2MF9A

Solution structure of the n-terminal domain of human fkbp38 (fkbp38ntd)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
157
structure length
157
Chain Sequence
MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP8
publication title Functional role of the flexible N-terminal extension of FKBP38 in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, isomerase
total genus 30
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mf9A00
1ROTA 4TW8A 1U79A 2MF9A 5BXJA 1FJDA 2XPAA 2ZQSA 2LKNA 1FKKA 4JYSA 1BKFA 2ZR5A 3IHZA 2DG9A 4LAYA 1L1PA 2RQSA 3NRKA 4DRIA 1FKJA 2PV2A 2PPOA 2LPVA 3CGNA 3O5EA 3CGMA 2OFNA 4ODMA 4DRHA 3EY6A 3O5FA 4ODQA 4DRKA 2Y78A 2PV3A 2XP4A 1B6CA 2LGOA 2RURA 5HW6A 1JNSA 2IF4A 2ZR4A 2KR7A 5HKGA 4ODKA 2RUQA 3O5JA 1FKTA 2XP7A 5J6EA 1BL4A 1J4IA 2N87A 3O5PA 3KACA 5DIVA 3WH0A 1FKSA 2KI3A 2MLZA 3PA7A 4ODRA 2ZQVA 1ZK6A 2XP3A 2XP9A 2KO7A 1NMWA 2K8IA 3O5OA 4IQCA 5GPGA 5HTGA 1J6YA 1FKFA 4JFMA 3H9RB 4J4OA 2F4EA 1F8AB 2VCDA 3UQBA 3IKDA 2MPHA 1FKIA 4IPXA 3ODKA 4JFJA 3KAHA 1FKLA 1R9HA 2D9FA 2MNTA 4FAPA 1Q1CA 3JYJA 4TYOA 4U86A 2PPPA 3UQIA 3NI6A 3O5IA 4DH0A 3KAIA 5HUAA 4DRNA 4J4NA 3UI5A 1JVWA 5DITA 3O5KA 4ODPA 1T11A 2FAPA 2F21A 2ZQTA 3O5QA 4N19A 4ODNA 1NMVA 3RFWA 4DZ2A 3KAFA 1N1AA 3JXVA 3JYMA 5D75A 3GPKA 3B7XA 1HXVA 4DRMA 4W9QA 4DRPA 3NTPA 4TX0A 1D6OA 1ROUA 2RSEA 4JFIA 4QT2A 2F2DA 3TCZA 3UI4A 2M2AA 4NNRA 4LAWA 3VAWA 3UQAA 2AWGA 1FKGA 1Q6IA 2RUDA 1FD9A 4LAVA 4O2TA 1QPLA 2PBCA 1FKRA 1A7XA 4DZ3A 2ITKA 5HT1A 2L2SA 1ZCNA 2Q5AA 4FN2A 4BF8A 3O5DA 5HWCA 5I98A 1QPFA 3PRBA 3OOBA 3RGCA 3O5MA 2PPNA 1D7HA 4DRQA 1FKHA 1W26A 2ZQUA 1YATA 5DIUA 1YW5A 2ZR6A 2XPBA 2KFWA 2MLXA 2DG4A 3MDYB 3IKGA 3O5GA 3I6CA 3IK8A 4GGQA 1FKBA 1F40A 2M1IA 4G50A 3TC5A 2XP6A 3FAPA 4IQ2A 1KT1A 1J4RA 2XP8A 3KADA 3O5RA 4C02B 3PRDA 4DRJA 3KCEA 3UF8A 1QZ2A 1J4HA 4U85A 4ODOA 4DROA 1KT0A 4QIBA 2FKEA 1M5YA 2DG3A 3KZ7A 4W9OA 5HW8A 1FAPA 1D7IA 2M08A 2XP5A 3O5LA 1P5QA 4GIVA 4LAXA 4QT3A 1PINA 1Q6HA 4ITZA 2KGJA 4W9PA 2VN1A 5HWBA 3KABA 4JFLA 4G2PA 1C9HA 1JNTA 2PV1A 3KAGA 4TW6A 1EQ3A 2RUCA 1D7JA 2UZ5A 3UI6A 2KE0A 4R0XA 2JZVA 1PBKA 1FKDA 1NSGA 1Y0OA 4JFKA 4TNSA 1EYMA 2MLYA 4ODLA 4MGVA 4TW7A 3TDBA 4DT4A 2LJ4A 4MSPA 3LUOA 1TCOC 5B8IC 4DIPA 4U84A 1Q6UA 5HW7A
chains in the Genus database with same CATH superfamily
