 3JYMA 1XHGA 1FKGA 2PV2A 1NH6A 4S3JA 4PTMA 1E6RA 3ARUA 2IF4A 2ITKA 3AS2A 4DWSC 4NNRA 1EHNA 1W9VA 2O9OA 2ESCA 5HBFA 1HJXA 1ZBKA 3BXWA 5DEZA 1KT1A 4FN2A 2KO7A 1ZU8A 3FAPA 4HBOA 4MGVA 1KFWA 1GRJA 3ARXA 1F8AB 2WK2A 1D7JA 3CHDA 4JFLA 2XPAA 2QF8A 4DRPA 1EDQA 1C9HA 3WQWA 2UZ5A 3ARYA 3MDYB 3ARQA 2M1IA 3CZ8A 1NWTA 3AQUA 1GOIA 4KR0B 1FKHA 4LAWA 1J6YA 4P8UA 4TYOA 2KGJA 3UQBA 3RM8A 1QPLA 3RMEA 2FDMA 2RUQA 4MNLA 2PV1A 1XRVA 1FKBA 1FKLA 1FFQA 4ODRA 1HKIA 1FKKA 2K8IA 2A3AA 3ARSA 3O5EA 5DO2A 1FKFA 1IX5A 4KQZA 4DRHA 4QIBA 2OFNA 1EIBA 1E6PA 1ZK6A 2O92A 1JNEA 1VF8A 3O5MA 3VAWA 2RURA 2N87A 4QZVB 4HARA 4DRQA 4DRNA 2ZR6A 3KAGA 1SYTA 2XP4A 3KAFA 1PBKA 5GPRA 1W1TA 4TX0A 2F4EA 2PPPA 5J6EA 4U86A 5I98A 3GTYX 3CHFA 1SR0A 1M5YA 4IQCA 1R9HA 3WD0A 4JFMA 4WKFA 3WKZA 4ZPTR 4TW7A 4J4OA 4FAPA 1EQ3A 5DF0A 1ROTA 1QPFA 3KABA 5B8IC 4W9QA 1GPFA 3ARPA
chains in the Genus database with same CATH topology
2A3EA 2YBUA 2G41A 2LGOA 4Z2KA 4ZPVR 5D75A 1H0GA 3PRAA 2LPVA 3KADA 1P5QA 4L3NA 5HW7A 3I6CA 3KACA 4IPXA 4W9OA 3WD1A 1HJWA 5DIVA 1WB0A 5DIUA 2G8ZA 1T11A 4DRMA 3OOBA 2LJ4A 1JNSA 1JNTA 2MNTA 4W5UA 4DIPA 1LJYA 2ZQSA 3B8SA 4DWSD 5HUAA 4J4NA 3KAHA 4TNSA 1U79A 2XPBA 1FD9A 1GUVA 2Q5AA 3RGCA 4P8XA 3O5JA 3O5QA 3ODKA 2RQSA 1K9TA 2DT2A 4MNJA 2F2DA 3EY6A 3PRBA 3CHCA 2LKNA 3LUOA 4TW6A 2KI3A 3O5GA 1FAPA 4S3KA 4LAXA 3JYJA 4DT4A 4Q7NA 1ZCNA 1ZL1A 1Q6UA 3B9DA 3IKGA 3ARZA 1NMWA 3WD2A 1W1VA 4WJXA 1ROUA 2DT1A 4QT3A 4DZ3A 1Q6IA 4MSPA 1TFVA 2XP7A 4IQ2A 1FFRA 1FKIA 1WAWA 2XP8A 1PINA 1H0IA 2XP3A 4Z2HA 4ODLA 4NSBA 4DWSB 2WLZA 4WIWA 4Z2LA 4W9PA 2MLYA 2PV3A 5HW8A 3CGNA 2PPNA 3G6MA 4ODQA 3RFWA 4U84A 2ZQUA 1LL7A 2OLHA 4DRKA 3ARRA 1OGGA 1D2KA 1W26A 2ZR5A 3AS3A 2XP6A 1NSGA 1FJDA 1OWQA 2M08A 1N1AA 3O5RA 4GIVA 4JFIA 2WM0A 3B9EA 1UR9A 1YATA 1Y0OA 4ZS6A 2DG9A 1X6LA 4LAYA 3O5DA 1B6CA 2Y78A 3TC5A 1FKDA 2A3CA 1OGBA 2AWGA 2DSWA 4P8WA 4ITZA 4Z2JA 2WLYA 2MF9A 1W9PA 4BF8A 4DZ2A 1HKKA 1HXVA 4DH0A 4IT4A 4G50A 2ZR4A 2DSUA 1BL4A 4XAKA 3G6LA 1CTNA 2KR7A 4U85A 3WL1A 1Q6HA 4R5EA 3PRDA 1E6ZA 2MPHA 1UR8A 2PPOA 3B9AA 4Z2GA 5HT1A 1HKJA 1HJVA 