2MFIA

Domain 1 of e. coli ribosomal protein s1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Resonance assignment of the ribosome binding domain of E. coli ribosomal protein S1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mfiA00
1J6QA 4GKKL 4WJ3M 3HOUH 1CSQA 1Q1BA 2MO0A 3TQYA 5LMNL 4JI5Q 3PF4A 1S72A 1EWIA 1QVGA 3T1HL 2KBNA 3CCSA 2K5HA 3DM3A 4YHHL 4PG3A 5GQOA 3SGIA 3UDGA 2EXDA 4B3SL 3PO3G 1EQRA 3CC4A 1N33L 3GTGH 4GLVB 5ELOA 4PZ7A 4KHPL 4X66Q 1BBWA 3M85A 4IO9A 4LWCA 1HR0L 1XNQQ 3K81C 5M5XH 2LXJA 2YV5A 4QQBX 3BZKA 3FHWA 3NELA 1W2BA 3W1GA 1B7YB 2NZHA 3OYYA 2JA7G 4UPAA 2IHEA 4IPGA 4X65Q 3J80c 2AKWB 1YZ6A 1VQBA 3NEMA 1VQ9A 2E2HH 1PYBA 4LUOA 4DV0L 1S3OA 2AMCB 4JI0Q 4DR7L 1E3PA 4OX9Q 3ZJYC 4YCWA 1WCMG 5IWAL 4DKAC 2MO1A 1HR0Q 4EQ5A 4BXXH 2UUAQ 4OXPA 3M4PA 2FXQA 3J7A5 1IXRA 3ERSX 4A3BH 3G71A 4IFDJ 1CKNA 1HJPA 2Q2HA 3MEFA 4IPDA 1N36Q 3AFQA 3K80C 3CC2A 5EAYA 1B70B 2VY3A 2XTIA 1M90C 3JC66 3CCRA 1X3EA 1Q81C 1X9NA 1C7YA 2WB1E 1UEBA 4L5TA 4BY1G 4JI8Q 3K0XA 3JAMi 4OX9L 5BR8Q 3CCUA 2IY5B 5ELNA 1KIXA 1IBMQ 1HNXL 3HOYH 3K7UC 4LW1A 4GNXA 4JYAQ 5IY0A 1VS0A 3U58A 4TVAB 2ZJRA 3AQQA 4OWWB 1FJGL 2ID0A 4JC0A 1N32L 4DV3L 3I4OA 3HOYG 1HZBA 1VQ8A 3F2DA 1PH4A 1XNRQ 2NVTH 1EUJA 5IP7H 3OTOQ 1IBKL 4APVA 2NVXH 3S1RH 5IYDH 2JA9A 4NXNL 2VS1A 1VQ4A 2ZTDA 4A3DH 5BR8L 2JEBI 4LF7Q 1NE3A 1ASZA 1IBML 1HNXQ 4XIGS 4JYAL 4PZ6A 5C44H 1YIJA 2F52A 3L7ZC 3CF5A 4HIMA 4JCVE 4YWMA 4B3TQ 1WFQA 3S1NH 1P8LA 4R4QA 4B3RL 4JOIC 1HH2P 2VQFQ 4DV3Q 2BA1A 2R6GA 4QGUA 1E1TA 3RN2A 1YJWA 3MXNB 4HJ7A 2CCZA 1L1OC 1E24A 2I5MX 4EX5A 3OTOL 4FDBA 1N34L 1IBKQ 2R93G 3HOXH 4Y52H 1A62A 4BA2I 1FVIA 2Y0SG 4DPGA 4JI6Q 1OXXK 3UDIA 4AQYQ 1JJ2A 5HY6A 2OWOA 3WWVA 4IFDG 4OO1I 4JOIA 2VUMH 4P71A 3H3VH 4KI0A 4JI2Q 5FLMG 4DV2Q 1EIFA 2JEAI 4C2MH 4POGA 2VQFL 4BBRH 1U5KA 1VQHA 3S15H 3TRZA 2PMZE 4YCVA 3PCOB 2B63H 1VQIA 2I5LX 2YYZA 5GAEC 3CPFA 5C0XI 2MNAA 1HNZQ 1K0RA 4BBRG 3PUXA 3A5UA 3I55A 4AQYL 1Q86C 4LF6Q 3NBHB 3I4MG 1YVCA 4BA1I 3CCVA 4JI2L 1V1QA 4TQUS 2F3IA 5C4JH 3A0JA 1VQDA 1NTGA 1BKBA 2PQAA 2RCNA 1WI5A 3STBC 2K4KA 1RIPA 2WB1G 3GD7A 5M5WH 3E9HA 1QVFA 4A3CG 1GO3E 2KCMA 2NN6I 1CKOA 2Q2IA 3A5ZB 1H95A 1N8RC 3ULLA 2E5LL 1T9HA 2R7ZH 1X65A 4AYBG 1P16A 1HZ9A 2RF4A 4A3GG 4OWTB 1J5EQ 3PGZA 4OWXB 4DV7L 3Q8DA 1B8AA 4A3DG 2JA8H 1NJIC 4JV5Q 3KJPA 1VQMA 3TREA 2QEXA 2JJQA 5JJIA 4LUZA 1K8GA 5HGQA 1KHIA 2UXBL 1IBLL 5DLQE 2JE6I 4JG2A 4QJFA 3M4QA 3ULJA 2E5LQ 2JA7H 4DR4Q 4A3LG 1QUQA 4GN5A 5IYBG 4JBMA 3U4ZA 3E9IA 4NB3A 2N49A 3GTJH 2ZTCA 2NVQH 4BXXG 3CP0A 4AYBE 1Z47A 2K5VA 2C35B 1RL2A 5M3FG 4DV7Q 5IP9H 2DGYA 5FJ8H 4DV0Q 4JV5L 4LFAQ 4DAMA 5IYCG 1LM0A 2LSSA 2KHIA 4DR5Q 2B63G 4K0KL 4IOAA 4GNXB 5JJKA 1IBLQ 1X6OA 3U50C 4DR4L 1SLJA 1YHBA 4GOPB 4A3EH 1MJEA 3CAMA 4BY1H 1Y1WH 3GO5A 2R92H 3E0EA 1VQ5A 2K52A 1PH7A 2VNUD 3KFUA 4JI8L 3T1YL 3S16H 4DR6L 1QVCA 1IZ6A 1BVSA 1G6PA 4LF5L 3HKZE 1PH8A 4B3MQ 3GDEA 3H0GH 1VQKA 3PO2G 3I4NG 2NZOA 4DR5L 1IL2A 5K36G 4K0KQ 4DR3Q 4L5SA 2I5HA 1Q8KA 4DV4Q 2Z0SA 4DV6Q 3KDFA 1X54A 4HIOA 4P75A 1L1OA 3RZDH 1N32Q 1VQPA 1JE5A 1HZCA 4A3FH 4UP7A 1XMQL 1NMGA 2Z6KC 4HJ5A 3GTLH 4MTNA 4A75A 1SN8A 4NPSA 4NXNQ 4DK6C 1VQGA 4DAYB 1WOCA 4LF5Q 2IX1A 4LF7L 5FLXc 2UXBQ 1SRUA 1TWAH 4A3GH 1E1OA 3CQZH 4O0AA 1LUZA 3BJUA 3EIVA 4DV4L 4DV6L 1UE6A 4A3KG 1Q12A 3CCLA 1OXSC 2AWNA 4YCUA 4DR2L 1ASYA 3D31A 3RLFA 5C4XG 3AYHB 3KOJA 2AHOB 1VQNA 4JBJA 4DUYL 2YU9H 4JI7L 2JA6G 1XMQQ 2CKZB 3D0FA 2MQHA 3HOZG 5C4XH 1L1OB 1K9MC 2MFIA 4MNOA 2OQ0A 3PUVA 2JA5G 2PI2E 4R1JA 2BH8A 2I0QA 1IYJB 3F2BA 4DV2L 5M3FH 2B29A 1GKHA 3UE1A 1KQSA 4A3MG 5FJ8G 2Q2TA 2ZTEA 4DR2Q 1LYLA 4KLKA 4NXMQ 2CWAA 2D0PA 4DUYQ 4JI7Q 1LTLA 2R7FA 1XPOA 4X64L 2A19A 3HOUG 4R4IA 3M3YH 4IOCA 4A3EG 1HR0W 1MKHA 4A93G 3CXCA 3KYHC 1O7IA 4MZ9A 1OXVA 1KAWA 3H15A 1YJNA 2ALYB 3PO2H 3PUZA 3HOWG 3I4NH 1A63A 2RHSB 2BH2A 5M3MH 4LF9L 2VZAA 3HKZG 1UE1A 1PH2A 3CPWA 1HNWQ 4C3JH 2Z6KA 3OW2A 2UUBL 3F1ZA 3J80i 1VQ7A 2VQEL 1PH9A 2JA5H 3PIOA 5M3MG 4BY7G 4UP8A 3BZCA 4HIKA 4A3FG 2E2IH 4R4CA 4JI3L 1J5EL 3GTPH 4L5RC 3S1MH 2GVAA 3AFPA 3W1BA 1VQOA 2IHFA 1VCIA 5GROA 4DV1Q 4A3IH 1HNWL 1R9TH 1U0LA 1VQEA 2YTXA 1G51A 3I56A 4LNQA 5IYBH 3PO3H 1X56A 4QL5A 4A3LH 2VQEQ 2XGTA 1VQ6A 3EBEA 1Q46A 1MIUA 1NMFA 2LXKA 4JI1L 2HHHQ 1Q7YC 2ES2A 3W5OA 2HIXA 1NBWA 3RLOA 4DUZQ 4LF8L 1KXLA 1X3FA 3B6YA 1GM5A 4DK3C 4LFAL 4A4IA 1I94Q 3I7FA 3RR5A 2CWPA 2WP8J 3S14H 2KCTA 4POFA 1YHQA 1CKMA 3M7NA 4A3JH 1KL9A 1OXTA 1E22A 2WFWA 3I2ZA 1KRTA 2UU9L 4LFBQ 3KLWA 3FP9A 1I5FA 1VQCA 4A3CH 2D62A 5JJLA 3H0GG 3K7AH 3T1YQ 3PV0A 4DR6Q 2D0OA 5C44G 2CQOA 2R7ZG 2F4VL 3HOWH 4B3ML 3TS0A 2UXCQ 1JJGA 3UDFA 5C0XJ 3S17H 2L15A 1I94L 4DR3L 4P73A 3M4OH 3LGJA 3G4SA 2PI2A 1AE2A 5IP7G 1Q82C 2N78A 2VL6A 1Y1VG 3FKIH 4IPCA 2CFMA 5JEAJ 5IYDG 3CC7A 4DV5L 2UU9Q 5E7NA 1TWHH 4UY8C 3GTQH 3TS2A 4LFBL 1I6HH 3ICEA 1EQQA 2V1CC 4J15A 1K83H 2WAQG 4A3KH 4IPHA 3RN5A 2A8VA 4GOPC 1CSPA 4HJAA 4BBSH 1YNXA 5FLMH 4LFCQ 1JJCB 1XNRL 3CCQA 4YY3L 2NN6G 3PUWA 4P72A 1CUKA 3F2CA 2ZJQA 4A3IG 4HIDA 1VQLA 1OXUA 1Q1EA 5GADC 2UUCQ 4X6AH 1KC8C 1TWFH 4JI4L 3HOZH 2JK8A 4UP9A 3ULPA 1K3RA 4GLXA 2Y0SE 1S40A 1EOVA 1PA6A 4A3BG 2UXDQ 4RG1A 1KD1C 1V9PA 4XTCS 4LFCL 2ATWA 5C0XG 1AH9A 4QY7A 2HT1A 4KHZA 2R92G 3KF6A 3G48A 3NENA 4IJLA 5C3EH 5J3BA 3RZOH 2EQSA 1XMOQ 3HOVH 1Y14B 4IJHA 4JI5L 2YTYA 2VW9A 3DLLA 1UE7A 5LMNQ 1EYGA 4NXML 4A93H 2ASBA 3HKSA 1KRSA 3ER0A 1L2FA 3T1HQ 2N8NA 4LUVA 3RLNA 4X64Q 2OTJA 4YHHQ 2IX0A 2OTLA 2EIFA 4A76A 2UXDL 2H5XA 3VDYA 1JB7A 1N33Q 4KHPQ 3CCJA 3S2HH 2Q2UA 4AH6A 3S1QH 1BBUA 3CW2C 2K14A 4L5QA 3CCMA 3IRBA 1XMOL 1K8AC 2HQLA 2HIVA 1YBYA 5M5YH 1TWGH 4YWLA 2B3GA 1HZAA 4LF9Q 1SROA 4X65L 2A1AA 2PQAB 1X55A 1UE5A 2UUBQ 4JI0L 4BY7H 1E7ZA 4DR7Q 1YEZA 1TWCH 1Y1VH 3FKIG 4PZ8A 4GOPA 1EIYB 2JA6H 5IWAQ 1YITA 3STBD 4OONA 4BBSG 2UUAL 4JI3Q 1K73C 1G291 4O2DA 2E2JH 5IYCH 1DGSA 2OQKA 1EFWA 3RNUA 1N36L 3HOXG 2ZM6L 4WJ4A 4GKJL 5H1SE 1TXYA 1YHAA 4AIMA 5IT9c 4DV1L 1SFOH 1QZHA 1FGUA 2PNHA 4HJ8A 1JMCA 3CCEA 5LMNW 3BU2A 2BA0A 1YJ9A 3CMEA 2OCEA 2ZJPA 4HJ9A 3H3VI 1C0AA 1UWVA 1XTDA 4QIWE 3AEVA 3A74A 3L2PA 3PIPA 4LF4Q 3KF8B 