1W1TA 1FJDA 1LL7A 3GTYX 4MNLA 1FKJA 2PPOA 1HKIA 3WL1A 4ODMA 3GU0A 3EIPA 2Y78A 2XP4A 1B6CA 2WLYA 1JNSA 1ZU8A 3ARZA 2DPEA 2ZR4A 5HKGA 5J6EA 4ODKA 2RUQA 1RD6A 1J4IA 3RM9A 3ARVA 2KI3A 3ARWA 4UDMA 3ARXA 3PA7A 1ZK6A 2XP3A 2K8IA 5GPGA 1FKFA 3PRAA 1FKIA 4IPXA 2PN0A 3ODKA 4JFJA 4Z2KA 2FDMA 4KQZA 1FKLA 1JNEA 3NI6A 2AOSA 4MNJA 4DRNA 4J4NA 1JVWA 1XHGA 5DITA 3O5KA 3ARTA 3AQUA 2F21A 4DZ2A 3JYMA 4LGXA 3GPKA 3B7XA 1HXVA 4W9QA 4WKFA 3NTPA 2F23A 3TCZA 3PR9A 1NWRA 1FD9A 1LQ0A 1FKRA 1QPLA 4DZ3A 4PTMA 4W5UA 2DSZA 4FN2A 3BMBA 2A3CA 5I98A 3PRBA 3OOBA 3O5MA 1ZL1A 3CHCA 5DIUA 2XPBA 1NWSA 3MDYB 3IKGA 3O5GA 1W9UA 4GGQA 5HBFA 3B9AA 4G50A 3ARUA 3RMEA 3FAPA 4IQ2A 1J4RA 3CHFA 2XP8A 3O5RA 3WKZA 2DSWA 1J4HA 3B9EA 4NSBA 4ODOA 4U85A 1E9LA 1K9TA 1D7IA 1FAPA 2M08A 2XP5A 4ZPVR 4QT3A 4ITZA 2VN1A 3KABA 1C9HA 3KAGA 2RUCA 3UI6A 1FKDA 4TNSA 3RM8A 1EYMA 4ODLA 4DT4A 3LUOA 2G8ZA 4Q7NA 2DT0A 2P4VA 3B9DA 1ROTA 1U79A 2MF9A 5BXJA 3ARRA 1FKKA 4WIWA 2ZR5A 3IHZA 4IT4A 1L1PA 1EHNA 4KR0B 3AS1A 4Z2LA 1EDQA 3EY6A 4ODQA 4DRKA 4S3KA 2LGOA 4P8WA 2RURA 1LL6A 3O5JA 2XP7A 5GPRA 1W9VA 5DEZA 5DIVA 2EULA 1FKSA 2MLZA 2WK2A 3FXYA 1O6IA 2XP9A 4NZCA 3W4RA 3AROA 3H9RB 2F4EA 2VCDA 3UQBA 3IKDA 2B5UB 4DWSD 1Q1CA 4HBOA 1HKJA 3UQIA 4DH0A 3KAIA 5HUAA 5JH8A 4ODPA 1E15A 2FAPA 4ODNA 1GRJA 2ZQTA 4MTVA 4N19A 1NMVA 1W1YA 3KAFA 3JXVA 5DO2A 1ROUA 2RSEA 1W1VA 3VAWA 4LAWA 2RUDA 1HJWA 4O2TA 1X6NA 2DT1A 4WKAA 4BF8A 3RGCA 2PPNA 2ZQUA 3WD4A 1E6RA 2ZR6A 1LG2A 2KFWA 3IK8A 1SR0A 4ML4A 2M1IA 1TFVA 4AY1A 4QZVB 4R5EA 2A3BA 1WAWA 1OGGA 4C02B 4DWSB 3KCEA 3AS2A 1QZ2A 1KT0A 4QIBA 2FKEA 4W9OA 2DT2A 1W1PA 4LAXA 4W9PA 1PINA 1WB0A 5HWBA 4JFLA 2PV1A 4XAKA 1Y0OA 3B8SA 1ZBVA 2ETNA 1NWTA 3TDBA 4DIPA 4DRQA 4TW8A 2LKNA 1X6LA 3RM4A 4LAYA 4P8VA 3NRKA 2PV2A 3O5EA 3CGMA 4DRHA 4Z2HA 3O5FA 1OGBA 2PV3A 4Z2IA 3BXWA 5HW6A 3ARPA 2KR7A 3O5PA 1JNDA 1LG1A 4IQCA 1GPFA 1NH6A 4ZPTR 4Z2JA 1J6YA 1IX5A 4JFMA 4J4OA 2YBTA 3G6LA 4WKHA 2A3EA 1FFRA 4FAPA 3JYJA 1EIBA 4MPKA 2PPPA 3O5IA 3FY1A 4WJXA 1OWQA 4MNMA 3WL0A 3CZ8A 4L3NA 1D6OA 4JFIA 4NNRA 2PBCA 4MAVA 2IUZA 2ITKA 2L2SA 2Q5AA 5HWCA 3O5DA 1WNOA 1QPFA 1HKKA 1E6NA 1CTNA 1LJYA 1FKHA 1W26A 1YATA 1XRVA 1E44A 2MLXA 2DG4A 1UR9A 3TC5A 2XP6A 1SYTA 1JCHB 3ALFA 3PRDA 4DRJA 4HARA 3UF8A 1KFWA 4DROA 5HW8A 1W9PA 3O5LA 4R0XA 4GIVA 2O92A 4WK9A 4ZPWR 1JNTA 3WIJA 1EQ3A 2UZ5A 2KE0A 1PBKA 4TW7A 3AS3A 2LJ4A 3ARQA 4MSPA 1TCOC 5B8IC 3WQVA 5DF0A 1VF8A 4Z2GA 2XPAA 2ZQSA 1ZB5A 4JYSA 2YBUA 1BKFA 4Q22A 2DG9A 4HBEA 2RQSA 4DRIA 3CGNA 2LPVA 5HW7A 2OFNA 4URIA 3G6MA 1ZBWA 1D2KA 3QOKA 2IF4A 1FKTA 1BL4A 3AS0A 2ESCA 2N87A 3KACA 3OA5A 4IT6A 1HJVA 2A3AA 4ODRA 2ZQVA 3ALGA 1NMWA 2KO7A 3O5OA 4ZS6A 3WD2A 5HTGA 2WLZA 1H0GA 1F8AB 2MPHA 3CHDA 3KAHA 2B31A 2D9FA 1R9HA 2MNTA 4TYOA 4U86A 3WD0A 3UI5A 1T11A 3RFWA 3O5QA 1H0IA 1N1AA 5D75A 3WD3A 2DSUA 2QF8A 1ZBCA 4DRMA 4DRPA 4TX0A 1E6ZA 4QT2A 3UI4A 1HKMA 2F2DA 2M2AA 3UQAA 2AWGA 1UR8A 4DWSA 2O9OA 1FKGA 1Q6IA 4LAVA 2OLHA 2DT3A 1A7XA 5GQBA 5HT1A 1ZCNA 4S3JA 1GUVA 1D7HA 3WD1A 1NWUA 4MNKA 1YW5A 1GOIA 3I6CA 1ZBKA 3CHEA 1FKBA 1F40A 1KT1A 1FFQA 3KADA 2G41A 3ARYA 4L72B 1ITXA 2DSVA 4DWSC 1M5YA 2DG3A 3KZ7A 3WH0A 1P5QA 1Q6HA 2KGJA 1HJXA 4G2PA 4P8UA 2WM0A 4TW6A 1D7JA 2JZVA 4P8XA 1LL4A 1NSGA 4JFKA 2MLYA 3CH9A 4MGVA 3WQWA 3ARSA 1E6PA 4U84A 1Q6UA 2PI6A