4ODPA 2M2AA 1D7IA 1NMVA 3CGMA 3UI5A 4JYSA 3ALFA 3CH9A 1Q1CA 3IKDA 4WKHA 3B7XA 5DITA 1LG1A 3QOKA 4R0XA 3NTPA 4URIA 4ODMA 3WIJA 5HWCA 1NWSA 3UQIA 1W1PA 1WNOA 3KAIA 2PI6A 1J4RA 4ODKA 4ZPWR 4DROA 2MLXA 1ITXA 2KE0A 1LL6A 1FKRA 5HKGA 2AOSA 3NRKA 3WQVA 1E6NA 4O2TA 3H9RB 2A3BA 4DWSA 3AROA 4AY1A 1ZBVA 3KCEA 1RD6A 3UI6A 2ZQVA 2D9FA 2DG4A 1X6NA 3UF8A 3PR9A 2XP9A 3WD3A 4TW8A 1NWUA 3ARVA 4JFKA 4IT6A 3GPKA 1O6IA 4MNMA 2DPEA 4MAVA 3FY1A 4ODOA 3UI4A 5BXJA 3TDBA 1E9LA 3WL0A 1F40A 1L1PA 2RSEA 1A7XA 4N19A 5HW6A 1D6OA 1W9UA 4MPKA 3W4RA 4HBEA 2DSZA 4MTVA 4MNKA 2ZQTA 4Q22A 3RM9A 1ZBCA 3O5PA 2FAPA 3OA5A 4WK9A 2F21A 1E15A 2IUZA 4LAVA 1D7HA 4WKAA 1ZBWA 2L2SA 3O5KA 4NZCA 1FKTA 3ARTA 2B31A 4L72B 3AS1A 2KFWA 5GPGA 4C02B 1LL4A 1LQ0A 3O5LA 3WD4A 1BKFA 3PA7A 1HKMA 3RM4A 1FKSA 1TCOC 3O5OA 4ODNA 1J4HA 3JXVA 4DRJA 1EYMA 3TCZA 1ZB5A 4Z2IA 4LGXA 4JFJA 3NI6A 2DT3A 3AS0A 4ML4A 1NWRA 2MLZA 1QZ2A 3O5FA 1KT0A 1JVWA 1YW5A 2XP5A 3ALGA 2YBTA 4GGQA 4QT2A 4G2PA 2DT0A 3O5IA 2PBCA 2DSVA 2DG3A 5GQBA 3UQAA 5HWBA 3KZ7A 1FKJA 3WH0A 2RUDA 3IK8A 2VCDA 2FKEA 1J4IA 3ARWA 1LG2A 1W1YA 5JH8A 2RUCA 2VN1A 3IHZA 1JNDA 3CHEA 3FXYA 2JZVA 4P8VA 4DRIA 5HTGA 3JYMA 1XHGA 1FKGA 2PV2A 1NH6A 4S3JA 4PTMA 1E6RA 3ARUA 2IF4A 2ITKA 3AS2A 4DWSC 4NNRA 1EHNA 1W9VA 2O9OA 2ESCA 5HBFA 1HJXA 1ZBKA 3BXWA 5DEZA 1KT1A 4FN2A 2KO7A 1ZU8A 3FAPA 4HBOA 4MGVA 1KFWA 3ARXA 1F8AB 2WK2A 1D7JA 3CHDA 4JFLA 2XPAA 2QF8A 4DRPA 1EDQA 1C9HA 3WQWA 2UZ5A 3ARYA 3MDYB 3ARQA 2M1IA 3CZ8A 1NWTA 3AQUA 1GOIA 4KR0B 1FKHA 4LAWA 1J6YA 4P8UA 4TYOA 2KGJA 3UQBA 3RM8A 1QPLA 3RMEA 2FDMA 2RUQA 4MNLA 2PV1A 1XRVA 1FKBA 1FKLA 1FFQA 4ODRA 1HKIA 1FKKA 2K8IA 2A3AA 3ARSA 3O5EA 5DO2A 1FKFA 1IX5A 4KQZA 4DRHA 4QIBA 2OFNA 1EIBA 1E6PA 1ZK6A 2O92A 1JNEA 1VF8A 3O5MA 3VAWA 2RURA 2N87A 4QZVB 4HARA 4DRQA 4DRNA 2ZR6A 3KAGA 1SYTA 2XP4A 3KAFA 1PBKA 5GPRA 1W1TA 4TX0A 2F4EA 2PPPA 5J6EA 4U86A 5I98A 3CHFA 1SR0A 1M5YA 4IQCA 1R9HA 3WD0A 4JFMA 4WKFA 3WKZA 4ZPTR 4TW7A 4J4OA 4FAPA 1EQ3A 5DF0A 1ROTA 1QPFA 3KABA 5B8IC 4W9QA 1GPFA 3ARPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  4DRK A;  