4JI1Q 2HHHL 2RHQB 1SMXA 3J81i 3G6EA 1Y1WG 1FJGQ 4DUZL 4LF8Q 1WYDA 3I4MH 1PHJA 3S2DH 5LMUQ 3J81j 2ZM6Q 2DUDA 4GS3A 4DNIA 3J7ZC 3GTOH 4GKJQ 3K8AA 2N3SA 3UDXA 3JAMc 4A3JG 2QGQA 1JT8A 1GD7A 1L0WA 3PUYA 4H02A 4PMWA 4R4OA 3TEHB 1QZGA 2IT1A 4C3IH 4DR1Q 4JBKA 4LF4L 1VQFA 3J81c 4B3TL 1VQAA 4IFDI 4GN3B 2YTVA 3S24A 1XPRA 4B3RQ 4X62L 1Z9FA 1MJCA 5LMUL 4ALPA 4JBWA 1WJJA 2F4VQ 2UXCL 1VQJA 1N34Q 3CD6A 3M9BA 3GTKH 3KDFB 3PF5A 1FL0A 2GN5A 1OTCA 2JA8G 4JI6L 3KF6B 2R93H 4DV5Q 2JQOA 1SR3A 1XPUA 3PSIA 1GVPA 5JEAG 4DR1L 1D7QA 1I3QH 2WAQE 1PH6A 1PH5A 1A0IA 1NY4A 2K5NA 4C3HH 1PH1A 1WCMH 5GAGC 2R7DA 1PVOA 1AE3A 3U4VA 4X62Q 1PV4A 3UE0A 3EN2A 4Y7NH 3KJOA 1D8LA 2AWOA 1CKNB 3CMAA 1N9WA 2VUMG 3HFZB 4YY3Q 5AJ3Q 5IP9G 1HNZL 4ME3A 4LF6L 1V43A 4GKKQ 1YI2A 2KHJA 1W3SA 3L0OA 1PH3A 2UUCL 2KENA 4JI4Q 2K50A 1PYSB 5IE8A 2QA4A 4YWKA 5C3EG 1PFSA 1XJVA 1X3GA 1A8VA 1I50H 1C9OA 2NVYH 2K75A 4B3SQ 4GN4B 4P74A 4OO1G 4A3MH 1QUQB 4GNXC 1M1KC 4X66L 3HOVG 1XNQL 4R4TA 5AJ3L 5GAHC 2E8GA 3GTMH 2GVBA 1SE8A 3F8TA 4RMFA 4GLAC
chains in the Genus database with same CATH superfamily
3HOUH 2MO0A 4F8MA 1JQYD 5EKLA 2B8FA 3T1HL 1RJTA 5I9PA 5GQOA 3K58A 2Q8TA 3HZXA 1EQRA 2PYKA 5ELOA 1HR0L 1LT6D 4XYQA 1KNEA 1EY5A 2ZXOA 3NELA 1W2BA 3W1GA 2NB0A 4IPGA 3J80c 1YZ6A 1VQBA 4ULLA 4PMBA 1K0SA 4A3MB 4DV0L 4JI0Q 3NK9A 1E3PA 3CHBD 3ZJYC 3S2DB 3I72A 4U673 2EDGA 1CA5A 5FOBB 4EQ5A 2UUAQ 2Z4HA 1EZ6A 3ERSX 1PTOB 3MEFA 3CC2A 2L5TA 1ZKOA 3K0XA 4QIWB 2NWGA 3VR5A 4RHRA 1VS0A 3U58A 4OWWB 4M8AA 2ZJRA 3A7LA 4RA8A 2F4IA 5IP7H 3OTOQ 1IBKL 2AUKA 3MXGA 2A74C 1VQ4A 2EVBA 3QR8A 1LLRD 1U9RA 1I4RA 1GUWA 1CA6A 4YWMA 3ONAB 3OHXC 3TP7A 1EWCA 2BCOA 3VYRA 4JOIC 1HH2P 2VQFQ 3RN2A 1YJWA 3MXNB 1PFBA 2I5MX 3OTOL 4EX5A 3HOXH 2Y0SG 5J22A 4K6LA 4JI6Q 3UDIA 5HY6A 1VDZA 3I91A 3H3VH 2RA4A 2OT2A 5FLMG 5JPNC 4POGA 1RKNA 3S15H 1U5KA 2MGSA 1HXYD 1BBXC 4RH6A 1CQVA 1MBYA 1BCPF 2PMZE 5IGFA 3TRZA 1R4PB 4YCVA 2B63H 2IW3A 5GAEC 3CPFA 5C0XI 2MNAA 1K0RA 4LF6Q 3HOXB 4EGVA 1WTRA 3OSOA 5BN4A 3STBC 3TN2A 2K5DA 3SK4A 1BQQT 3KLSX 5BN5A 2KCMA 2RBMA 1H95A 2V4DA 1JOQA 2EJGC 1OO9B 1VF5C 3T13A 5EBCA 5M3FB 1HZ9A 2RF4A 1G2SA 3Q8DA 2F0UA 4A3DG 4O1NA 2JA8H 2MUYA 4CBVA 1VQMA 2QEXA 2JJQA 4LUZA 1K8GA 1KHIA 2UXBL 2E75C 5LL6S 2I07B 1IBLL 3D3RA 4JG2A 3ULJA 1CZWA 5D3DA 1RODA 2N49A 3GTJH 4A3GB 3CP0A 1QILA 3NUCA 2K5VA 5M3FG 2F0WA 4LFAQ 4DAMA 3W2DA 1PTOC 1JOOA 2EE1A 3ND9A 5JJKA 1X6OA 4ZKCB 1SLJA 3FEWX 4KN7C 4A3EH 1MJEA 2QILA 3R3OA 3D6WA 4DR6L 1QVCA 1IZ6A 2F0VA 3HKZE 1JWUD 3H0GH 1AW7A 3PO2G 4DR5L 5K36G 4K0KQ 3J81E 4DR3Q 4X3UA 1Q8KA 4DV6Q 1UAPA 1O78A 1G8ZD 1L1OA 4NW2A 4P75A 1N32Q 5HGTA 1IW7C 1C48A 3N6RA 4MTNA 3AMUA 3U9OA 2F0JA 1VQGA 5NUCA 1CM9A 4DK6C 2K5QA 3HKZB 2IX1A 1DOLA 4LF7L 3DHQA 3CQZH 4DV6L 1UE6A 2NVYB 3S9WA 2AWNA 4YCUA 3D31A 1CFMA 4IUQA 3KOJA 4KJOA 4JI7L 2J7ZA 1Y8PB 1BNZA 3GV6A 3D0FA 2MQHA 5JAVA 1L1OB 2B2TC 2OQ0A 4C3JB 5K5PA 2I0QA 2RCFA 3TP8A 4NDXA 1IYJB 4DV2L 2EY5A 1KQSA 1LYLA 4KLKA 2K6AA 2CWAA 4DFAA 4IZ8A 4JI7Q 5D14A 2QF7A 1ESRA 4A3IB 3KLRA 1MKHA 3KYHC 1RF2D 1NAPA 1OXVA 4QUFA 5D3IB 3H15A 2ALYB 3I4NH 4C3JG 1A63A 4K14A 3V96A 2RHSB 2L55A 2LMCB 3MZ5A 2PPBC 3ITPA 1PTOD 1UE1A 1ZYRD 5C44B 1HNWQ 1TS3A 2X6LA 1LTSD 3NTHA 1ICWA 4K8IA 4RAUC 2F3VA 4JI3L 3GTPH 1BCPB 4K2KA 1J5EL 3GTMB 2KECA 3P75A 2NN6H 5GROA 4DV1Q 1DOMA 1HNWL 4LNQA 3J80L 3PO3H 3NBHA 1SE4A 1L0YB 3WOFA 2B2VA 3EBEA 1MIUA 3BDOA 4FXGC 1CTMA 2ES2A 1KXLA 3RZDB 1G6ZA 1X3FA 2K03A 3B6YA 4HMIA 3V05A 1SSOA 4FF4A 2WP8J 4XDXA 4POFA 4H7BA 3T51B 5IGBA 3RUZA 4KKTA 1KRTA 4CGYB 2QDLA 4OL7A 4HMJA 2D62A 5M5YB 5I6WA 5EPKA 3FPPA 2R7ZG 3HOWH 2UXCQ 2KCNA 3TBIB 4F7XA 3G4SA 2PI2A 1TWFB 1AE2A 3BS1A 1U4LA 1K8OA 3FKIH 2CFMA 3OW7A 3TS2A 5E7NA 2XNAC 1CHPD 1SYCA 3H0GB 2A8VA 4GOPC 4C3HG 4HJAA 2F1MA 1V8QA 4YY3L 3Q6SA 2CW0C 2KEEA 3SE0A 4HIDA 1VQLA 1Q1EA 1TWFH 4DAVA 4GLXA 2P5ZX 1S40A 3PIP3 2GA4B 1KD1C 1KTKA 1H9JA 4B08A 4HCEA 4QY7A 2HT1A 4C3HB 3NENA 3BVGA 5C3EH 1IYUA 3MTSA 3MXUA 1EYGA 2A68D 4JI5L 2YTYA 1UE7A 4A93H 1Y1WB 1STAA 3RLNA 2OTJA 4YHHQ 2EYLA 2H5XA 3VYUA 4KHPQ 3NTIA 1PZKD 3DEPA 2K14A 2X6GA 1LV9A 3W3AA 1B2TA 2ZXRA 1TWGH 4LF9Q 2A1AA 2RDHA 2EY1A 4DR7Q 1E7ZA 4GOPA 1C4QA 1QE6A 5CV9A 4FVMA 1DGSA 4Z9CB 1EFWA 1JC7A 1H9RA 1S4ZA 3HOXG 4WJ4A 4GKJL 1FD7D 3PO3G 4MN3A 5IT9c 1QZHA 2JA5H 2PNHA 4HJ8A 1LT5D 2OCEA 4ILWA 4HJ9A 1C0AA 5FO8B 1SYFA 2XRQD 4QIWE 2WINB 3KF8B 3L3OC 2SDFA 3G6EA 3J81i 4NMZA 4DUZL 4LF8Q 1WYDA 2EY6A 1U4PA 2DUDA 4GS3A 4DNIA 3J7ZC 4GKJQ 3DEOA 2Z8LA 3K8AA 2N3SA 3JAMc 1JT8A 1A2TA 4PMWA 4G7HC 4B3TL 1V1PB 2CVRA 3S24A 1XPRA 3NWSA 1Z9FA 4G4KA 3URYA 3RD4A 1F2MA 3OIQA 2KEDA 4KJNA 1N34Q 2A69C 3M9BA 3S2HB 2YU9B 3DWQA 3KDFB 1OTCA 2JA8G 3HOUB 1EL0A 1DYQA 1PH6A 2K5NA 2R92B 1XTCD 2L4NA 4C3HH 4K5WA 2HCCA 2R7DA 5DAUA 5CV4A 3SXHA 3EN2A 1LTBD 4Y7NH 1D8LA 3CMAA 2PQEA 3GTGB 1HUNA 1V43A 5C3WA 3DUZA 1PH3A 2UUCL 1Q8IA 5C0XH 3DM1A 2QA4A 1NNXA 4ZUIA 1X3GA 1C9OA 2K75A 4B3SQ 1XXGA 4P74A 4A3MH 1BXTA 4ZUJA 1XNQL 5DEHA 5AJ3L 5GAHC 3K5MA 4ZKBB 1TWCB 3F8TA 3LGJA 2PNRC 3QG1A 1Q1BA 2E2DC 1TY2A 2NUCA 4IQZA 5LMNL 1S72A 1QVGA 3J80E 1BOSA 3EQLC 3DM3A 4PG3A 2SOBA 2MPMA 3UDGA 2EXDA 3CC4A 4GLVB 4CDEC 4IO9A 1W6KA 3M85A 3KBGA 3I4NB 2K7VA 2HCIA 5M5XH 2YV5A 1TQOA 3FRPB 4LJZC 1B7YB 2NZHA 3OYYA 2HDLA 3BDCA 1NCVA 3NEMA 2AMCB 5I9OA 5IWAL 1HR0Q 4OXPA 3M4PA 2FXQA 3EFXD 3DWAA 4A3BH 4WRDA 4DAYA 1CKNA 2B63G 4IOAA 3K80C 1EY0A 5EAYA 2VY3A 2XTIA 4WFN3 1Q81C 1B9NA 4WORA 1X9NA 1C7YA 3QOLA 2EYMA 5DM63 2IY5B 2F0MA 3K7AB 1WCMB 1HNXL 1I4GA 1CZGA 2E2JB 3H3VC 3K57A 1FJGL 2R93B 4DV3L 1F9SA 1Y8OB 2NVTH 2B63B 2HDMA 3JAML 2WACA 3OPOA 3R8BA 1F2ZA 4ZQ3A 2JEBI 4K8JA 4PZ6A 5C44H 3L7ZC 4HIMA 5M5WB 1WFQA 4RHSA 4B3RL 4EQOA 5JEAH 4HJ7A 1L1OC 1E24A 1SEBD 1IBKQ 2R93G 3PIO3 4Y52H 1A62A 1YNNC 1FVIA 1QJOA 2EJMA 2K28A 3SVMA 4OO1I 3WWVA 4IFDG 4JOIA 4DA2A 4P71A 4KI0A 4JI2Q 4QUCA 1EIFA 2NTTA 4ZCKA 3A54A 2VQFL 1STHA 4DK1A 3L9AX 1O7ZA 1VQIA 2I5LX 4ZYSA 3A5UA 3I55A 5C4XB 1HQRD 4N8X1 1IHZA 4BA1I 4JI2L 2K5WA 4YIJA 4CDDC 1BKBA 4P2CB 2RCNA 3OWFA 1RIPA 1EFID 1ENCA 3E9HA 1KDAA 2KJXA 2MJ8A 3A5ZB 3ULLA 1F2YA 1SXTA 2R7ZH 1X65A 4FF2A 