chains in the Genus database with same CATH topology
1W1TA 1FJDA 1LL7A 4MNLA 1FKJA 2PPOA 1HKIA 3WL1A 4ODMA 2Y78A 2XP4A 1B6CA 2WLYA 1JNSA 1ZU8A 3ARZA 2DPEA 2ZR4A 5HKGA 5J6EA 4ODKA 2RUQA 1RD6A 1J4IA 3RM9A 3ARVA 2KI3A 3ARWA 3ARXA 3PA7A 1ZK6A 2XP3A 2K8IA 5GPGA 1FKFA 3PRAA 1FKIA 4IPXA 3ODKA 4JFJA 4Z2KA 2FDMA 4KQZA 1FKLA 1JNEA 3NI6A 2AOSA 4MNJA 4DRNA 4J4NA 1JVWA 1XHGA 5DITA 3O5KA 3ARTA 3AQUA 2F21A 4DZ2A 3JYMA 4LGXA 3GPKA 3B7XA 1HXVA 4W9QA 4WKFA 3NTPA 3TCZA 3PR9A 1NWRA 1FD9A 1LQ0A 1FKRA 1QPLA 4DZ3A 4PTMA 4W5UA 2DSZA 4FN2A 2A3CA 5I98A 3PRBA 3OOBA 3O5MA 1ZL1A 3CHCA 5DIUA 2XPBA 1NWSA 3MDYB 3IKGA 3O5GA 1W9UA 4GGQA 5HBFA 3B9AA 4G50A 3ARUA 3RMEA 3FAPA 4IQ2A 1J4RA 3CHFA 2XP8A 3O5RA 3WKZA 2DSWA 1J4HA 3B9EA 4NSBA 4ODOA 4U85A 1E9LA 1K9TA 1D7IA 1FAPA 2M08A 2XP5A 4ZPVR 4QT3A 4ITZA 2VN1A 3KABA 1C9HA 3KAGA 2RUCA 3UI6A 1FKDA 4TNSA 3RM8A 1EYMA 4ODLA 4DT4A 3LUOA 2G8ZA 4Q7NA 2DT0A 3B9DA 1ROTA 1U79A 2MF9A 5BXJA 3ARRA 1FKKA 4WIWA 2ZR5A 3IHZA 4IT4A 1L1PA 1EHNA 4KR0B 3AS1A 4Z2LA 1EDQA 3EY6A 4ODQA 4DRKA 4S3KA 2LGOA 4P8WA 2RURA 1LL6A 3O5JA 2XP7A 5GPRA 1W9VA 5DEZA 5DIVA 1FKSA 2MLZA 2WK2A 3FXYA 1O6IA 2XP9A 4NZCA 3W4RA 3AROA 3H9RB 2F4EA 2VCDA 3UQBA 3IKDA 4DWSD 1Q1CA 4HBOA 1HKJA 3UQIA 4DH0A 3KAIA 5HUAA 5JH8A 4ODPA 1E15A 2FAPA 4ODNA 2ZQTA 4MTVA 4N19A 1NMVA 1W1YA 3KAFA 3JXVA 5DO2A 1ROUA 2RSEA 1W1VA 3VAWA 4LAWA 2RUDA 1HJWA 4O2TA 1X6NA 2DT1A 4WKAA 4BF8A 3RGCA 2PPNA 2ZQUA 3WD4A 1E6RA 2ZR6A 1LG2A 2KFWA 3IK8A 1SR0A 4ML4A 2M1IA 1TFVA 4AY1A 4QZVB 4R5EA 2A3BA 1WAWA 1OGGA 4C02B 4DWSB 3KCEA 3AS2A 1QZ2A 1KT0A 4QIBA 2FKEA 4W9OA 2DT2A 1W1PA 4LAXA 4W9PA 1PINA 1WB0A 5HWBA 4JFLA 2PV1A 4XAKA 1Y0OA 3B8SA 1ZBVA 1NWTA 3TDBA 4DIPA 4DRQA 4TW8A 2LKNA 1X6LA 3RM4A 4LAYA 4P8VA 3NRKA 2PV2A 3O5EA 3CGMA 4DRHA 4Z2HA 3O5FA 1OGBA 2PV3A 4Z2IA 3BXWA 5HW6A 3ARPA 2KR7A 3O5PA 1JNDA 1LG1A 4IQCA 1GPFA 1NH6A 4ZPTR 4Z2JA 1J6YA 1IX5A 4JFMA 4J4OA 2YBTA 3G6LA 4WKHA 2A3EA 1FFRA 4FAPA 3JYJA 1EIBA 4MPKA 2PPPA 3O5IA 3FY1A 4WJXA 1OWQA 4MNMA 3WL0A 3CZ8A 4L3NA 1D6OA 4JFIA 4NNRA 2PBCA 4MAVA 2IUZA 2ITKA 2L2SA 2Q5AA 5HWCA 3O5DA 1WNOA 1QPFA 1HKKA 1E6NA 1CTNA 1LJYA 1FKHA 1W26A 1YATA 1XRVA 2MLXA 2DG4A 1UR9A 3TC5A 2XP6A 1SYTA 3ALFA 3PRDA 4DRJA 4HARA 3UF8A 1KFWA 4DROA 5HW8A 1W9PA 3O5LA 4R0XA 4GIVA 2O92A 4WK9A 4ZPWR 1JNTA 3WIJA 1EQ3A 2UZ5A 2KE0A 1PBKA 4TW7A 3AS3A 2LJ4A 3ARQA 4MSPA 1TCOC 5B8IC 3WQVA 5DF0A 1VF8A 4Z2GA 2XPAA 2ZQSA 1ZB5A 4JYSA 2YBUA 1BKFA 4Q22A 2DG9A 4HBEA 