5HW6 A;  1D6O A;  2LGO A;  1W26 A;  1D7J A;  2ZR5 A;  2XP6 A;  4JFL A;  2XPA A;  1NSG A;  5D75 A;  4DRP A;  2LPV A;  3KAD A;  1FJD A;  1P5Q A;  2M08 A;  1C9H A;  1N1A A;  2ZQT A;  2UZ5 A;  3O5P A;  3O5R A;  4GIV A;  2FAP A;  4JFI A;  5HW7 A;  1YAT A;  2F21 A;  3I6C A;  3KAC A;  3MDY B;  4IPX A;  1Y0O A;  4W9O A;  4LAV A;  5DIV A;  2DG9 A;  1D7H A;  4LAY A;  2L2S A;  3O5D A;  2M1I A;  3O5K A;  5DIU A;  1B6C A;  2Y78 A;  1FKT A;  3TC5 A;  1T11 A;  1FKH A;  1FKD A;  4DRM A;  2AWG A;  4LAW A;  2KFW A;  2LJ4 A;  3OOB A;  5GPG A;  1JNT A;  4C02 B;  1J6Y A;  2MNT A;  4ITZ A;  4DIP A;  1JNS A;  2ZQS A;  2MF9 A;  5HUA A;  4J4N A;  3KAH A;  4TYO A;  2KGJ A;  4BF8 A;  4DZ2 A;  4TNS A;  3UQB A;  1HXV A;  4DH0 A;  1U79 A;  1QPL A;  1FD9 A;  2XPB A;  2ZR4 A;  2Q5A A;  4G50 A;  3O5L A;  3RGC A;  1BKF A;  3O5J A;  3PA7 A;  3O5Q A;  2RUQ A;  1BL4 A;  2PV1 A;  1FKB A;  1FKL A;  2KR7 A;  4U85 A;  4ODR A;  3ODK A;  2RQS A;  1Q6H A;  1FKS A;  1TCO C;  3O5O A;  3PRD A;  4ODN A;  1FKK A;  2MPH A;  2PPO A;  2K8I A;  1J4H A;  2F2D A;  3EY6 A;  3JXV A;  3O5E A;  4DRJ A;  5HT1 A;  1EYM A;  3PRB A;  3TCZ A;  4ODP A;  1FKF A;  4JFJ A;  3NI6 A;  2M2A A;  1D7I A;  4DRH A;  4QIB A;  1NMV A;  3CGM A;  3UI5 A;  2OFN A;  2MLZ A;  4JYS A;  1QZ2 A;  2LKN A;  1KT0 A;  1Q1C A;  2KI3 A;  3IKD A;  1JVW A;  3LUO A;  3O5G A;  3O5F A;  4TW6 A;  3B7X A;  1FAP A;  1YW5 A;  1ZK6 A;  2XP5 A;  4GGQ A;  5DIT A;  4R0X A;  3NTP A;  3JYJ A;  4LAX A;  4ODM A;  4QT2 A;  4DT4 A;  4G2P A;  5HWC A;  4U84 A;  3O5I A;  3UQI A;  1ZCN A;  2PBC A;  3O5M A;  3VAW A;  1Q6U A;  3KAI A;  2DG3 A;  3IKG A;  2RUR A;  2N87 A;  1NMW A;  1J4R A;  3UQA A;  4ODK A;  4DRO A;  4DRQ A;  4DRN A;  5HWB A;  2MLX A;  3KZ7 A;  1FKJ A;  3WH0 A;  2RUD A;  1ROU A;  2KE0 A;  2ZR6 A;  3IK8 A;  1FKR A;  3KAG A;  4QT3 A;  1Q6I A;  2VCD A;  2FKE A;  4MSP A;  4DZ3 A;  1J4I A;  2XP4 A;  2XP7 A;  5HKG A;  2RUC A;  2VN1 A;  3KAF A;  1PBK A;  3NRK A;  3IHZ A;  4IQ2 A;  2JZV A;  4DRI A;  4TX0 A;  5HTG A;  3JYM A;  1FKG A;  2F4E A;  2PPP A;  