2A69D 2EYFA 4A3GG 4XT3B 5D65A 1MGSA 5JPMC 4DV7L 1GUOA 4K5VA 1MSGA 5E3FA 5E4XA 5HGQA 2Z4IA 1J8IA 1QUQA 5IYBG 4JBMA 4PV1C 3E9IA 2AUJD 1TWAB 2ZTCA 2NVQH 4BXXG 4AYBE 4DV7Q 2C35B 1RL2A 1EY4A 4KV6A 2DGYA 4ABNA 5IP9H 1WTWA 4K5XA 3K5LA 5IYCG 1TKWB 5LL6X 1IBLQ 2F0DA 1JICA 5JOBA 1L0XB 5JJZA 2R92H 3E0EA 2B2VC 2K52A 1PH7A 1BVSA 1KDBA 5CGKA 2F0TA 4B3MQ 3GDEA 2D2CC 1VQKA 3I4NG 2NZOA 1IL2A 4HCSA 5COYA 2I5HA 2Z0SA 1PRTC 2B2WC 4HIOA 2WV6D 3RZDH 5IT9E 1DJRD 4A3FH 2Z6KC 1JR0D 3ZYYX 2Q8IB 4C3IB 4NXNQ 1DXMA 2PZTA 3PO3B 3KUPA 4LMQD 1LUZA 3CCLA 5JJIA 3TP5A 1OXSC 3IAYA 4N8FA 1B50A 2AHOB 4DUYL 5CV7A 3NHHA 2EYPA 2IWHA 1KDCA 3M4OB 4C2MB 2PI2E 2BH8A 3V2TA 1SMYD 4ID6A 1SBBB 1F9RA 3PQIA 2M2LA 3NQIA 4NXMQ 2PMZB 2D0PA 4DUYQ 2R7FA 3J7AV 3A56A 2RDFA 3H91A 5CR3A 3HOUG 3I90A 4XQJA 3CU7A 5CV6A 4KTAA 4A3EG 1HR0W 2C9OA 1O7IA 4XYOA 1JB3A 2F3WA 4KMUC 4EQPA 2JA8B 4NKLA 3WDNA 3ND8A 2JXMB 1ILQA 4C3JH 2Z6KA 3I3CA 3OW2A 2UUBL 3J80i 2VQEL 1PH9A 1TVXA 3DWPA 1WD1A 4BY7G 3BZCA 4R4CA 3S1MH 1QNUA 2GVAA 1A15A 3U9SA 3W1BA 2CW0D 3A55A 1ONLA 1B3AA 3C1EA 5CBEE 1R9TH 1VQEA 2YTXA 3R2TA 1G51A 3I56A 2VQEQ 2ICIA 4KY7A 1VQ6A 1Q46A 4HR7B 1NMFA 2HHHQ 1D1KA 2B8GA 2LXKA 3J7AF 1HHVA 2M9VA 1S5CD 3W5OA 1NR2A 5EGTA 3MC0B 3MHBA 2B2YC 4PQXA 4LFAL 2EPBA 1QB5D 1FNVA 3I7FA 2XWJB 2CWPA 3S14H 4FYDA 4UAIA 3I2ZA 1JE4A 5C3XA 5DNFA 2UU9L 4LFBQ 3FP9A 4A3CH 5TSSA 1E2WA 3H0GG 4FXDA 1D5MC 3T1YQ 4DR6Q 1HRJA 1TIID 5KNCA 3K5NA 3S1NB 2CQOA 2F4VL 2LKVA 1FR3A 3MFGA 4P73A 2CQAA 2KA7A 2C5CA 4KHVA 5IP7G 1A3VA 2N78A 1Y1VG 2VL6A 1I6HH 5CMDA 1EQQA 4R8NA 3C46A 1CHQD 1JWMD 4A3KH 2CHBD 3RN5A 1Y8NB 1CSPA 5ELEA 1ESFA 3CCQA 1GXDC 4EQNA 3PUWA 4ME5A 3F2CA 3FDTA 4A3IG 1M8AA 3GV3A 1ILPA 4KN4C 4JI4L 1D2BA 1EEFD 2Y0SE 1PA6A 3H94A 2UXDQ 4RG1A 1FNUA 2F03A 1AH9A 4RWSC 4KHZA 1BCPD 5J3BA 3RZOH 1XMOQ 3M7GA 1Y14B 3S16B 5KRUA 2KCCA 4V0BA 4OO1H 2ASBA 3HKSA 1AZPA 3T1HQ 4X64Q 4TKOB 4DN4M 1D5XC 2ZT9C 5BN3A 3VDYA 1N33Q 1SJHD 2Q2UA 1IYVA 1BBUA 5IODA 1XMOL 4G7OC 2HQLA 4YWLA 2B3GA 1HZAA 4X65L 2PQAB 1UE5A 3MXPA 4CJ0B 4JI0L 4BY7H 4Y7NB 4OGQC 3HS0C 4XQQA 3TSSA 1YITA 3STBD 3OMGA 4OONA 4BBSG 2UUAL 4JI3Q 1EU4A 2E2JH 2ICEC 1YNJC 4QMGA 2OQKA 3VR2A 1HTPA 2F0LA 5H1SE 1SFOH 1B44D 3H3VI 1YJ9A 5A2QE 1UWVA 2QCPX 3KK7A 3AEVA 3A74A 4JI1Q 1SJED 5EPLA 3O13A 4DK0A 5A35A 1EU3A 1TY0A 4IURA 4KY6A 3J81j 3GTOH 2QW7A 3TMEA 3TEHB 4R4OA 3GTQB 1QG7A 2F0OA 1VQAA 4IFDI 4GN3B 4KK7A 2FHTA 4X62L 2EOTA 4JBWA 1WJJA 2UXCL 1VQJA 1V1PA 5G3LD 1FL0A 4DNRB 3KF6B 2JQOA 4XXEA 3PSIA 1I3QH 2WAQE 1PH5A 4IUUA 1A0IA 5AFWA 2K01A 3FPUB 3WOEA 3QOJA 3U4VA 4CKBA 2KVMA 3KJOA 2AWOA 2VUMG 3HFZB 4OIJA 4YY3Q 4A3FB 4EVOA 4DXGA 1TWGB 5IP9G 1HNZL 4ME3A 1HFNA 4GKKQ 1YI2A 3L0OA 3OOCA 3Q22A 1PYSB 5C3EG 4BWGB 1PFSA 1XJVA 2NVYH 1I50H 4GN4B 1V1OA 3DMUA 2A5HA 1M1KC 2FFKB 4X66L 3SK8A 1Y1VB 1TT2A 1J6QA 4GKKL 5EPJA 4WJ3M 1I50B 4JI5Q 3PF4A 5ELFA 1PXUA 2DY8A 2KHSA 1GUNA 2KBNA 3CCSA 3I8ZA 2K5HA 3TZDA 5G3LF 2K32A 3SGIA 4B3SL 5FK9C 1WTHA 2L11A 4KHPL 3NWTA 1XWEA 4X66Q 2F0IA 2IL8A 4C1NK 1XNQQ 1PTOF 2LXJA 3BZKA 3FHWA 2WKDA 4RGTA 4UPAA 2IHEA 5IGCA 4A3EB 2E2HH 2NTSA 3MWYW 1WCMG 1K83B 4DKAC 2DJFC 2MO1A 3MVVA 1IKLA 1TWHB 4C56C 3J7A5 1TU2B 2Q2HA 1N36Q 3AFQA 1SNDA 1B70B 1M90C 3JC66 1X3EA 5ISRA 5EKIA 4H0LC 2WB1E 4JI8Q 4BY1G 3JAMi 4RGNA 5BR8Q 3CCUA 5ELNA 4JYAQ 3K7UC 3OIPA 4LW1A 4CKCA 1M4VA 1UEAB 1O80A 3AQQA 4TVAB 2ID0A 1N32L 5IGEA 5CORA 1HZBA 1VQ8A 3F2DA 1PH4A 1XNRQ 1PRTB 1EUJA 3D4WA 4APVA 3S1RH 5IYDH 4KKSA 2VS1A 2ZTDA 5BR8L 1NE3A 3QB3A 5LHY1 1ASZA 1HNXQ 4JYAL 4A3BB 3CF5A 4RCNA 3MEHA 4JCVE 1F2LA 2A6HD 4B3TQ 1EY7A 3S1NH 2F0FA 4IUNA 2IJ0A 4DV3Q 2PW5A 2BA1A 1E1TA 5C5LA 1MI2A 1XNRL 2XRSD 1N34L 4JK1C 4CJ1B 1OXXK 2OWOA 3S14B 1UNSA 2QEJC 3G7LA 3JAME 5ELCA 4ZRZA 4DV2Q 1XYIA 4S3SA 3GQBA 2JEAI 4C2MH 4XQNA 1KLGD 3S1QB 3D8GA 2YYZA 2NVQB 1AEXA 3I4MG 3NBHB 1HQMC 4KD4A 2HD3A 3GTOB 3D6CA 2F3IA 1ET9A 5C4JH 1VQDA 1NTGA 5CV5A 1JORA 1WI5A 1PFMA 2H4OA 3AU7A 4X3TA 4ZK9B 1D5ZC 1QVFA 1GO3E 2RSNA 3A8IE 1STBA 1GOZA 2NN6I 1PZJD 1FYCA 2ZXPA 1T9HA 4AYBG 1AFPA 1G91A 2R3ZA 3PGZA 4OWXB 2G9HD 4JV5Q 3KJPA 2VUMB 3NTKA 3K6OA 1KABA 3M4QA 4QJFA 4DR4Q 3NQTA 4GN5A 4RKBA 4NB3A 3SR1A 2BE5D 5IIFA 3X3NA 3K59A 1Z47A 4AYBB 1CK1A 5FJ8H 4DV0Q 4R9WA 2M00A 2LSSA 2KHIA 1EZ8A 2Z9HA 2QKIC 4GNXB 3CRLC 4DR4L 1EQVA 4GOPB 4QF4A 4DAPA 3GO5A 3MAQA 3S16H 2F0SA 2X69A 3ERQA 4HN7A 3VR3A 1HCZA 1B53A 4PNYA 5E4WC 4DV4Q 1FGBD 2XVSA 1LACA 4RGMA 3E0JA 2VB3X 1VQPA 4A3DB 1XMQL 3GTLH 4HJ5A 1SN8A 4NPSA 2JA5B 1E2ZA 3Q24A 5FLXc 2B2WA 1SRUA 3GTJB 4A3GH 3OWEB 1ZEQX 3EIVA 1ASYA 5C4XG 2K33A 3OMCA 2DY7A 2YU9H 1XMQQ 2EY2A 5C5MA 3HOZG 5C4XH 2LS01 5JVH3 2RQXA 2JA5G 2WKCA 3Q0AA 3SK6A 5M3FH 2B29A 1GKHA 2Q2TA 2ZTEA 2N55A 1WTPA 1W6JA 1LTLA 1VMCA 1XPOA 1EY8A 2IX3A 3LWEA 2O5JC 1EIHA 3VA7A 3X3MA 4R4IA 4IOCA 4BY7B 3CXCA 4MZ9A 1KAWA 1Q90A 3PO2H 2JSOA 3HOWG 4TRDA 3M4YA 2BH2A 2EYJA 1LO5D 5M3MH 2VZAA 5K36H 3HKZG 2XN9C 2J0TD 3VR4A 2I46A 1VQ7A 3PIOA 1HA6A 1LTRD 2NVXB 1LTAD 4HIKA 1PFNA 4A3FG 2E2IH 3VR6A 4IALA 3EJIA 4L5RC 4IN3A 1I4XA 1LTID 4DF7A 1VQOA 2L0CA 1VCIA 4A3IH 1XX8A 1U0LA 2UXBQ 1PRTD 1ET6A 5IYBH 1X56A 4QL5A 1ICFB 2XGTA 1SDFA 4OIKA 2G9DA 3H09A 4IUPA 4DUZQ 1HA5A 3A8JE 1GM5A 1S5DD 2JP1A 3HEJA 2A68C 4A4IA 1I94Q 4C1NI 4DU9A 1EY9A 1A3UA 2K04A 3M7NA 1KL9A 1OXTA 1E22A 2E76C 3KLWA 3CQZB 1I5FA 5F2DA 5EJWA 5JJLA 3QO2A 2AQ1B 3PV0A 4TSSA 2D0OA 5C44G 4BBRB 4B3ML 1GJXA 3UDFA 4LK1C 2L15A 1SMYC 4DR3L 3M4OH 3E6ZX 4HTHA 4DV5L 5FLXE 1Q82C 1Q86C 1IKMA 4UY8C 1SNCA 2NYZD 3R2IA 2UU9Q 1TWHH 4LFBL 2F0HA 5JVG3 1K83H 1X3PA 2WAQG 4R8IA 4IPHA 1BCPC 5FLXL 4BBSH 1H9SB 1II3A 5FLMH 4LFCQ 1JJCB 4I7ZC 3UI2A 1I6VC 4X3KA 2NN6G 4P72A 5T1IA 2ZJQA 4BS9A 4OELB 4FNFA 5GADC 4GZYC 2UUCQ 3A8KE 3ULPA 2DNEA 2O2LD 4CDFC 4KD3A 1EOVA 4A3BG 1S5ED 1V9PA 2HUGA 4LFCL 3EROA 4IJLA 3G48A 3R93A 2DNCA 4IJHA 2VW9A 1HFGA 5LMNQ 4I65A 3S1MB 3VYTA 4CHTB 3ER0A 1L2FA 2VXWA 4LUVA 4FXKC 1SNOA 2IX0A 5I6YA 2UXDL 4A76A 2RKSA 3TDQA 1JB7A 1MD2D 4DXFA 3S2HH 3CW2C 4OEMB 3IRBA 1H9SA 1K8AC 4F88A 2HIVA 1AZQA 2PZUA 1TS4A 4KKUA 4HAEA 4IUVA 3QIAA 3HP3A 5CV8A 1YEZA 1TWCH 1B3QA 1EYDA 3FKIG 2JA6H 3N52A 