2RQSA 4DRIA 3CGNA 2LPVA 5HW7A 2OFNA 4URIA 3G6MA 1ZBWA 1D2KA 3QOKA 2IF4A 1FKTA 1BL4A 3AS0A 2ESCA 2N87A 3KACA 3OA5A 4IT6A 1HJVA 2A3AA 4ODRA 2ZQVA 3ALGA 1NMWA 2KO7A 3O5OA 4ZS6A 3WD2A 5HTGA 2WLZA 1H0GA 1F8AB 2MPHA 3CHDA 3KAHA 2B31A 2D9FA 1R9HA 2MNTA 4TYOA 4U86A 3WD0A 3UI5A 1T11A 3RFWA 3O5QA 1H0IA 1N1AA 5D75A 3WD3A 2DSUA 2QF8A 1ZBCA 4DRMA 4DRPA 4TX0A 1E6ZA 4QT2A 3UI4A 1HKMA 2F2DA 2M2AA 3UQAA 2AWGA 1UR8A 4DWSA 2O9OA 1FKGA 1Q6IA 4LAVA 2OLHA 2DT3A 1A7XA 5GQBA 5HT1A 1ZCNA 4S3JA 1GUVA 1D7HA 3WD1A 1NWUA 4MNKA 1YW5A 1GOIA 3I6CA 1ZBKA 3CHEA 1FKBA 1F40A 1KT1A 1FFQA 3KADA 2G41A 3ARYA 4L72B 1ITXA 2DSVA 4DWSC 1M5YA 2DG3A 3KZ7A 3WH0A 1P5QA 1Q6HA 2KGJA 1HJXA 4G2PA 4P8UA 2WM0A 4TW6A 1D7JA 2JZVA 4P8XA 1LL4A 1NSGA 4JFKA 2MLYA 3CH9A 4MGVA 3WQWA 3ARSA 1E6PA 4U84A 1Q6UA 2PI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROT A;  4TW8 A;  1U79 A;  2MF9 A;  5BXJ A;  1FJD A;  2XPA A;  2ZQS A;  2LKN A;  1FKK A;  4JYS A;  1BKF A;  2ZR5 A;  3IHZ A;  2DG9 A;  4LAY A;  1L1P A;  2RQS A;  3NRK A;  4DRI A;  1FKJ A;  2PV2 A;  2PPO A;  2LPV A;  3CGN A;  3O5E A;  3CGM A;  2OFN A;  4ODM A;  4DRH A;  3EY6 A;  3O5F A;  4ODQ A;  4DRK A;  2Y78 A;  2PV3 A;  2XP4 A;  1B6C A;  2LGO A;  2RUR A;  5HW6 A;  1JNS A;  2IF4 A;  2ZR4 A;  2KR7 A;  5HKG A;  4ODK A;  2RUQ A;  3O5J A;  1FKT A;  2XP7 A;  5J6E A;  1BL4 A;  1J4I A;  2N87 A;  3O5P A;  3KAC A;  5DIV A;  3WH0 A;  1FKS A;  2KI3 A;  2MLZ A;  3PA7 A;  4ODR A;  2ZQV A;  1ZK6 A;  2XP3 A;  2XP9 A;  2KO7 A;  1NMW A;  2K8I A;  3O5O A;  4IQC A;  5GPG A;  5HTG A;  1J6Y A;  1FKF A;  4JFM A;  3H9R B;  4J4O A;  2F4E A;  1F8A B;  2VCD A;  3UQB A;  3IKD A;  2MPH A;  1FKI A;  4IPX A;  3ODK A;  4JFJ A;  3KAH A;  1FKL A;  1R9H A;  2D9F A;  2MNT A;  4FAP A;  1Q1C A;  3JYJ A;  4TYO A;  4U86 A;  2PPP A;  3UQI A;  3NI6 A;  3O5I A;  4DH0 A;  3KAI A;  5HUA A;  4DRN A;  4J4N A;  3UI5 A;  1JVW A;  5DIT A;  3O5K A;  4ODP A;  1T11 A;  2FAP A;  2F21 A;  2ZQT A;  3O5Q A;  4N19 A;  4ODN A;  1NMV A;  3RFW A;  4DZ2 A;  3KAF A;  1N1A A;  3JXV A;  3JYM A;  5D75 A;  3GPK A;  3B7X A;  1HXV A;  4DRM A;  4W9Q A;  4DRP A;  3NTP A;  4TX0 A;  1D6O A;  1ROU A;  2RSE A;  4JFI A;  4QT2 A;  2F2D A;  3TCZ A;  3UI4 A;  2M2A A;  4NNR A;  4LAW A;  3VAW A;  3UQA A;  2AWG A;  1FKG A;  1Q6I A;  2RUD A;  1FD9 A;  4LAV A;  4O2T A;  1QPL A;  2PBC A;  1FKR A;  1A7X A;  4DZ3 A;  2ITK A;  5HT1 A;  2L2S A;  1ZCN A;  2Q5A A;  4FN2 A;  4BF8 A;  3O5D A;  5HWC A;  5I98 A;  1QPF A;  3PRB A;  3OOB A;  3RGC A;  3O5M A;  2PPN A;  1D7H A;  4DRQ A;  1FKH A;  1W26 A;  2ZQU A;  1YAT A;  5DIU A;  1YW5 A;  2ZR6 A;  2XPB A;  2KFW A;  2MLX A;  2DG4 A;  3MDY B;  3IKG