2RSE A;  1FKI A;  3H9R B;  2PV2 A;  4O2T A;  5J6E A;  3KCE A;  4U86 A;  3UI6 A;  2IF4 A;  2ZQV A;  2D9F A;  2XP8 A;  5I98 A;  2DG4 A;  1PIN A;  2ITK A;  3UF8 A;  1M5Y A;  2XP9 A;  2XP3 A;  4IQC A;  1R9H A;  4NNR A;  4ODL A;  4JFM A;  1L1P A;  4TW8 A;  4JFK A;  3GPK A;  4TW7 A;  4J4O A;  4FAP A;  1EQ3 A;  1KT1 A;  4FN2 A;  2KO7 A;  4W9P A;  3FAP A;  2MLY A;  2PV3 A;  5HW8 A;  3CGN A;  2PPN A;  1ROT A;  1QPF A;  4ODO A;  3UI4 A;  3KAB A;  5B8I C;  5BXJ A;  4W9Q A;  4ODQ A;  4MGV A;  3RFW A;  3TDB A;  1F40 A;  1A7X A;  2ZQU A;  4N19 A; 
#chains in the Genus database with same CATH topology
 2A3E A;  2YBU A;  2G41 A;  2LGO A;  4Z2K A;  4UDM A;  4ZPV R;  5D75 A;  1H0G A;  3PRA A;  2LPV A;  3KAD A;  1P5Q A;  4L3N A;  5HW7 A;  3I6C A;  3KAC A;  4IPX A;  4W9O A;  3WD1 A;  1HJW A;  5DIV A;  1WB0 A;  5DIU A;  2G8Z A;  1T11 A;  4DRM A;  3OOB A;  2LJ4 A;  1JNS A;  1JNT A;  2MNT A;  4W5U A;  4DIP A;  1LJY A;  2ZQS A;  3B8S A;  4DWS D;  5HUA A;  4J4N A;  3KAH A;  4TNS A;  1U79 A;  2XPB A;  1FD9 A;  1GUV A;  2Q5A A;  3RGC A;  4P8X A;  3O5J A;  3O5Q A;  3ODK A;  2RQS A;  1K9T A;  2DT2 A;  4MNJ A;  2F2D A;  3EY6 A;  2ETN A;  3PRB A;  3CHC A;  1JCH B;  2LKN A;  3LUO A;  4TW6 A;  2KI3 A;  3O5G A;  1FAP A;  4S3K A;  4LAX A;  3JYJ A;  4DT4 A;  4Q7N A;  1ZCN A;  1ZL1 A;  2EUL A;  1Q6U A;  3B9D A;  3IKG A;  3ARZ A;  1NMW A;  3WD2 A;  1W1V A;  4WJX A;  1ROU A;  2DT1 A;  4QT3 A;  4DZ3 A;  1Q6I A;  4MSP A;  2B5U B;  1TFV A;  2XP7 A;  4IQ2 A;  1FFR A;  1FKI A;  1WAW A;  2XP8 A;  1PIN A;  1H0I A;  2XP3 A;  4Z2H A;  4ODL A;  4NSB A;  4DWS B;  2WLZ A;  4WIW A;  4Z2L A;  4W9P A;  2MLY A;  2PV3 A;  5HW8 A;  3CGN A;  2PPN A;  3G6M A;  4ODQ A;  3RFW A;  4U84 A;  2ZQU A;  1LL7 A;  2OLH A;  4DRK A;  1E44 A;  3ARR A;  1OGG A;  1D2K A;  1W26 A;  2P4V A;  2ZR5 A;  3AS3 A;  2XP6 A;  1NSG A;  1FJD A;  1OWQ A;  2M08 A;  1N1A A;  3O5R A;  4GIV A;  4JFI A;  2WM0 A;  3B9E A;  1UR9 A;  1YAT A;  1Y0O A;  4ZS6 A;  2DG9 A;  1X6L A;  4LAY A;  3O5D A;  1B6C A;  2Y78 A;  3TC5 A;  1FKD A;  2A3C