4KY5A 1K73C 1STGA 2L1BA 4O2DA 1TS5A 5IYCH 3RNUA 2ZM6L 3EVQA 1JWSD 1TXYA 1YHAA 4AIMA 4DV1L 2L9HA 1FGUA 3CCEA 5LMNW 2BE5C 2R61A 2BA0A 3CMEA 2ZJPA 1BR9A 1MHWC 3KF8A 3PIPA 4LF4Q 2SNSA 4JVZA 2XIWA 3AB9A 1KAAA 2NBFA 1Y1WG 1S5FD 3I4MH 3T4AC 1PHJA 3S2DH 5LMUQ 4PMCA 4O42A 2D5DA 4MIUA 3Q23A 5J39A 5ELBA 2QGQA 1L0WA 1X32A 3K5OA 2IT1A 4JW0A 1X3QA 3HGBA 4C3IH 4L63B 4DR1Q 4LF4L 2EJFC 4CDCC 2EYHA 2YTVA 4B3RQ 4ALPA 4UDUC 4C3IG 4X3SA 2F4VQ 4J1MA 5DM73 1EQTA 4ODGA 5EBDA 3M3YB 4NP5A 4JI6L 1SR3A 2O4XA 3P20A 2DJGC 5JEAG 1Q3LA 1E0BA 4DR1L 3C3LA 5C3EB 1DOKA 4A93B 1PH1A 5GAGC 1AE3A 1I6HB 3I73A 4X62Q 3SK5A 1VF7A 1SNMA 3TP6A 1YNJD 5EKKA 3DXJC 4QCLA 4LF6L 5FKAC 2KHJA 2F0GA 5A2QL 4JI4Q 1QWYA 5IE8A 4F87A 1J9OA 5I4DA 5C4ZA 4JPBW 2Y0SB 2F0QA 5IGGA 2RSOA 1PMRA 1KLUD 1S5BD 2E2HB 1A3TA 1QUQB 4GNXC 3C1FA 2CH4W 3T56B 5C4JB 2TMPA 3CRKC 4R4TA 3GTMH 2E8GA 2GVBA 1VMPA 1CSQA 3TQYA 1EWIA 2IPKD 2WAQB 5CBAE 3GTKB 1EWHA 4J8QA 4CJ2C 4YHHL 2AQ3B 4WJWA 1JOKA 4I7AA 1N33L 3GTGH 1GUGA 4PZ7A 1U4RA 4HEDA 1BBWA 4LWCA 2FJ2A 3K81C 4QQBX 2JYOA 3TZUA 2HQEA 1RTNA 2JA7G 2TSSA 2A6EC 4X65Q 1VQ9A 2AKWB 4FO2A 4BY1B 1WTQA 3K0YA 1PYBA 4LUOA 1S3OA 4DR7L 1I4HA 1LT4D 4OX9Q 5M5XB 2RVLA 4YCWA 5CC4A 3J7YW 1R4QB 4BXXH 3T53B 5T1GA 1IXRA 4IFDJ 3G71A 1HJPA 4IPDA 2DN8A 3CCRA 1JCKB 4L5TA 1UEBA 2VB2X 2JA7B 2OEOA 4OX9L 4B9WA 1D1IA 3FVQA 1KIXA 1IBMQ 3HOYH 4GNXA 4L6TB 5IY0A 2E2IB 1EOTA 1H9KA 5FO9B 4JC0A 5C6AA 3I4OA 3HOYG 2L12A 2NVXH 1K28A 2JA9A 4NXNL 2R7ZB 4A3DH 4LF7Q 1IBML 4XIGS 4FF1A 1YIJA 2F52A 2PW7A 1F9QA 3VA5A 2NVTB 1P8LA 4R4QA 4K6DA 2R6GA 3MXNA 1GUTA 4QGUA 2CCZA 5KNBA 4FDBA 3HOYB 4HSPA 4BA2I 5J1ZA 4DPGA 5IT9L 1EYAA 1JJ2A 2OF1A 4AQYQ 2VUMH 1EY6A 4RCOA 1LTTD 1WTXA 3P7JA 4BBRH 1VQHA 1SYDA 3PCOB 3E3XA 1HNZQ 1B9MA 3CKIB 1SE2A 4BBRG 3PUXA 4AQYL 2E74C 1YVCA 3CCVA 2B2UC 1V1QA 2J4XA 3BYYB 4TQUS 4OHJA 2Q8RE 3A0JA 2PQAA 3HRZC 2K4KA 2WB1G 3GD7A 3J81L 1WTOA 5M5WH 2MP1A 4A3CG 3EA6A 1WTVA 1CKOA 2Q2IA 5FO7B 2LFNA 1N8RC 2E5LL 1P16A 1PZID 3GTLB 4OWTB 1J5EQ 1DONA 1B8AA 1STYA 1DD2A 1NJIC 1MSHA 1A2UA 4G7ZC 1CT1D 1STNA 3TREA 3NPPA 3FMCA 5DLQE 2JE6I 2E5LQ 2JA7H 4BBSB 2FINB 2FMCA 1HPCA 1T5XD 2BDOA 3QWNA 4A3JB 2WIIB 4A3LG 3U4ZA 1NSNS 1SNPA 1K8MA 3SDZA 2JN4A 5CYUA 4JV5L 5HURA 1LM0A 4DR5Q 1B1ZA 1RTOA 4K0KL 2B39A 2LY7A 3U50C 1RHPA 1YHBA 5KYIA 3CAMA 4BY1H 1PYWD 3D4DA 2H1EA 1VQ5A 1WD0A 2B2UA 2EXZA 3LNNA 4N9TA 4JI8L 3T1YL 3KFUA 2VNUD 1G6PA 1G2TA 4LF5L 1PH8A 1AN8A 4A3KB 1PDQA 1SNQA 4N9PA 4L5SA 3NXWA 2XSCA 3KDFA 1CI3M 1X54A 2BDNA 2F0PA 2OXPA 5M9OA 1JE5A 1HZCA 4UP7A 1ENFA 1NMGA 4MTKA 4A75A 5C4HA 1WVLA 4DAYB 1WOCA 4LF5Q 1IW7D 1NUCA 3KLSA 1TWAH 1E1OA 3BDLA 4O0AA 4DV4L 3BJUA 4A3KG 1SYGA 1Q12A 4ZLTF 4DR2L 3I4MB 3LWUA 3RLFA 3AYHB 1VQNA 4K2LA 1DM0B 4JBJA 4L8JA 5EQ0A 2PZWA 2JA6G 2CKZB 2O5IC 2A73B 1K9MC 4V190 2MFIA 4MNOA 3IL8A 2KQ3A 2PO4A 3PUVA 1QCBD 4R1JA 3SHLA 2F0EA 2EZVA 3F2BA 3HOWB 1I4QA 3UE1A 3BZDB 3HG9A 4A3MG 5FJ8G 1QNKA 4DR2Q 3IFDA 3PMFA 5KIXA 3BYTB 3LX0A 3E5SA 4X64L 2A19A 4E6IA 2F0KA 1Z6HA 3M3YH 3C2PA 2JA6B 2EYOA 3NSWA 5E1FA 4ZAIA 4A93G 1O7YA 3SEBA 1F77A 1YJNA 1HUMA 3PUZA 2PCFB 5L37A 4LF9L 1PH2A 3D4RA 3CPWA 1U4MA 2ENBA 3F1ZA 4LAAA 3NP8A 4M1UB 1EEID 1DCZA 1HTLD 2B2YA 5M3MG 4UP8A 1YNND 2CH4A 2G5DA 3AFPA 1QOHA 2D9UA 2IHFA 1PLFA 3P1HA 4QB4A 3NE5B 4A3LH 1BDOA 1K3BC 1DZ1A 4JI1L 1Q7YC 5M3MB 1B4OA 2HIXA 1NBWA 3RLOA 4LF8L 2WB1B 3IFTA 4DK3C 2Z6BA 5ELDA 3RR5A 1RD9D 2KCTA 2A6ED 4XT1B 1YHQA 2KUMA 1CKMA 1E2VA 4A3JH 2WFWA 3NBIA 1VQCA 4B9XA 1ENAA 3K7AH 4FP5D 3S15B 3TS0A 1JJGA 5C0XJ 3S17H 1I94L 3QJYA 3HOZB 4IPCA 5JEAJ 3VYSA 1RCVD 5IYDG 3CC7A 1ZYRC 4DNTB 3GTQH 3ICEA 2V1CC 4J15A 4RGOS 2B2TA 1YNXA 1STEA 1CUKA 5KYLA 1OXUA 4X6AH 4H44C 1KC8C 3HOZH 3KBXA 2JK8A 4UP9A 1AP0A 4IFDH 1K3RA 1GHKA 2QDBA 2Z1CA 4XTCS 4J6HA 2ATWA 5C0XG 5IOCA 2R92G 3KF6A 4CKEA 3I4LA 1I3QB 2EQSA 1GHJA 3HOVH 3DLLA 3H6MA 4NXML 3GTPB 1KRSA 4FF3A 3A7AB 2N8NA 4H13C 1Y69U 3FKIB 2OTLA 2EIFA 3BVZA 2K1BA 1PTOH 5I2XA 5IGDA 3CCJA 1SYEA 2MHVA 3BG3A 4Q0FA 4AH6A 3S1QH 4L5QA 2FMMA 2N88A 3CCMA 1H9MA 1I4PA 2XWBB 1YBYA 5M5YH 3PO2B 1A6XA 1SROA 1R9TB 1X55A 2UUBQ 1TS2A 1BUVT 4RKLA 1EIYB 1Y1VH 4PZ8A 5IWAQ 1LTGD 1G291 1LT3D 1RDPD 1N36L 4MHEA 4IUTA 1SYBA 1BF4A 1JMCA 2KOLA 3BU2A 3BVMA 1EIGA 4UHVA 2RDGA 1XTDA 2BOSA 3L2PA 1EYCA 3I70A 2HHHL 2RHQB 1SMXA 1ZXTA 1FJGQ 5KEEA 2ZM6Q 1C8CA 4Q5VA 2F0NA 1UUPA 3UDXA 4A3JG 1Z7TA 1GD7A 3PUYA 4H02A 1QZGA 1FNWA 2SNMA 1LABA 4JBKA 1VQFA 3J81c 2AQ2B 3S17B 1NR4A 1MJCA 5LMUL 5KNDA 2SEBD 3GP7A 3CD6A 3MFYA 1F9PA 3GTKH 3PF5A 1GUSA 1CQFA 2GN5A 2R93H 4DV5Q 1XPUA 1IL8A 1GVPA 1SE3A 4RFBA 1D7QA 3RZOB 3F2UA 1NY4A 1WCMH 1PVOA 2K05A 1PV4A 5I2YA 3HOVB 3UE0A 2NZ1D 1CKNB 1N9WA 4HSVA 3RMHA 3G6JB 3T16A 5KGUA 1ML0D 5AJ3Q 1KNAA 1D6EC 3S1RB 1W3SA 4DGZA 1TR5A 1T5EA 2KENA 2K50A 1SAPA 3MA2B 1SFOB 4YWKA 2A6HC 4G57A 1A8VA 4OO1G 1BO0A 1PRTF 4U68A 3HOVG 1O7LA 1Y1WH 1SE8A 3IKJA 4RMFA 4GLAC
chains in the Genus database with same CATH topology
1J6QA 4GKKL 4WJ3M 3HOUH 1CSQA 1Q1BA 2MO0A 3TQYA 5LMNL 4JI5Q 3PF4A 1S72A 1EWIA 1QVGA 3T1HL 2KBNA 3CCSA 2K5HA 3DM3A 4YHHL 4PG3A 5GQOA 3SGIA 3UDGA 2EXDA 4B3SL 3PO3G 1EQRA 3CC4A 1N33L 3GTGH 4GLVB 5ELOA 4PZ7A 4KHPL 4X66Q 1BBWA 3M85A 4IO9A 4LWCA 1HR0L 1XNQQ 3K81C 5M5XH 2LXJA 2YV5A 4QQBX 3BZKA 3FHWA 3NELA 1W2BA 3W1GA 1B7YB 2NZHA 3OYYA 2JA7G 4UPAA 2IHEA 4IPGA 4X65Q 3J80c 2AKWB 1YZ6A 1VQBA 3NEMA 1VQ9A 2E2HH 1PYBA 4LUOA 4DV0L 1S3OA 2AMCB 4JI0Q 4DR7L 1E3PA 4OX9Q 3ZJYC 4YCWA 1WCMG 5IWAL 4DKAC 2MO1A 1HR0Q 4EQ5A 4BXXH 2UUAQ 4OXPA 3M4PA 2FXQA 3J7A5 1IXRA 3ERSX 4A3BH 3G71A 4IFDJ 1CKNA 1HJPA 2Q2HA 3MEFA 4IPDA 1N36Q 3AFQA 3K80C 3CC2A 5EAYA 1B70B 2VY3A 2XTIA 1M90C 3JC66 3CCRA 1X3EA 1Q81C 1X9NA 1C7YA 2WB1E 1UEBA 4L5TA 4BY1G 4JI8Q 3K0XA 3JAMi 4OX9L 5BR8Q 3CCUA 2IY5B 5ELNA 1KIXA 1IBMQ 1HNXL 3HOYH 3K7UC 4LW1A 4GNXA 4JYAQ 5IY0A 1VS0A 3U58A 4TVAB 2ZJRA 3AQQA 4OWWB 1FJGL 2ID0A 4JC0A 1N32L 4DV3L 3I4OA 3HOYG 1HZBA 1VQ8A 3F2DA 1PH4A 1XNRQ 2NVTH 1EUJA 5IP7H 3OTOQ 1IBKL 4APVA 2NVXH 3S1RH 5IYDH 2JA9A 4NXNL 2VS1A 1VQ4A 2ZTDA 4A3DH 5BR8L 2JEBI 4LF7Q 1NE3A 1ASZA 1IBML 1HNXQ 4XIGS 4JYAL 4PZ6A 5C44H 1YIJA 2F52A 3L7ZC 3CF5A 4HIMA 4JCVE 4YWMA 4B3TQ 1WFQA 3S1NH 1P8LA 4R4QA 4B3RL 4JOIC 1HH2P 2VQFQ 4DV3Q 2BA1A 2R6GA 4QGUA 1E1TA 3RN2A 1YJWA 3MXNB 4HJ7A 2CCZA 1L1OC 1E24A 2I5MX 4EX5A 3OTOL 4FDBA 1N34L 1IBKQ 2R93G 3HOXH 4Y52H 1A62A 4BA2I 1FVIA 2Y0SG 4DPGA 4JI6Q 1OXXK 3UDIA 4AQYQ 1JJ2A 5HY6A 2OWOA 3WWVA 4IFDG 4OO1I 4JOIA 2VUMH 4P71A 3H3VH 4KI0A 4JI2Q 5FLMG 4DV2Q 1EIFA 2JEAI 4C2MH 4POGA 2VQFL 4BBRH 1U5KA 1VQHA 3S15H 3TRZA 2PMZE 4YCVA 3PCOB 2B63H 1VQIA 2I5LX 2YYZA 5GAEC 3CPFA 5C0XI 2MNAA 1HNZQ 1K0RA 4BBRG 3PUXA 3A5UA 3I55A 4AQYL 1Q86C 4LF6Q 3NBHB 3I4MG 1YVCA 4BA1I 3CCVA 4JI2L 1V1QA 4TQUS 2F3IA 5C4JH 3A0JA 1VQDA 1NTGA 1BKBA 2PQAA 2RCNA 1WI5A 3STBC 2K4KA 1RIPA 2WB1G 3GD7A 5M5WH 3E9HA 1QVFA 4A3CG 1GO3E 2KCMA 2NN6I 1CKOA 2Q2IA 3A5ZB 1H95A 1N8RC 3ULLA 2E5LL 1T9HA 2R7ZH 1X65A 4AYBG 1P16A 1HZ9A 2RF4A 4A3GG 4OWTB 1J5EQ 3PGZA 4OWXB 4DV7L 3Q8DA 1B8AA 4A3DG 2JA8H 1NJIC 4JV5Q 3KJPA 1VQMA 3TREA 2QEXA 2JJQA 5JJIA 4LUZA 1K8GA 5HGQA 1KHIA 2UXBL 1IBLL 5DLQE 2JE6I 4JG2A 4QJFA 3M4QA 3ULJA 2E5LQ 2JA7H 4DR4Q 4A3LG 1QUQA 4GN5A 5IYBG 4JBMA 3U4ZA 3E9IA 4NB3A 2N49A 3GTJH 2ZTCA 2NVQH 4BXXG 3CP0A 4AYBE 1Z47A 2K5VA 2C35B 1RL2A 5M3FG 4DV7Q 5IP9H 2DGYA 5FJ8H 4DV0Q 4JV5L 4LFAQ 4DAMA 5IYCG 1LM0A 2LSSA 2KHIA 4DR5Q 2B63G 4K0KL 4IOAA 4GNXB 5JJKA 1IBLQ 1X6OA 3U50C 4DR4L 1SLJA 1YHBA 4GOPB 4A3EH 1MJEA 3CAMA 4BY1H 1Y1WH 3GO5A 2R92H 3E0EA 1VQ5A 2K52A 1PH7A 2VNUD 3KFUA 4JI8L 3T1YL 3S16H 4DR6L 1QVCA 1IZ6A 1BVSA 1G6PA 4LF5L 3HKZE 1PH8A 4B3MQ 3GDEA 3H0GH 1VQKA 3PO2G 3I4NG 2NZOA 4DR5L 1IL2A 5K36G 4K0KQ 4DR3Q 4L5SA 2I5HA 1Q8KA 4DV4Q 2Z0SA 4DV6Q 3KDFA 1X54A 4HIOA 4P75A 1L1OA 3RZDH 1N32Q 1VQPA 1JE5A 1HZCA 4A3FH 4UP7A 1XMQL 1NMGA 2Z6KC 4HJ5A 3GTLH 4MTNA 4A75A 1SN8A 4NPSA 4NXNQ 4DK6C 1VQGA 4DAYB 1WOCA 4LF5Q 2IX1A 4LF7L 5FLXc 2UXBQ 1SRUA 1TWAH 4A3GH 1E1OA 3CQZH 4O0AA 1LUZA 3BJUA 3EIVA 4DV4L 4DV6L 1UE6A 4A3KG 1Q12A 3CCLA 1OXSC 2AWNA 4YCUA 4DR2L 1ASYA 3D31A 3RLFA 5C4XG 3AYHB 3KOJA 2AHOB 1VQNA 4JBJA 4DUYL 2YU9H 4JI7L 2JA6G 1XMQQ 2CKZB 3D0FA 2MQHA 3HOZG 5C4XH 1L1OB 1K9MC 2MFIA 4MNOA 2OQ0A 3PUVA 2JA5G 2PI2E 4R1JA 2BH8A 2I0QA 1IYJB 3F2BA 4DV2L 5M3FH 2B29A 1GKHA 3UE1A 1KQSA 4A3MG 5FJ8G 2Q2TA 2ZTEA 4DR2Q 1LYLA 4KLKA 4NXMQ 2CWAA 2D0PA 4DUYQ 4JI7Q 1LTLA 2R7FA 1XPOA 4X64L 2A19A 3HOUG 4R4IA 3M3YH 4IOCA 4A3EG 1HR0W 1MKHA 4A93G 3CXCA 3KYHC 1O7IA 4MZ9A 1OXVA 1KAWA 3H15A 1YJNA 2ALYB 3PO2H 3PUZA 3HOWG 3I4NH 1A63A 2RHSB 2BH2A 5M3MH 4LF9L 2VZAA 3HKZG 1UE1A 1PH2A 3CPWA 1HNWQ 4C3JH 2Z6KA 3OW2A 2UUBL 3F1ZA 3J80i 1VQ7A 2VQEL 1PH9A 2JA5H 3PIOA 5M3MG 4BY7G 4UP8A 3BZCA 4HIKA 4A3FG 2E2IH 4R4CA 4JI3L 1J5EL 3GTPH 4L5RC 3S1MH 2GVAA 3AFPA 3W1BA 1VQOA 2IHFA 1VCIA 5GROA 4DV1Q 4A3IH 1HNWL 1R9TH 1U0LA 1VQEA 2YTXA 1G51A 3I56A 4LNQA 5IYBH 3PO3H 1X56A 4QL5A 4A3LH 2VQEQ 2XGTA 1VQ6A 3EBEA 1Q46A 1MIUA 1NMFA 2LXKA 4JI1L 2HHHQ 1Q7YC 2ES2A 3W5OA 2HIXA 1NBWA 3RLOA 4DUZQ 4LF8L 1KXLA 1X3FA 3B6YA 1GM5A 4DK3C 4LFAL 4A4IA 1I94Q 3I7FA 3RR5A 2CWPA 2WP8J 3S14H 2KCTA 4POFA 1YHQA 1CKMA 3M7NA 4A3JH 1KL9A 1OXTA 1E22A 2WFWA 3I2ZA 1KRTA 2UU9L 4LFBQ 3KLWA 3FP9A 1I5FA 1VQCA 4A3CH 2D62A 5JJLA 3H0GG 3K7AH 3T1YQ 3PV0A 4DR6Q 2D0OA 5C44G 2CQOA 2R7ZG 2F4VL 3HOWH 4B3ML 3TS0A 2UXCQ 1JJGA 3UDFA 5C0XJ 3S17H 2L15A 1I94L 4DR3L 4P73A 3M4OH 3LGJA 3G4SA 2PI2A 1AE2A 5IP7G 1Q82C 2N78A 2VL6A 1Y1VG 3FKIH 4IPCA 2CFMA 5JEAJ 5IYDG 3CC7A 4DV5L 2UU9Q 5E7NA 1TWHH 4UY8C 3GTQH 3TS2A 4LFBL 1I6HH 3ICEA 1EQQA 2V1CC 4J15A 1K83H 2WAQG 4A3KH 4IPHA 3RN5A 2A8VA 4GOPC 1CSPA 4HJAA 4BBSH 1YNXA 5FLMH 4LFCQ 1JJCB 1XNRL 3CCQA 4YY3L 2NN6G 3PUWA 4P72A 1CUKA 3F2CA 2ZJQA 4A3IG 4HIDA 1VQLA 1OXUA 1Q1EA 5GADC 2UUCQ 4X6AH 1KC8C 1TWFH 4JI4L 3HOZH 2JK8A 4UP9A 3ULPA 1K3RA 4GLXA 2Y0SE 1S40A 1EOVA 1PA6A 4A3BG 2UXDQ 4RG1A 1KD1C 1V9PA 4XTCS 4LFCL 2ATWA 5C0XG 1AH9A 4QY7A 2HT1A 4KHZA 2R92G 3KF6A 3G48A 3NENA 4IJLA 5C3EH 5J3BA 3RZOH 2EQSA 1XMOQ 3HOVH 1Y14B 4IJHA 4JI5L 2YTYA 2VW9A 3DLLA 1UE7A 5LMNQ 1EYGA 4NXML 4A93H 2ASBA 3HKSA 1KRSA 3ER0A 1L2FA 3T1HQ 2N8NA 4LUVA 3RLNA 4X64Q 2OTJA 4YHHQ 2IX0A 2OTLA 2EIFA 4A76A 2UXDL 2H5XA 3VDYA 1JB7A 1N33Q 4KHPQ 3CCJA 3S2HH 2Q2UA 4AH6A 3S1QH 1BBUA 3CW2C 2K14A 4L5QA 3CCMA 3IRBA 1XMOL 1K8AC 2HQLA 2HIVA 1YBYA 5M5YH 1TWGH 4YWLA 2B3GA 1HZAA 4LF9Q 1SROA 4X65L 2A1AA 2PQAB 1X55A 1UE5A 2UUBQ 4JI0L 4BY7H 1E7ZA 4DR7Q 1YEZA 1TWCH 1Y1VH 3FKIG 4PZ8A 4GOPA 1EIYB 2JA6H 5IWAQ 1YITA 3STBD 4OONA 4BBSG 2UUAL 4JI3Q 1K73C 1G291 4O2DA 2E2JH 5IYCH 1DGSA 2OQKA 1EFWA 3RNUA 1N36L 3HOXG 2ZM6L 4WJ4A 4GKJL 5H1SE 1TXYA 1YHAA 4AIMA 5IT9c 4DV1L 1SFOH 1QZHA 1FGUA 2PNHA 4HJ8A 1JMCA 3CCEA 5LMNW 3BU2A 2BA0A 1YJ9A 3CMEA 2OCEA 2ZJPA 4HJ9A 3H3VI 1C0AA 1UWVA 1XTDA 4QIWE 3AEVA 3A74A 3L2PA 3PIPA 4LF4Q 3KF8B 4JI1Q 2HHHL 2RHQB 1SMXA 3J81i 3G6EA 1Y1WG 1FJGQ 4DUZL 4LF8Q 1WYDA 3I4MH 1PHJA 3S2DH 5LMUQ 3J81j 2ZM6Q 2DUDA 4GS3A 4DNIA 3J7ZC 3GTOH 4GKJQ 3K8AA 2N3SA 3UDXA 3JAMc 4A3JG 2QGQA 1JT8A 1GD7A 1L0WA 3PUYA 4H02A 4PMWA 4R4OA 3TEHB 1QZGA 2IT1A 4C3IH 4DR1Q 4JBKA 4LF4L 1VQFA 3J81c 4B3TL 1VQAA 4IFDI 4GN3B 2YTVA 3S24A 1XPRA 4B3RQ 4X62L 1Z9FA 1MJCA 5LMUL 4ALPA 4JBWA 1WJJA 2F4VQ 2UXCL 1VQJA 1N34Q 3CD6A 3M9BA 3GTKH 3KDFB 3PF5A 1FL0A 2GN5A 1OTCA 2JA8G 4JI6L 3KF6B 2R93H 4DV5Q 2JQOA 1SR3A 1XPUA 3PSIA 1GVPA 5JEAG 4DR1L 1D7QA 1I3QH 2WAQE 1PH6A 1PH5A 1A0IA 1NY4A 2K5NA 4C3HH 1PH1A 1WCMH 5GAGC 2R7DA 1PVOA 1AE3A 3U4VA 4X62Q 1PV4A 3UE0A 3EN2A 4Y7NH 3KJOA 1D8LA 2AWOA 1CKNB 3CMAA 1N9WA 2VUMG 3HFZB 4YY3Q 5AJ3Q 5IP9G 1HNZL 4ME3A 4LF6L 1V43A 4GKKQ 1YI2A 2KHJA 1W3SA 3L0OA 1PH3A 2UUCL 2KENA 4JI4Q 2K50A 1PYSB 5IE8A 2QA4A 4YWKA 5C3EG 1PFSA 1XJVA 1X3GA 1A8VA 1I50H 1C9OA 2NVYH 2K75A 4B3SQ 4GN4B 4P74A 4OO1G 4A3MH 1QUQB 4GNXC 1M1KC 4X66L 3HOVG 1XNQL 4R4TA 5AJ3L 5GAHC 2E8GA 3GTMH 2GVBA 1SE8A 3F8TA 4RMFA 4GLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  4GKK L;  4WJ3 M;  3HOU H;  1CSQ A;  1Q1B A;  2MO0 A;  3TQY A;  5LMN L;  4JI5 Q;  3PF4 A;  1S72 A;  1EWI A;  1QVG A;  3T1H L;  2KBN A;  3CCS A;  2K5H A;  3DM3 A;  4YHH L;  4PG3 A;  5GQO A;  3SGI A;  3UDG A;  2EXD A;  4B3S L;  3PO3 G;  1EQR A;  3CC4 A;  1N33 L;  3GTG H;  4GLV B;  5ELO A;  4PZ7 