A;  3O5G A;  3I6C A;  3IK8 A;  4GGQ A;  1FKB A;  1F40 A;  2M1I A;  4G50 A;  3TC5 A;  2XP6 A;  3FAP A;  4IQ2 A;  1KT1 A;  1J4R A;  2XP8 A;  3KAD A;  3O5R A;  4C02 B;  3PRD A;  4DRJ A;  3KCE A;  3UF8 A;  1QZ2 A;  1J4H A;  4U85 A;  4ODO A;  4DRO A;  1KT0 A;  4QIB A;  2FKE A;  1M5Y A;  2DG3 A;  3KZ7 A;  4W9O A;  5HW8 A;  1FAP A;  1D7I A;  2M08 A;  2XP5 A;  3O5L A;  1P5Q A;  4GIV A;  4LAX A;  4QT3 A;  1PIN A;  1Q6H A;  4ITZ A;  2KGJ A;  4W9P A;  2VN1 A;  5HWB A;  3KAB A;  4JFL A;  4G2P A;  1C9H A;  1JNT A;  2PV1 A;  3KAG A;  4TW6 A;  1EQ3 A;  2RUC A;  1D7J A;  2UZ5 A;  3UI6 A;  2KE0 A;  4R0X A;  2JZV A;  1PBK A;  1FKD A;  1NSG A;  1Y0O A;  4JFK A;  4TNS A;  1EYM A;  2MLY A;  4ODL A;  4MGV A;  4TW7 A;  3TDB A;  4DT4 A;  2LJ4 A;  4MSP A;  3LUO A;  1TCO C;  5B8I C;  4DIP A;  4U84 A;  1Q6U A;  5HW7 A; 
#chains in the Genus database with same CATH topology
 1W1T A;  1FJD A;  1LL7 A;  3GTY X;  4MNL A;  1FKJ A;  2PPO A;  1HKI A;  3WL1 A;  4ODM A;  3GU0 A;  3EIP A;  2Y78 A;  2XP4 A;  1B6C A;  2WLY A;  1JNS A;  1ZU8 A;  3ARZ A;  2DPE A;  2ZR4 A;  5HKG A;  5J6E A;  4ODK A;  2RUQ A;  1RD6 A;  1J4I A;  3RM9 A;  3ARV A;  2KI3 A;  3ARW A;  4UDM A;  3ARX A;  3PA7 A;  1ZK6 A;  2XP3 A;  2K8I A;  5GPG A;  1FKF A;  3PRA A;  1FKI A;  4IPX A;  2PN0 A;  3ODK A;  4JFJ A;  4Z2K A;  2FDM A;  4KQZ A;  1FKL A;  1JNE A;  3NI6 A;  2AOS A;  4MNJ A;  4DRN A;  4J4N A;  1JVW A;  1XHG A;  5DIT A;  3O5K A;  3ART A;  3AQU A;  2F21 A;  4DZ2 A;  3JYM A;  4LGX A;  3GPK A;  3B7X A;  1HXV A;  4W9Q A;  4WKF A;  3NTP A;  2F23 A;  3TCZ A;  3PR9 A;  1NWR A;  1FD9 A;  1LQ0 A;  1FKR A;  1QPL A;  4DZ3 A;  4PTM A;  4W5U A;  2DSZ A;  4FN2 A;  3BMB A;  2A3C A;  5I98 A;  3PRB A;  3OOB A;  3O5M A;  1ZL1 A;  3CHC A;  5DIU A;  2XPB A;  1NWS A;  3MDY B;  3IKG A;  3O5G A;  1W9U A;  4GGQ A;  5HBF A;  3B9A A;  4G50 A;  3ARU A;  3RME A;  3FAP A;  4IQ2 A;  1J4R A;  3CHF A;  2XP8 A;  3O5R A;  3WKZ A;  2DSW A;  1J4H A;  3B9E A;  4NSB A;  4ODO A;  4U85 A;  1E9L A;  1K9T A;  1D7I A;  1FAP A;  2M08 A;  2XP5 A;  4ZPV R;  4QT3 A;  4ITZ A;  2VN1 A;  3KAB A;  1C9H A;  3KAG A;  2RUC A;  3UI6 A;  1FKD A;  4TNS A;  3RM8 A;  1EYM A;  4ODL A;  4DT4 A;  3LUO A;  2G8Z A;  4Q7N A;  2DT0 A;  2P4V A;  3B9D A;  1ROT A;  1U79 A;  2MF9 A;  5BXJ A;  3ARR A;  1FKK A;  4WIW A;  2ZR5 A;  3IHZ A;  4IT4 A;  1L1P A;  1EHN A;  4KR0 B;  3AS1 A;  4Z2L A;  1EDQ A;  3EY6 A;  4ODQ A;  4DRK A;  4S3K A;  2LGO A;  4P8W A;  2RUR A;  1LL6 A;  3O5J A;  2XP7 A;  5GPR A;  1W9V A;  5DEZ A;  5DIV A;  2EUL A;  1FKS A;  2MLZ A;  2WK2 A;  3FXY A;  1O6I A;  2XP9 A;  4NZC A;  3W4R A;  3ARO A;  3H9R B;  2F4E