A;  1OGB A;  2AWG A;  2DSW A;  4P8W A;  4ITZ A;  4Z2J A;  2WLY A;  2F23 A;  2MF9 A;  1W9P A;  4BF8 A;  4DZ2 A;  1HKK A;  1HXV A;  4DH0 A;  4IT4 A;  4G50 A;  2ZR4 A;  2DSU A;  1BL4 A;  4XAK A;  3G6L A;  1CTN A;  2KR7 A;  4U85 A;  3WL1 A;  1Q6H A;  4R5E A;  3PRD A;  1E6Z A;  2MPH A;  1UR8 A;  2PPO A;  3GU0 A;  3B9A A;  4Z2G A;  5HT1 A;  1HKJ A;  1HJV A;  4ODP A;  2M2A A;  1D7I A;  1NMV A;  3CGM A;  3UI5 A;  4JYS A;  3ALF A;  3CH9 A;  1Q1C A;  3IKD A;  4WKH A;  3B7X A;  3EIP A;  5DIT A;  1LG1 A;  3QOK A;  4R0X A;  3NTP A;  4URI A;  4ODM A;  3WIJ A;  5HWC A;  1NWS A;  3UQI A;  1W1P A;  1WNO A;  3KAI A;  2PI6 A;  3BMB A;  1J4R A;  4ODK A;  4ZPW R;  4DRO A;  2MLX A;  1ITX A;  2KE0 A;  1LL6 A;  1FKR A;  5HKG A;  2AOS A;  3NRK A;  3WQV A;  1E6N A;  4O2T A;  3H9R B;  2A3B A;  4DWS A;  3ARO A;  4AY1 A;  1ZBV A;  3KCE A;  1RD6 A;  3UI6 A;  2ZQV A;  2D9F A;  2DG4 A;  1X6N A;  3UF8 A;  3PR9 A;  2XP9 A;  3WD3 A;  2PN0 A;  4TW8 A;  1NWU A;  3ARV A;  4JFK A;  4IT6 A;  3GPK A;  1O6I A;  4MNM A;  2DPE A;  4MAV A;  3FY1 A;  4ODO A;  3UI4 A;  5BXJ A;  3TDB A;  1E9L A;  3WL0 A;  1F40 A;  1L1P A;  2RSE A;  1A7X A;  4N19 A;  5HW6 A;  1D6O A;  1W9U A;  4MPK A;  3W4R A;  4HBE A;  2DSZ A;  4MTV A;  4MNK A;  2ZQT A;  4Q22 A;  3RM9 A;  1ZBC A;  3O5P A;  2FAP A;  3OA5 A;  4WK9 A;  2F21 A;  1E15 A;  2IUZ A;  4LAV A;  1D7H A;  4WKA A;  1ZBW A;  2L2S A;  3O5K A;  4NZC A;  1FKT A;  3ART A;  2B31 A;  4L72 B;  3AS1 A;  2KFW A;  5GPG A;  4C02 B;  1LL4 A;  1LQ0 A;  3O5L A;  3WD4 A;  1BKF A;  3PA7 A;  1HKM A;  3RM4 A;  1FKS A;  1TCO C;  3O5O A;  4ODN A;  1J4H A;  3JXV A;  4DRJ A;  1EYM A;  3TCZ A;  1ZB5 A;  4Z2I A;  4LGX A;  4JFJ A;  3NI6 A;  2DT3 A;  3AS0 A;  4ML4 A;  1NWR A;  2MLZ A;  1QZ2 A;  3O5F A;  1KT0 A;  1JVW A;  1YW5 A;  2XP5 A;  3ALG A;  2YBT A;  4GGQ A;  4QT2 A;  4G2P A;  2DT0 A;  3O5I A;  2PBC A;  2DSV A;  2DG3 A;  5GQB A;  3UQA A;  5HWB A;  3KZ7 A;  1FKJ A;  3WH0 A;  2RUD A;  3IK8 A;  2VCD A;  2FKE A;  1J4I A;  3ARW A;  1LG2 A;  1W1Y A;  5JH8 A;  2RUC A;  2VN1 A;  3IHZ A;  1JND A;  3CHE A;  3FXY A;  2JZV A;  4P8V A;  4DRI A;  5HTG A;  3JYM A;  1XHG A;  1FKG A;  2PV2 A;  1NH6 A;  4S3J A;  4PTM A;  1E6R A;  3ARU A;  2IF4 A;  2ITK A;  3AS2 A;  4DWS C;  4NNR A;  1EHN A;  1W9V A;  2O9O A;  2ESC A;  5HBF A;  1HJX A;  1ZBK A;  3BXW A;  5DEZ A;  1KT1 A;  4FN2 A;  2KO7 A;  1ZU8 A;  3FAP A;  4HBO A;  4MGV A;  1KFW A;  1GRJ A;  3ARX A;  1F8A B;  2WK2 A;  1D7J A;  3CHD A;  4JFL A;  2XPA A;  2QF8 A;  4DRP A;  1EDQ A;  1C9H A;  3WQW A;  2UZ5 A;  3ARY A;  3MDY B;  3ARQ A;  2M1I A;  3CZ8 A;  1NWT A;  3AQU A;  1GOI A;  4KR0 B;  1FKH A;  4LAW A;  1J6Y A;  4P8U A;  4TYO A;  2KGJ A;  3UQB A;  3RM8 A;  1QPL A;  3RME A;  2FDM A;  2RUQ A;  4MNL A;  2PV1 A;  1XRV A;  1FKB A;  1FKL A;  1FFQ A;  4ODR A;  1HKI A;  1FKK A;  2K8I A;  2A3A A;  3ARS A;  3O5E A;  5DO2 A;  1FKF A;  1IX5 A;  4KQZ A;  4DRH A;  4QIB A;  2OFN A;  1EIB A;  1E6P A;  1ZK6 A;  2O92 A;  1JNE A;  1VF8 A;  3O5M A;  3VAW A;  2RUR A;  2N87 A;  4QZV B;  4HAR A;  4DRQ A;  4DRN A;  2ZR6 A;  3KAG A;  1SYT A;  2XP4 A;  3KAF A;  1PBK A;  5GPR A;  1W1T A;  4TX0 A;  2F4E A;  2PPP A;  5J6E A;  4U86 A;  5I98 A;  3GTY X;  3CHF A;  1SR0 A;  1M5Y A;  4IQC A;  1R9H A;  3WD0 A;  4JFM A;  4WKF A;  3WKZ A;  4ZPT R;  4TW7 A;  4J4O A;  4FAP A;  1EQ3 A;  5DF0 A;  1ROT A;  1QPF A;  3KAB A;  5B8I C;  4W9Q A;  1GPF A;  3ARP A; 
#chains in the Genus database with same CATH homology
 2A3E A;  2YBU A;  2G41 A;  2LGO A;  4Z2K A;  4ZPV R;  5D75 A;  1H0G A;  3PRA A;  2LPV A;  3KAD A;  1P5Q A;  4L3N A;  5HW7 A;  3I6C A;  3KAC A;  4IPX A;  4W9O A;  3WD1 A;  1HJW A;  5DIV A;  1WB0 A;  5DIU A;  2G8Z A;  1T11 A;  4DRM A;  3OOB A;  2LJ4 A;  1JNS A;  1JNT A;  2MNT A;  4W5U A;  4DIP A;  1LJY A;  2ZQS A;  3B8S A;  4DWS D;  5HUA A;  4J4N A;  3KAH A;  4TNS A;  1U79 A;  2XPB A;  1FD9 A;  1GUV A;  2Q5A A;  3RGC A;  4P8X A;  3O5J A;  3O5Q A;  3ODK A;  2RQS A;  1K9T A;  2DT2 A;  4MNJ A;  2F2D A;  3EY6 A;  3PRB A;  3CHC A;  2LKN A;  3LUO A;  4TW6 A;  2KI3 A;  3O5G A;  1FAP A;  4S3K A;  4LAX A;  3JYJ A;  4DT4 A;  4Q7N