A;  4KHP L;  4X66 Q;  1BBW A;  3M85 A;  4IO9 A;  4LWC A;  1HR0 L;  1XNQ Q;  3K81 C;  5M5X H;  2LXJ A;  2YV5 A;  4QQB X;  3BZK A;  3FHW A;  3NEL A;  1W2B A;  3W1G A;  1B7Y B;  2NZH A;  3OYY A;  2JA7 G;  4UPA A;  2IHE A;  4IPG A;  4X65 Q;  3J80 c;  2AKW B;  1YZ6 A;  1VQB A;  3NEM A;  1VQ9 A;  2E2H H;  1PYB A;  4LUO A;  4DV0 L;  1S3O A;  2AMC B;  4JI0 Q;  4DR7 L;  1E3P A;  4OX9 Q;  3ZJY C;  4YCW A;  1WCM G;  5IWA L;  4DKA C;  2MO1 A;  1HR0 Q;  4EQ5 A;  4BXX H;  2UUA Q;  4OXP A;  3M4P A;  2FXQ A;  3J7A 5;  1IXR A;  3ERS X;  4A3B H;  3G71 A;  4IFD J;  1CKN A;  1HJP A;  2Q2H A;  3MEF A;  4IPD A;  1N36 Q;  3AFQ A;  3K80 C;  3CC2 A;  5EAY A;  1B70 B;  2VY3 A;  2XTI A;  1M90 C;  3JC6 6;  3CCR A;  1X3E A;  1Q81 C;  1X9N A;  1C7Y A;  2WB1 E;  1UEB A;  4L5T A;  4BY1 G;  4JI8 Q;  3K0X A;  3JAM i;  4OX9 L;  5BR8 Q;  3CCU A;  2IY5 B;  5ELN A;  1KIX A;  1IBM Q;  1HNX L;  3HOY H;  3K7U C;  4LW1 A;  4GNX A;  4JYA Q;  5IY0 A;  1VS0 A;  3U58 A;  4TVA B;  2ZJR A;  3AQQ A;  4OWW B;  1FJG L;  2ID0 A;  4JC0 A;  1N32 L;  4DV3 L;  3I4O A;  3HOY G;  1HZB A;  1VQ8 A;  3F2D A;  1PH4 A;  1XNR Q;  2NVT H;  1EUJ A;  5IP7 H;  3OTO Q;  1IBK L;  4APV A;  2NVX H;  3S1R H;  5IYD H;  2JA9 A;  4NXN L;  2VS1 A;  1VQ4 A;  2ZTD A;  4A3D H;  5BR8 L;  2JEB I;  4LF7 Q;  1NE3 A;  1ASZ A;  1IBM L;  1HNX Q;  4XIG S;  4JYA L;  4PZ6 A;  5C44 H;  1YIJ A;  2F52 A;  3L7Z C;  3CF5 A;  4HIM A;  4JCV E;  4YWM A;  4B3T Q;  1WFQ A;  3S1N H;  1P8L A;  4R4Q A;  4B3R L;  4JOI C;  1HH2 P;  2VQF Q;  4DV3 Q;  2BA1 A;  2R6G A;  4QGU A;  1E1T A;  3RN2 A;  1YJW A;  3MXN B;  4HJ7 A;  2CCZ A;  1L1O C;  1E24 A;  2I5M X;  4EX5 A;  3OTO L;  4FDB A;  1N34 L;  1IBK Q;  2R93 G;  3HOX H;  4Y52 H;  1A62 A;  4BA2 I;  1FVI A;  2Y0S G;  4DPG A;  4JI6 Q;  1OXX K;  3UDI A;  4AQY Q;  1JJ2 A;  5HY6 A;  2OWO A;  3WWV A;  4IFD G;  4OO1 I;  4JOI A;  2VUM H;  4P71 A;  3H3V H;  4KI0 A;  4JI2 Q;  5FLM G;  4DV2 Q;  1EIF A;  2JEA I;  4C2M H;  4POG A;  2VQF L;  4BBR H;  1U5K A;  1VQH A;  3S15 H;  3TRZ A;  2PMZ E;  4YCV A;  3PCO B;  2B63 H;  1VQI A;  2I5L X;  2YYZ A;  5GAE C;  3CPF A;  5C0X I;  2MNA A;  1HNZ Q;  1K0R A;  4BBR G;  3PUX A;  3A5U A;  3I55 A;  4AQY L;  1Q86 C;  4LF6 Q;  3NBH B;  3I4M G;  1YVC A;  4BA1 I;  3CCV A;  4JI2 L;  1V1Q A;  4TQU S;  2F3I A;  5C4J H;  3A0J A;  1VQD A;  1NTG A;  1BKB A;  2PQA A;  2RCN A;  1WI5 A;  3STB C;  2K4K A;  1RIP A;  2WB1 G;  3GD7 A;  5M5W H;  3E9H A;  1QVF A;  4A3C G;  1GO3 E;  2KCM A;  2NN6 I;  1CKO A;  2Q2I A;  3A5Z B;  1H95 A;  1N8R C;  3ULL A;  2E5L L;  1T9H A;  2R7Z H;  1X65 A;  4AYB G;  1P16 A;  1HZ9 A;  2RF4 A;  4A3G G;  4OWT B;  1J5E Q;  3PGZ A;  4OWX B;  4DV7 L;  3Q8D A;  1B8A A;  4A3D G;  2JA8 H;  1NJI C;  4JV5 Q;  3KJP A;  1VQM A;  3TRE A;  2QEX A;  2JJQ A;  5JJI A;  4LUZ A;  1K8G A;  5HGQ A;  1KHI A;  2UXB L;  1IBL L;  5DLQ E;  2JE6 I;  4JG2 A;  4QJF A;  3M4Q A;  3ULJ A;  2E5L Q;  2JA7 H;  4DR4 Q;  4A3L G;  1QUQ A;  4GN5 A;  5IYB G;  4JBM A;  3U4Z A;  3E9I A;  4NB3 A;  2N49 A;  3GTJ H;  2ZTC A;  2NVQ H;  4BXX G;  3CP0 A;  4AYB E;  1Z47 A;  2K5V A;  2C35 B;  1RL2 A;  5M3F G;  4DV7 Q;  5IP9 H;  2DGY A;  5FJ8 H;  4DV0 Q;  4JV5 L;  4LFA Q;  4DAM A;  5IYC G;  1LM0 A;  2LSS A;  2KHI A;  4DR5 Q;  2B63 G;  4K0K L;  4IOA A;  4GNX B;  5JJK A;  1IBL Q;  1X6O A;  3U50 C;  4DR4 L;  1SLJ A;  1YHB A;  4GOP B;  4A3E H;  1MJE A;  3CAM A;  4BY1 H;  1Y1W H;  3GO5 A;  2R92 H;  3E0E A;  1VQ5 A;  2K52 A;  1PH7 A;  2VNU D;  3KFU A;  4JI8 L;  3T1Y L;  3S16 H;  4DR6 L;  1QVC A;  1IZ6 A;  1BVS A;  1G6P A;  4LF5 L;  3HKZ E;  1PH8 A;  4B3M Q;  3GDE A;  3H0G H;  1VQK A;  3PO2 G;  3I4N G;  2NZO A;  4DR5 L;  1IL2 A;  5K36 G;  4K0K Q;  4DR3 Q;  4L5S A;  2I5H A;  1Q8K A;  4DV4 Q;  2Z0S A;  4DV6 Q;  3KDF A;  1X54 A;  4HIO A;  4P75 A;  1L1O A;  3RZD H;  1N32 Q;  1VQP A;  1JE5 A;  1HZC A;  4A3F H;  4UP7 A;  1XMQ L;  1NMG A;  2Z6K C;  4HJ5 A;  3GTL H;  4MTN A;  4A75 A;  1SN8 A;  4NPS A;  4NXN Q;  4DK6 C;  1VQG A;  4DAY B;  1WOC A;  4LF5 Q;  2IX1 A;  4LF7 L;  5FLX c;  2UXB Q;  1SRU A;  1TWA H;  4A3G H;  1E1O A;  3CQZ H;  4O0A A;  1LUZ A;  3BJU A;  3EIV A;  4DV4 L;  4DV6 L;  1UE6 A;  4A3K G;  1Q12 A;  3CCL A;  1OXS C;  2AWN A;  4YCU A;  4DR2 L;  1ASY A;  3D31 A;  3RLF A;  5C4X G;  3AYH B;  3KOJ A;  2AHO B;  1VQN A;  4JBJ A;  4DUY L;  2YU9 H;  4JI7 L;  2JA6 G;  1XMQ Q;  2CKZ B;  3D0F A;  2MQH A;  3HOZ G;  5C4X H;  1L1O B;  1K9M C;  2MFI A;  4MNO A;  2OQ0 A;  3PUV A;  2JA5 G;  2PI2 E;  4R1J A;  2BH8 A;  2I0Q A;  1IYJ B;  3F2B A;  4DV2 L;  5M3F H;  2B29 A;  1GKH A;  3UE1 A;  1KQS A;  4A3M G;  5FJ8 G;  2Q2T A;  2ZTE A;  4DR2 Q;  1LYL A;  4KLK A;  4NXM Q;  2CWA A;  2D0P A;  4DUY Q;  4JI7 Q;  1LTL A;  2R7F A;  1XPO A;  4X64 L;  2A19 A;  3HOU G;  4R4I A;  3M3Y H;  4IOC A;  4A3E G;  1HR0 W;  1MKH A;  4A93 G;  3CXC A;  3KYH C;  1O7I A;  4MZ9 A;  1OXV A;  1KAW A;  3H15 A;  1YJN A;  2ALY B;  3PO2 H;  3PUZ A;  3HOW G;  3I4N H;  1A63 A;  2RHS B;  2BH2 A;  5M3M H;  4LF9 L;  2VZA A;  3HKZ G;  1UE1 A;  1PH2 A;  3CPW A;  1HNW Q;  4C3J H;  2Z6K A;  3OW2 A;  2UUB L;  3F1Z A;  3J80 i;  1VQ7 A;  2VQE L;  1PH9 A;  2JA5 H;  3PIO A;  5M3M G;  4BY7 G;  4UP8 A;  3BZC A;  4HIK A;  4A3F G;  2E2I H;  4R4C A;  4JI3 L;  1J5E L;  3GTP H;  4L5R C;  3S1M H;  2GVA A;  3AFP A;  3W1B A;  1VQO A;  2IHF A;  1VCI A;  5GRO A;  4DV1 Q;  4A3I H;  1HNW L;  1R9T H;  1U0L A;  1VQE A;  2YTX A;  1G51 A;  3I56 A;  4LNQ A;  5IYB H;  3PO3 H;  1X56 A;  4QL5 A;  4A3L H;  2VQE Q;  2XGT A;  1VQ6 A;  3EBE A;  1Q46 A;  1MIU A;  1NMF A;  2LXK A;  4JI1 L;  2HHH Q;  1Q7Y C;  2ES2 A;  3W5O A;  2HIX A;  1NBW A;  3RLO A;  4DUZ Q;  4LF8 L;  1KXL A;  1X3F A;  3B6Y A;  1GM5 A;  4DK3 C;  4LFA L;  4A4I A;  1I94 Q;  3I7F A;  3RR5 A;  2CWP A;  2WP8 J;  3S14 H;  2KCT A;  4POF A;  1YHQ A;  1CKM A;  3M7N A;  4A3J H;  1KL9 A;  1OXT A;  1E22 A;  2WFW A;  3I2Z A;  1KRT A;  2UU9 L;  4LFB Q;  3KLW A;  3FP9 A;  1I5F A;  1VQC A;  4A3C H;  2D62 A;  5JJL A;  3H0G G;  3K7A