A;  2VCD A;  3UQB A;  3IKD A;  2B5U B;  4DWS D;  1Q1C A;  4HBO A;  1HKJ A;  3UQI A;  4DH0 A;  3KAI A;  5HUA A;  5JH8 A;  4ODP A;  1E15 A;  2FAP A;  4ODN A;  1GRJ A;  2ZQT A;  4MTV A;  4N19 A;  1NMV A;  1W1Y A;  3KAF A;  3JXV A;  5DO2 A;  1ROU A;  2RSE A;  1W1V A;  3VAW A;  4LAW A;  2RUD A;  1HJW A;  4O2T A;  1X6N A;  2DT1 A;  4WKA A;  4BF8 A;  3RGC A;  2PPN A;  2ZQU A;  3WD4 A;  1E6R A;  2ZR6 A;  1LG2 A;  2KFW A;  3IK8 A;  1SR0 A;  4ML4 A;  2M1I A;  1TFV A;  4AY1 A;  4QZV B;  4R5E A;  2A3B A;  1WAW A;  1OGG A;  4C02 B;  4DWS B;  3KCE A;  3AS2 A;  1QZ2 A;  1KT0 A;  4QIB A;  2FKE A;  4W9O A;  2DT2 A;  1W1P A;  4LAX A;  4W9P A;  1PIN A;  1WB0 A;  5HWB A;  4JFL A;  2PV1 A;  4XAK A;  1Y0O A;  3B8S A;  1ZBV A;  2ETN A;  1NWT A;  3TDB A;  4DIP A;  4DRQ A;  4TW8 A;  2LKN A;  1X6L A;  3RM4 A;  4LAY A;  4P8V A;  3NRK A;  2PV2 A;  3O5E A;  3CGM A;  4DRH A;  4Z2H A;  3O5F A;  1OGB A;  2PV3 A;  4Z2I A;  3BXW A;  5HW6 A;  3ARP A;  2KR7 A;  3O5P A;  1JND A;  1LG1 A;  4IQC A;  1GPF A;  1NH6 A;  4ZPT R;  4Z2J A;  1J6Y A;  1IX5 A;  4JFM A;  4J4O A;  2YBT A;  3G6L A;  4WKH A;  2A3E A;  1FFR A;  4FAP A;  3JYJ A;  1EIB A;  4MPK A;  2PPP A;  3O5I A;  3FY1 A;  4WJX A;  1OWQ A;  4MNM A;  3WL0 A;  3CZ8 A;  4L3N A;  1D6O A;  4JFI A;  4NNR A;  2PBC A;  4MAV A;  2IUZ A;  2ITK A;  2L2S A;  2Q5A A;  5HWC A;  3O5D A;  1WNO A;  1QPF A;  1HKK A;  1E6N A;  1CTN A;  1LJY A;  1FKH A;  1W26 A;  1YAT A;  1XRV A;  1E44 A;  2MLX A;  2DG4 A;  1UR9 A;  3TC5 A;  2XP6 A;  1SYT A;  1JCH B;  3ALF A;  3PRD A;  4DRJ A;  4HAR A;  3UF8 A;  1KFW A;  4DRO A;  5HW8 A;  1W9P A;  3O5L A;  4R0X A;  4GIV A;  2O92 A;  4WK9 A;  4ZPW R;  1JNT A;  3WIJ A;  1EQ3 A;  2UZ5 A;  2KE0 A;  1PBK A;  4TW7 A;  3AS3 A;  2LJ4 A;  3ARQ A;  4MSP A;  1TCO C;  5B8I C;  3WQV A;  5DF0 A;  1VF8 A;  4Z2G A;  2XPA A;  2ZQS A;  1ZB5 A;  4JYS A;  2YBU A;  1BKF A;  4Q22 A;  2DG9 A;  4HBE A;  2RQS A;  4DRI A;  3CGN A;  2LPV A;  5HW7 A;  2OFN A;  4URI A;  3G6M A;  1ZBW A;  1D2K A;  3QOK A;  2IF4 A;  1FKT A;  1BL4 A;  3AS0 A;  2ESC A;  2N87 A;  3KAC A;  3OA5 A;  4IT6 A;  1HJV A;  2A3A A;  4ODR A;  2ZQV A;  3ALG A;  1NMW A;  2KO7 A;  3O5O A;  4ZS6 A;  3WD2 A;  5HTG A;  2WLZ A;  1H0G A;  1F8A B;  2MPH A;  3CHD A;  3KAH A;  2B31 A;  2D9F A;  1R9H A;  2MNT A;  4TYO A;  4U86 A;  3WD0 A;  3UI5 A;  1T11 A;  3RFW A;  3O5Q A;  1H0I A;  1N1A A;  5D75 A;  3WD3 A;  2DSU A;  2QF8 A;  1ZBC A;  4DRM A;  4DRP A;  4TX0 A;  1E6Z A;  4QT2 A;  3UI4 A;  1HKM A;  2F2D A;  2M2A A;  3UQA A;  2AWG A;  1UR8 A;  4DWS A;  2O9O A;  1FKG A;  1Q6I A;  4LAV A;  2OLH A;  2DT3 A;  1A7X A;  5GQB A;  5HT1 A;  1ZCN A;  