A;  1ZCN A;  1ZL1 A;  1Q6U A;  3B9D A;  3IKG A;  3ARZ A;  1NMW A;  3WD2 A;  1W1V A;  4WJX A;  1ROU A;  2DT1 A;  4QT3 A;  4DZ3 A;  1Q6I A;  4MSP A;  1TFV A;  2XP7 A;  4IQ2 A;  1FFR A;  1FKI A;  1WAW A;  2XP8 A;  1PIN A;  1H0I A;  2XP3 A;  4Z2H A;  4ODL A;  4NSB A;  4DWS B;  2WLZ A;  4WIW A;  4Z2L A;  4W9P A;  2MLY A;  2PV3 A;  5HW8 A;  3CGN A;  2PPN A;  3G6M A;  4ODQ A;  3RFW A;  4U84 A;  2ZQU A;  1LL7 A;  2OLH A;  4DRK A;  3ARR A;  1OGG A;  1D2K A;  1W26 A;  2ZR5 A;  3AS3 A;  2XP6 A;  1NSG A;  1FJD A;  1OWQ A;  2M08 A;  1N1A A;  3O5R A;  4GIV A;  4JFI A;  2WM0 A;  3B9E A;  1UR9 A;  1YAT A;  1Y0O A;  4ZS6 A;  2DG9 A;  1X6L A;  4LAY A;  3O5D A;  1B6C A;  2Y78 A;  3TC5 A;  1FKD A;  2A3C A;  1OGB A;  2AWG A;  2DSW A;  4P8W A;  4ITZ A;  4Z2J A;  2WLY A;  2MF9 A;  1W9P A;  4BF8 A;  4DZ2 A;  1HKK A;  1HXV A;  4DH0 A;  4IT4 A;  4G50 A;  2ZR4 A;  2DSU A;  1BL4 A;  4XAK A;  3G6L A;  1CTN A;  2KR7 A;  4U85 A;  3WL1 A;  1Q6H A;  4R5E A;  3PRD A;  1E6Z A;  2MPH A;  1UR8 A;  2PPO A;  3B9A A;  4Z2G A;  5HT1 A;  1HKJ A;  1HJV A;  4ODP A;  2M2A A;  1D7I A;  1NMV A;  3CGM A;  3UI5 A;  4JYS A;  3ALF A;  3CH9 A;  1Q1C A;  3IKD A;  4WKH A;  3B7X A;  5DIT A;  1LG1 A;  3QOK A;  4R0X A;  3NTP A;  4URI A;  4ODM A;  3WIJ A;  5HWC A;  1NWS A;  3UQI A;  1W1P A;  1WNO A;  3KAI A;  2PI6 A;  1J4R A;  4ODK A;  4ZPW R;  4DRO A;  2MLX A;  1ITX A;  2KE0 A;  1LL6 A;  1FKR A;  5HKG A;  2AOS A;  3NRK A;  3WQV A;  1E6N A;  4O2T A;  3H9R B;  2A3B A;  4DWS A;  3ARO A;  4AY1 A;  1ZBV A;  3KCE A;  1RD6 A;  3UI6 A;  2ZQV A;  2D9F A;  2DG4 A;  1X6N A;  3UF8 A;  3PR9 A;  2XP9 A;  3WD3 A;  4TW8 A;  1NWU A;  3ARV A;  4JFK A;  4IT6 A;  3GPK A;  1O6I A;  4MNM A;  2DPE A;  4MAV A;  3FY1 A;  4ODO A;  3UI4 A;  5BXJ A;  3TDB A;  1E9L A;  3WL0 A;  1F40 A;  1L1P A;  2RSE A;  1A7X A;  4N19 A;  5HW6 A;  1D6O A;  1W9U A;  4MPK A;  3W4R A;  4HBE A;  2DSZ A;  4MTV A;  4MNK A;  2ZQT A;  4Q22 A;  3RM9 A;  1ZBC A;  3O5P A;  2FAP A;  3OA5 A;  4WK9 A;  2F21 A;  1E15 A;  2IUZ A;  4LAV A;  1D7H A;  4WKA A;  1ZBW