H;  3T1Y Q;  3PV0 A;  4DR6 Q;  2D0O A;  5C44 G;  2CQO A;  2R7Z G;  2F4V L;  3HOW H;  4B3M L;  3TS0 A;  2UXC Q;  1JJG A;  3UDF A;  5C0X J;  3S17 H;  2L15 A;  1I94 L;  4DR3 L;  4P73 A;  3M4O H;  3LGJ A;  3G4S A;  2PI2 A;  1AE2 A;  5IP7 G;  1Q82 C;  2N78 A;  2VL6 A;  1Y1V G;  3FKI H;  4IPC A;  2CFM A;  5JEA J;  5IYD G;  3CC7 A;  4DV5 L;  2UU9 Q;  5E7N A;  1TWH H;  4UY8 C;  3GTQ H;  3TS2 A;  4LFB L;  1I6H H;  3ICE A;  1EQQ A;  2V1C C;  4J15 A;  1K83 H;  2WAQ G;  4A3K H;  4IPH A;  3RN5 A;  2A8V A;  4GOP C;  1CSP A;  4HJA A;  4BBS H;  1YNX A;  5FLM H;  4LFC Q;  1JJC B;  1XNR L;  3CCQ A;  4YY3 L;  2NN6 G;  3PUW A;  4P72 A;  1CUK A;  3F2C A;  2ZJQ A;  4A3I G;  4HID A;  1VQL A;  1OXU A;  1Q1E A;  5GAD C;  2UUC Q;  4X6A H;  1KC8 C;  1TWF H;  4JI4 L;  3HOZ H;  2JK8 A;  4UP9 A;  3ULP A;  1K3R A;  4GLX A;  2Y0S E;  1S40 A;  1EOV A;  1PA6 A;  4A3B G;  2UXD Q;  4RG1 A;  1KD1 C;  1V9P A;  4XTC S;  4LFC L;  2ATW A;  5C0X G;  1AH9 A;  4QY7 A;  2HT1 A;  4KHZ A;  2R92 G;  3KF6 A;  3G48 A;  3NEN A;  4IJL A;  5C3E H;  5J3B A;  3RZO H;  2EQS A;  1XMO Q;  3HOV H;  1Y14 B;  4IJH A;  4JI5 L;  2YTY A;  2VW9 A;  3DLL A;  1UE7 A;  5LMN Q;  1EYG A;  4NXM L;  4A93 H;  2ASB A;  3HKS A;  1KRS A;  3ER0 A;  1L2F A;  3T1H Q;  2N8N A;  4LUV A;  3RLN A;  4X64 Q;  2OTJ A;  4YHH Q;  2IX0 A;  2OTL A;  2EIF A;  4A76 A;  2UXD L;  2H5X A;  3VDY A;  1JB7 A;  1N33 Q;  4KHP Q;  3CCJ A;  3S2H H;  2Q2U A;  4AH6 A;  3S1Q H;  1BBU A;  3CW2 C;  2K14 A;  4L5Q A;  3CCM A;  3IRB A;  1XMO L;  1K8A C;  2HQL A;  2HIV A;  1YBY A;  5M5Y H;  1TWG H;  4YWL A;  2B3G A;  1HZA A;  4LF9 Q;  1SRO A;  4X65 L;  2A1A A;  2PQA B;  1X55 A;  1UE5 A;  2UUB Q;  4JI0 L;  4BY7 H;  1E7Z A;  4DR7 Q;  1YEZ A;  1TWC H;  1Y1V H;  3FKI G;  4PZ8 A;  4GOP A;  1EIY B;  2JA6 H;  5IWA Q;  1YIT A;  3STB D;  4OON A;  4BBS G;  2UUA L;  4JI3 Q;  1K73 C;  1G29 1;  4O2D A;  2E2J H;  5IYC H;  1DGS A;  2OQK A;  1EFW A;  3RNU A;  1N36 L;  3HOX G;  2ZM6 L;  4WJ4 A;  4GKJ L;  5H1S E;  1TXY A;  1YHA A;  4AIM A;  5IT9 c;  4DV1 L;  1SFO H;  1QZH A;  1FGU A;  2PNH A;  4HJ8 A;  1JMC A;  3CCE A;  5LMN W;  3BU2 A;  2BA0 A;  1YJ9 A;  3CME A;  2OCE A;  2ZJP A;  4HJ9 A;  3H3V I;  1C0A A;  1UWV A;  1XTD A;  4QIW E;  3AEV A;  3A74 A;  3L2P A;  3PIP A;  4LF4 Q;  3KF8 B;  4JI1 Q;  2HHH L;  2RHQ B;  1SMX A;  3J81 i;  3G6E A;  1Y1W G;  1FJG Q;  4DUZ L;  4LF8 Q;  1WYD A;  3I4M H;  1PHJ A;  3S2D H;  5LMU Q;  3J81 j;  2ZM6 Q;  2DUD A;  4GS3 A;  4DNI A;  3J7Z C;  3GTO H;  4GKJ Q;  3K8A A;  2N3S A;  3UDX A;  3JAM c;  4A3J G;  2QGQ A;  1JT8 A;  1GD7 A;  1L0W A;  3PUY A;  4H02 A;  4PMW A;  4R4O A;  3TEH B;  1QZG A;  2IT1 A;  4C3I H;  4DR1 Q;  4JBK A;  4LF4 L;  1VQF A;  3J81 c;  4B3T L;  1VQA A;  4IFD I;  4GN3 B;  2YTV A;  3S24 A;  1XPR A;  4B3R Q;  4X62 L;  1Z9F A;  1MJC A;  5LMU L;  4ALP A;  4JBW A;  1WJJ A;  2F4V Q;  2UXC L;  1VQJ A;  1N34 Q;  3CD6 A;  3M9B A;  3GTK H;  3KDF B;  3PF5 A;  1FL0 A;  2GN5 A;  1OTC A;  2JA8 G;  4JI6 L;  3KF6 B;  2R93 H;  4DV5 Q;  2JQO A;  1SR3 A;  1XPU A;  3PSI A;  1GVP A;  5JEA G;  4DR1 L;  1D7Q A;  1I3Q H;  2WAQ E;  1PH6 A;  1PH5 A;  1A0I A;  1NY4 A;  2K5N A;  4C3H H;  1PH1 A;  1WCM H;  5GAG C;  2R7D A;  1PVO A;  1AE3 A;  3U4V A;  4X62 Q;  1PV4 A;  3UE0 A;  3EN2 A;  4Y7N H;  3KJO A;  1D8L A;  2AWO A;  1CKN B;  3CMA A;  1N9W A;  2VUM G;  3HFZ B;  4YY3 Q;  5AJ3 Q;  5IP9 G;  1HNZ L;  4ME3 A;  4LF6 L;  1V43 A;  4GKK Q;  1YI2 A;  2KHJ A;  1W3S A;  3L0O A;  1PH3 A;  2UUC L;  2KEN A;  4JI4 Q;  2K50 A;  1PYS B;  5IE8 A;  2QA4 A;  4YWK A;  5C3E G;  1PFS A;  1XJV A;  1X3G A;  1A8V A;  1I50 H;  1C9O A;  2NVY H;  2K75 A;  4B3S Q;  4GN4 B;  4P74 A;  4OO1 G;  4A3M H;  1QUQ B;  4GNX C;  1M1K C;  4X66 L;  3HOV G;  1XNQ L;  4R4T A;  5AJ3 L;  5GAH C;  2E8G A;  3GTM H;  2GVB A;  1SE8 A;  3F8T A;  4RMF A;  4GLA C; 
#chains in the Genus database with same CATH topology
 3HOU H;  2MO0 A;  4F8M A;  1JQY D;  5EKL A;  2B8F A;  3T1H L;  1RJT A;  5I9P A;  5GQO A;  3K58 A;  2Q8T A;  3HZX A;  1EQR A;  2PYK A;  5ELO A;  1HR0 L;  1LT6 D;  4XYQ A;  1KNE A;  1EY5 A;  2ZXO A;  3NEL A;  1W2B A;  3W1G A;  2NB0 A;  4IPG A;  3J80 c;  1YZ6 A;  1VQB A;  4ULL A;  4PMB A;  1K0S A;  4A3M B;  4DV0 L;  4JI0 Q;  3NK9 A;  1E3P A;  3CHB D;  3ZJY C;  3S2D B;  3I72 A;  4U67 3;  2EDG A;  1CA5 A;  5FOB B;  4EQ5 A;  2UUA Q;  2Z4H A;  1EZ6 A;  3ERS X;  1PTO B;  3MEF A;  3CC2 A;  2L5T A;  1ZKO A;  3K0X A;  4QIW B;  2NWG A;  3VR5 A;  4RHR A;  1VS0 A;  3U58 A;  4OWW B;  4M8A A;  2ZJR A;  3A7L A;  4RA8 A;  2F4I A;  5IP7 H;  3OTO Q;  1IBK L;  2AUK A;  3MXG A;  2A74 C;  1VQ4 A;  2EVB A;  3QR8 A;  1LLR D;  1U9R A;  1I4R A;  1GUW A;  1CA6 A;  4YWM A;  3ONA B;  3OHX C;  3TP7 A;  1EWC A;  2BCO A;  3VYR A;  4JOI C;  1HH2 P;  2VQF Q;  3RN2 A;  1YJW A;  3MXN B;  1PFB A;  2I5M X;  3OTO L;  4EX5 A;  3HOX H;  2Y0S G;  5J22 A;  4K6L A;  4JI6 Q;  3UDI A;  5HY6 A;  1VDZ A;  3I91 A;  3H3V H;  2RA4 A;  2OT2 A;  5FLM G;  5JPN C;  4POG A;  1RKN A;  3S15 H;  1U5K A;  2MGS A;  1HXY D;  1BBX C;  4RH6 A;  1CQV A;  1MBY A;  1BCP F;  2PMZ E;  5IGF A;  3TRZ A;  1R4P B;  4YCV A;  2B63 H;  2IW3 A;  5GAE C;  3CPF A;  5C0X I;  2MNA A;  1K0R A;  4LF6 Q;  3HOX B;  4EGV A;  1WTR A;  3OSO A;  5BN4 A;  3STB C;  3TN2 A;  2K5D A;  3SK4 A;  1BQQ T;  3KLS X;  5BN5 A;  2KCM A;  2RBM A;  1H95 A;  2V4D A;  1JOQ A;  2EJG C;  1OO9 B;  1VF5 C;  3T13 A;  5EBC A;  5M3F B;  1HZ9 A;  2RF4 A;  1G2S A;  3Q8D A;  2F0U A;  4A3D G;  4O1N A;  2JA8 H;  2MUY A;  4CBV A;  1VQM A;  2QEX A;  2JJQ A;  4LUZ A;  1K8G A;  1KHI A;  2UXB L;  2E75 C;  5LL6 S;  2I07 B;  1IBL L;  3D3R A;  4JG2 A;  3ULJ A;  1CZW A;  5D3D A;  1ROD A;  2N49 A;  3GTJ H;  4A3G B;  3CP0 A;  1QIL A;  3NUC A;  2K5V A;  5M3F G;  2F0W A;  4LFA Q;  4DAM A;  3W2D A;  1PTO C;  1JOO A;  2EE1 A;  3ND9 A;  5JJK A;  1X6O A;  4ZKC B;  1SLJ A;  3FEW X;  4KN7 C;  4A3E H;  1MJE A;  2QIL A;  3R3O A;  3D6W A;  4DR6 L;  1QVC A;  1IZ6 A;  2F0V A;  3HKZ E;  1JWU D;  3H0G H;  