4S3J A;  1GUV A;  1D7H A;  3WD1 A;  1NWU A;  4MNK A;  1YW5 A;  1GOI A;  3I6C A;  1ZBK A;  3CHE A;  1FKB A;  1F40 A;  1KT1 A;  1FFQ A;  3KAD A;  2G41 A;  3ARY A;  4L72 B;  1ITX A;  2DSV A;  4DWS C;  1M5Y A;  2DG3 A;  3KZ7 A;  3WH0 A;  1P5Q A;  1Q6H A;  2KGJ A;  1HJX A;  4G2P A;  4P8U A;  2WM0 A;  4TW6 A;  1D7J A;  2JZV A;  4P8X A;  1LL4 A;  1NSG A;  4JFK A;  2MLY A;  3CH9 A;  4MGV A;  3WQW A;  3ARS A;  1E6P A;  4U84 A;  1Q6U A;  2PI6 A; 
#chains in the Genus database with same CATH homology
 1W1T A;  1FJD A;  1LL7 A;  4MNL A;  1FKJ A;  2PPO A;  1HKI A;  3WL1 A;  4ODM A;  2Y78 A;  2XP4 A;  1B6C A;  2WLY A;  1JNS A;  1ZU8 A;  3ARZ A;  2DPE A;  2ZR4 A;  5HKG A;  5J6E A;  4ODK A;  2RUQ A;  1RD6 A;  1J4I A;  3RM9 A;  3ARV A;  2KI3 A;  3ARW A;  3ARX A;  3PA7 A;  1ZK6 A;  2XP3 A;  2K8I A;  5GPG A;  1FKF A;  3PRA A;  1FKI A;  4IPX A;  3ODK A;  4JFJ A;  4Z2K A;  2FDM A;  4KQZ A;  1FKL A;  1JNE A;  3NI6 A;  2AOS A;  4MNJ A;  4DRN A;  4J4N A;  1JVW A;  1XHG A;  5DIT A;  3O5K A;  3ART A;  3AQU A;  2F21 A;  4DZ2 A;  3JYM A;  4LGX A;  3GPK A;  3B7X A;  1HXV A;  4W9Q A;  4WKF A;  3NTP A;  3TCZ A;  3PR9 A;  1NWR A;  1FD9 A;  1LQ0 A;  1FKR A;  1QPL A;  4DZ3 A;  4PTM A;  4W5U A;  2DSZ A;  4FN2 A;  2A3C A;  5I98 A;  3PRB A;  3OOB A;  3O5M A;  1ZL1 A;  3CHC A;  5DIU A;  2XPB A;  1NWS A;  3MDY B;  3IKG A;  3O5G A;  1W9U A;  4GGQ A;  5HBF A;  3B9A A;  4G50 A;  3ARU A;  3RME A;  3FAP A;  4IQ2 A;  1J4R A;  3CHF A;  2XP8 A;  3O5R A;  3WKZ A;  2DSW A;  1J4H A;  3B9E A;  4NSB A;  4ODO A;  4U85 A;  1E9L A;  1K9T A;  1D7I A;  1FAP A;  2M08 A;  2XP5 A;  4ZPV R;  4QT3 A;  4ITZ A;  2VN1 A;  3KAB A;  1C9H A;  3KAG A;  2RUC A;  3UI6 A;  1FKD A;  4TNS A;  3RM8 A;  1EYM A;  4ODL A;  4DT4 A;  3LUO A;  2G8Z A;  4Q7N A;  2DT0 A;  3B9D A;  1ROT A;  1U79 A;  2MF9 A;  5BXJ A;  3ARR A;  1FKK A;  4WIW A;  2ZR5 A;  3IHZ A;  4IT4 A;  1L1P A;  1EHN A;  4KR0 B;  3AS1 A;  4Z2L A;  1EDQ A;  3EY6 A;  4ODQ A;  4DRK A;  4S3K A;  2LGO A;  4P8W A;  2RUR A;  1LL6 A;  3O5J A;  2XP7 A;  5GPR A;  1W9V A;  5DEZ A;  5DIV A;  1FKS A;  2MLZ A;  2WK2 A;  3FXY A;  1O6I A;  2XP9 A;  4NZC A;  3W4R A;  3ARO A;  3H9R B;  2F4E A;  2VCD A;  3UQB A;  3IKD A;  4DWS D;  1Q1C A;  4HBO A;  1HKJ A;  3UQI A;  4DH0 A;  3KAI A;  5HUA A;  5JH8 A;  4ODP A;  1E15 A;  2FAP A;  4ODN A;  2ZQT A;  4MTV A;  4N19 A;  1NMV A;  1W1Y A;  3KAF A;  3JXV A;  5DO2 A;  1ROU A;  2RSE A;  1W1V A;  3VAW A;  4LAW A;  2RUD A;  1HJW A;  4O2T A;  1X6N A;  2DT1 A;  4WKA A;  4BF8 A;  3RGC A;  2PPN A;  2ZQU A;  3WD4 A;  1E6R A;  2ZR6 A;  1LG2 A;  2KFW A;  3IK8 A;  1SR0 A;  4ML4 A;  2M1I A;  1TFV A;  