A;  2L2S A;  3O5K A;  4NZC A;  1FKT A;  3ART A;  2B31 A;  4L72 B;  3AS1 A;  2KFW A;  5GPG A;  4C02 B;  1LL4 A;  1LQ0 A;  3O5L A;  3WD4 A;  1BKF A;  3PA7 A;  1HKM A;  3RM4 A;  1FKS A;  1TCO C;  3O5O A;  4ODN A;  1J4H A;  3JXV A;  4DRJ A;  1EYM A;  3TCZ A;  1ZB5 A;  4Z2I A;  4LGX A;  4JFJ A;  3NI6 A;  2DT3 A;  3AS0 A;  4ML4 A;  1NWR A;  2MLZ A;  1QZ2 A;  3O5F A;  1KT0 A;  1JVW A;  1YW5 A;  2XP5 A;  3ALG A;  2YBT A;  4GGQ A;  4QT2 A;  4G2P A;  2DT0 A;  3O5I A;  2PBC A;  2DSV A;  2DG3 A;  5GQB A;  3UQA A;  5HWB A;  3KZ7 A;  1FKJ A;  3WH0 A;  2RUD A;  3IK8 A;  2VCD A;  2FKE A;  1J4I A;  3ARW A;  1LG2 A;  1W1Y A;  5JH8 A;  2RUC A;  2VN1 A;  3IHZ A;  1JND A;  3CHE A;  3FXY A;  2JZV A;  4P8V A;  4DRI A;  5HTG A;  3JYM A;  1XHG A;  1FKG A;  2PV2 A;  1NH6 A;  4S3J A;  4PTM A;  1E6R A;  3ARU A;  2IF4 A;  2ITK A;  3AS2 A;  4DWS C;  4NNR A;  1EHN A;  1W9V A;  2O9O A;  2ESC A;  5HBF A;  1HJX A;  1ZBK A;  3BXW A;  5DEZ A;  1KT1 A;  4FN2 A;  2KO7 A;  1ZU8 A;  3FAP A;  4HBO A;  4MGV A;  1KFW A;  3ARX A;  1F8A B;  2WK2 A;  1D7J A;  3CHD A;  4JFL A;  2XPA A;  2QF8 A;  4DRP A;  1EDQ A;  1C9H A;  3WQW A;  2UZ5 A;  3ARY A;  3MDY B;  3ARQ A;  2M1I A;  3CZ8 A;  1NWT A;  3AQU A;  1GOI A;  4KR0 B;  1FKH A;  4LAW A;  1J6Y A;  4P8U A;  4TYO A;  2KGJ A;  3UQB A;  3RM8 A;  1QPL A;  3RME A;  2FDM A;  2RUQ A;  4MNL A;  2PV1 A;  1XRV A;  1FKB A;  1FKL A;  1FFQ A;  4ODR A;  1HKI A;  1FKK A;  2K8I A;  2A3A A;  3ARS A;  3O5E A;  5DO2 A;  1FKF A;  1IX5 A;  4KQZ A;  4DRH A;  4QIB A;  2OFN A;  1EIB A;  1E6P A;  1ZK6 A;  2O92 A;  1JNE A;  1VF8 A;  3O5M A;  3VAW A;  2RUR A;  2N87 A;  4QZV B;  4HAR A;  4DRQ A;  4DRN A;  2ZR6 A;  3KAG A;  1SYT A;  2XP4 A;  3KAF A;  1PBK A;  5GPR A;  1W1T A;  4TX0 A;  2F4E A;  2PPP A;  5J6E A;  4U86 A;  5I98 A;  3CHF A;  1SR0 A;  1M5Y A;  4IQC A;  1R9H A;  3WD0 A;  4JFM A;  4WKF A;  3WKZ A;  4ZPT R;  4TW7 A;  4J4O A;  4FAP A;  1EQ3 A;  5DF0 A;  1ROT A;  1QPF A;  3KAB A;  5B8I C;  4W9Q A;  1GPF A;  3ARP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...