4AY1 A;  4QZV B;  4R5E A;  2A3B A;  1WAW A;  1OGG A;  4C02 B;  4DWS B;  3KCE A;  3AS2 A;  1QZ2 A;  1KT0 A;  4QIB A;  2FKE A;  4W9O A;  2DT2 A;  1W1P A;  4LAX A;  4W9P A;  1PIN A;  1WB0 A;  5HWB A;  4JFL A;  2PV1 A;  4XAK A;  1Y0O A;  3B8S A;  1ZBV A;  1NWT A;  3TDB A;  4DIP A;  4DRQ A;  4TW8 A;  2LKN A;  1X6L A;  3RM4 A;  4LAY A;  4P8V A;  3NRK A;  2PV2 A;  3O5E A;  3CGM A;  4DRH A;  4Z2H A;  3O5F A;  1OGB A;  2PV3 A;  4Z2I A;  3BXW A;  5HW6 A;  3ARP A;  2KR7 A;  3O5P A;  1JND A;  1LG1 A;  4IQC A;  1GPF A;  1NH6 A;  4ZPT R;  4Z2J A;  1J6Y A;  1IX5 A;  4JFM A;  4J4O A;  2YBT A;  3G6L A;  4WKH A;  2A3E A;  1FFR A;  4FAP A;  3JYJ A;  1EIB A;  4MPK A;  2PPP A;  3O5I A;  3FY1 A;  4WJX A;  1OWQ A;  4MNM A;  3WL0 A;  3CZ8 A;  4L3N A;  1D6O A;  4JFI A;  4NNR A;  2PBC A;  4MAV A;  2IUZ A;  2ITK A;  2L2S A;  2Q5A A;  5HWC A;  3O5D A;  1WNO A;  1QPF A;  1HKK A;  1E6N A;  1CTN A;  1LJY A;  1FKH A;  1W26 A;  1YAT A;  1XRV A;  2MLX A;  2DG4 A;  1UR9 A;  3TC5 A;  2XP6 A;  1SYT A;  3ALF A;  3PRD A;  4DRJ A;  4HAR A;  3UF8 A;  1KFW A;  4DRO A;  5HW8 A;  1W9P A;  3O5L A;  4R0X A;  4GIV A;  2O92 A;  4WK9 A;  4ZPW R;  1JNT A;  3WIJ A;  1EQ3 A;  2UZ5 A;  2KE0 A;  1PBK A;  4TW7 A;  3AS3 A;  2LJ4 A;  3ARQ A;  4MSP A;  1TCO C;  5B8I C;  3WQV A;  5DF0 A;  1VF8 A;  4Z2G A;  2XPA A;  2ZQS A;  1ZB5 A;  4JYS A;  2YBU A;  1BKF A;  4Q22 A;  2DG9 A;  4HBE A;  2RQS A;  4DRI A;  3CGN A;  2LPV A;  5HW7 A;  2OFN A;  4URI A;  3G6M A;  1ZBW A;  1D2K A;  3QOK A;  2IF4 A;  1FKT A;  1BL4 A;  3AS0 A;  2ESC A;  2N87 A;  3KAC A;  3OA5 A;  4IT6 A;  1HJV A;  2A3A A;  4ODR A;  2ZQV A;  3ALG A;  1NMW A;  2KO7 A;  3O5O A;  4ZS6 A;  3WD2 A;  5HTG A;  2WLZ A;  1H0G A;  1F8A B;  2MPH A;  3CHD A;  3KAH A;  2B31 A;  2D9F A;  1R9H A;  2MNT A;  4TYO A;  4U86 A;  3WD0 A;  3UI5 A;  1T11 A;  3RFW A;  3O5Q A;  1H0I A;  1N1A A;  5D75 A;  3WD3 A;  2DSU A;  2QF8 A;  1ZBC A;  4DRM A;  4DRP A;  4TX0 A;  1E6Z A;  4QT2 A;  3UI4 A;  1HKM A;  2F2D A;  2M2A A;  3UQA A;  2AWG A;  1UR8 A;  4DWS A;  2O9O A;  1FKG A;  1Q6I A;  4LAV A;  2OLH A;  2DT3 A;  1A7X A;  5GQB A;  5HT1 A;  1ZCN A;  4S3J A;  1GUV A;  1D7H A;  3WD1 A;  1NWU A;  4MNK A;  1YW5 A;  1GOI A;  3I6C A;  1ZBK A;  3CHE A;  1FKB A;  1F40 A;  1KT1 A;  1FFQ A;  3KAD A;  2G41 A;  3ARY A;  4L72 B;  1ITX A;  2DSV A;  4DWS C;  1M5Y A;  2DG3 A;  3KZ7 A;  3WH0 A;  1P5Q A;  1Q6H A;  2KGJ A;  1HJX A;  4G2P A;  4P8U A;  2WM0 A;  4TW6 A;  1D7J A;  2JZV A;  4P8X A;  1LL4 A;  1NSG A;  4JFK A;  2MLY A;  3CH9 A;  4MGV A;  3WQW A;  3ARS A;  1E6P A;  4U84 A;  1Q6U A;  2PI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...