1AW7 A;  3PO2 G;  4DR5 L;  5K36 G;  4K0K Q;  3J81 E;  4DR3 Q;  4X3U A;  1Q8K A;  4DV6 Q;  1UAP A;  1O78 A;  1G8Z D;  1L1O A;  4NW2 A;  4P75 A;  1N32 Q;  5HGT A;  1IW7 C;  1C48 A;  3N6R A;  4MTN A;  3AMU A;  3U9O A;  2F0J A;  1VQG A;  5NUC A;  1CM9 A;  4DK6 C;  2K5Q A;  3HKZ B;  2IX1 A;  1DOL A;  4LF7 L;  3DHQ A;  3CQZ H;  4DV6 L;  1UE6 A;  2NVY B;  3S9W A;  2AWN A;  4YCU A;  3D31 A;  1CFM A;  4IUQ A;  3KOJ A;  4KJO A;  4JI7 L;  2J7Z A;  1Y8P B;  1BNZ A;  3GV6 A;  3D0F A;  2MQH A;  5JAV A;  1L1O B;  2B2T C;  2OQ0 A;  4C3J B;  5K5P A;  2I0Q A;  2RCF A;  3TP8 A;  4NDX A;  1IYJ B;  4DV2 L;  2EY5 A;  1KQS A;  1LYL A;  4KLK A;  2K6A A;  2CWA A;  4DFA A;  4IZ8 A;  4JI7 Q;  5D14 A;  2QF7 A;  1ESR A;  4A3I B;  3KLR A;  1MKH A;  3KYH C;  1RF2 D;  1NAP A;  1OXV A;  4QUF A;  5D3I B;  3H15 A;  2ALY B;  3I4N H;  4C3J G;  1A63 A;  4K14 A;  3V96 A;  2RHS B;  2L55 A;  2LMC B;  3MZ5 A;  2PPB C;  3ITP A;  1PTO D;  1UE1 A;  1ZYR D;  5C44 B;  1HNW Q;  1TS3 A;  2X6L A;  1LTS D;  3NTH A;  1ICW A;  4K8I A;  4RAU C;  2F3V A;  4JI3 L;  3GTP H;  1BCP B;  4K2K A;  1J5E L;  3GTM B;  2KEC A;  3P75 A;  2NN6 H;  5GRO A;  4DV1 Q;  1DOM A;  1HNW L;  4LNQ A;  3J80 L;  3PO3 H;  3NBH A;  1SE4 A;  1L0Y B;  3WOF A;  2B2V A;  3EBE A;  1MIU A;  3BDO A;  4FXG C;  1CTM A;  2ES2 A;  1KXL A;  3RZD B;  1G6Z A;  1X3F A;  2K03 A;  3B6Y A;  4HMI A;  3V05 A;  1SSO A;  4FF4 A;  2WP8 J;  4XDX A;  4POF A;  4H7B A;  3T51 B;  5IGB A;  3RUZ A;  4KKT A;  1KRT A;  4CGY B;  2QDL A;  4OL7 A;  4HMJ A;  2D62 A;  5M5Y B;  5I6W A;  5EPK A;  3FPP A;  2R7Z G;  3HOW H;  2UXC Q;  2KCN A;  3TBI B;  4F7X A;  3G4S A;  2PI2 A;  1TWF B;  1AE2 A;  3BS1 A;  1U4L A;  1K8O A;  3FKI H;  2CFM A;  3OW7 A;  3TS2 A;  5E7N A;  2XNA C;  1CHP D;  1SYC A;  3H0G B;  2A8V A;  4GOP C;  4C3H G;  4HJA A;  2F1M A;  1V8Q A;  4YY3 L;  3Q6S A;  2CW0 C;  2KEE A;  3SE0 A;  4HID A;  1VQL A;  1Q1E A;  1TWF H;  4DAV A;  4GLX A;  2P5Z X;  1S40 A;  3PIP 3;  2GA4 B;  1KD1 C;  1KTK A;  1H9J A;  4B08 A;  4HCE A;  4QY7 A;  2HT1 A;  4C3H B;  3NEN A;  3BVG A;  5C3E H;  1IYU A;  3MTS A;  3MXU A;  1EYG A;  2A68 D;  4JI5 L;  2YTY A;  1UE7 A;  4A93 H;  1Y1W B;  1STA A;  3RLN A;  2OTJ A;  4YHH Q;  2EYL A;  2H5X A;  3VYU A;  4KHP Q;  3NTI A;  1PZK D;  3DEP A;  2K14 A;  2X6G A;  1LV9 A;  3W3A A;  1B2T A;  2ZXR A;  1TWG H;  4LF9 Q;  2A1A A;  2RDH A;  2EY1 A;  4DR7 Q;  1E7Z A;  4GOP A;  1C4Q A;  1QE6 A;  5CV9 A;  4FVM A;  1DGS A;  4Z9C B;  1EFW A;  1JC7 A;  1H9R A;  1S4Z A;  3HOX G;  4WJ4 A;  4GKJ L;  1FD7 D;  3PO3 G;  4MN3 A;  5IT9 c;  1QZH A;  2JA5 H;  2PNH A;  4HJ8 A;  1LT5 D;  2OCE A;  4ILW A;  4HJ9 A;  1C0A A;  5FO8 B;  1SYF A;  2XRQ D;  4QIW E;  2WIN B;  3KF8 B;  3L3O C;  2SDF A;  3G6E A;  3J81 i;  4NMZ A;  4DUZ L;  4LF8 Q;  1WYD A;  2EY6 A;  1U4P A;  2DUD A;  4GS3 A;  4DNI A;  3J7Z C;  4GKJ Q;  3DEO A;  2Z8L A;  3K8A A;  2N3S A;  3JAM c;  1JT8 A;  1A2T A;  4PMW A;  4G7H C;  4B3T L;  1V1P B;  2CVR A;  3S24 A;  1XPR A;  3NWS A;  1Z9F A;  4G4K A;  3URY A;  3RD4 A;  1F2M A;  3OIQ A;  2KED A;  4KJN A;  1N34 Q;  2A69 C;  3M9B A;  3S2H B;  2YU9 B;  3DWQ A;  3KDF B;  1OTC A;  2JA8 G;  3HOU B;  1EL0 A;  1DYQ A;  1PH6 A;  2K5N A;  2R92 B;  1XTC D;  2L4N A;  4C3H H;  4K5W A;  2HCC A;  2R7D A;  5DAU A;  5CV4 A;  3SXH A;  3EN2 A;  1LTB D;  4Y7N H;  1D8L A;  3CMA A;  2PQE A;  3GTG B;  1HUN A;  1V43 A;  5C3W A;  3DUZ A;  1PH3 A;  2UUC L;  1Q8I A;  5C0X H;  3DM1 A;  2QA4 A;  1NNX A;  4ZUI A;  1X3G A;  1C9O A;  2K75 A;  4B3S Q;  1XXG A;  4P74 A;  4A3M H;  1BXT A;  4ZUJ A;  1XNQ L;  5DEH A;  5AJ3 L;  5GAH C;  3K5M A;  4ZKB B;  1TWC B;  3F8T A;  3LGJ A;  2PNR C;  3QG1 A;  1Q1B A;  2E2D C;  1TY2 A;  2NUC A;  4IQZ A;  5LMN L;  1S72 A;  1QVG A;  3J80 E;  1BOS A;  3EQL C;  3DM3 A;  4PG3 A;  2SOB A;  2MPM A;  3UDG A;  2EXD A;  3CC4 A;  4GLV B;  4CDE C;  4IO9 A;  1W6K A;  3M85 A;  3KBG A;  3I4N B;  2K7V A;  2HCI A;  5M5X H;  2YV5 A;  1TQO A;  3FRP B;  4LJZ C;  1B7Y B;  2NZH A;  3OYY A;  2HDL A;  3BDC A;  1NCV A;  3NEM A;  2AMC B;  5I9O A;  5IWA L;  1HR0 Q;  4OXP A;  3M4P A;  2FXQ A;  3EFX D;  3DWA A;  4A3B H;  4WRD A;  4DAY A;  1CKN A;  2B63 G;  4IOA A;  3K80 C;  1EY0 A;  5EAY A;  2VY3 A;  2XTI A;  4WFN 3;  1Q81 C;  1B9N A;  4WOR A;  1X9N A;  1C7Y A;  3QOL A;  2EYM A;  5DM6 3;  2IY5 B;  2F0M A;  3K7A B;  1WCM B;  1HNX L;  1I4G A;  1CZG A;  2E2J B;  3H3V C;  3K57 A;  1FJG L;  2R93 B;  4DV3 L;  1F9S A;  1Y8O B;  2NVT H;  2B63 B;  2HDM A;  3JAM L;  2WAC A;  3OPO A;  3R8B A;  1F2Z A;  4ZQ3 A;  2JEB I;  4K8J A;  4PZ6 A;  5C44 H;  3L7Z C;  4HIM A;  5M5W B;  1WFQ A;  4RHS A;  4B3R L;  4EQO A;  5JEA H;  4HJ7 A;  1L1O C;  1E24 A;  1SEB D;  1IBK Q;  2R93 G;  3PIO 3;  4Y52 H;  1A62 A;  1YNN C;  1FVI A;  1QJO A;  2EJM A;  2K28 A;  3SVM A;  4OO1 I;  3WWV A;  4IFD G;  4JOI A;  4DA2 A;  4P71 A;  4KI0 A;  4JI2 Q;  4QUC A;  1EIF A;  2NTT A;  4ZCK A;  3A54 A;  2VQF L;  1STH A;  4DK1 A;  3L9A X;  1O7Z A;  1VQI A;  2I5L X;  4ZYS A;  3A5U A;  3I55 A;  5C4X B;  1HQR D;  4N8X 1;  1IHZ A;  4BA1 I;  4JI2 L;  2K5W A;  4YIJ A;  4CDD C;  1BKB A;  4P2C B;  2RCN A;  3OWF A;  1RIP A;  1EFI D;  1ENC A;  3E9H A;  1KDA A;  2KJX A;  2MJ8 A;  3A5Z B;  3ULL A;  1F2Y A;  1SXT A;  2R7Z H;  1X65 A;  4FF2 A;  2A69 D;  2EYF A;  4A3G G;  4XT3 B;  5D65 A;  1MGS A;  5JPM C;  4DV7 L;  1GUO A;  4K5V A;  1MSG A;  5E3F A;  5E4X A;  5HGQ A;  2Z4I A;  1J8I A;  1QUQ A;  5IYB G;  4JBM A;  4PV1 C;  3E9I A;  2AUJ D;  1TWA B;  2ZTC A;  2NVQ H;  4BXX G;  4AYB E;  4DV7 Q;  2C35 B;  1RL2 A;  1EY4 A;  4KV6 A;  2DGY A;  4ABN A;  5IP9 H;  1WTW A;  4K5X A;  3K5L A;  5IYC G;  1TKW B;  5LL6 X;  1IBL Q;  2F0D A;  1JIC A;  5JOB A;  1L0X B;  5JJZ A;  2R92 H;  3E0E A;  2B2V C;  2K52 A;  1PH7 A;  1BVS A;  1KDB A;  5CGK A;  2F0T A;  4B3M Q;  3GDE A;  2D2C C;  1VQK A;  3I4N G;  2NZO A;  1IL2 A;  4HCS A;  5COY A;  2I5H A;  2Z0S A;  1PRT C;  2B2W C;  4HIO A;  2WV6 D;  3RZD H;  5IT9 E;  1DJR D;  4A3F H;  2Z6K C;  1JR0 D;  3ZYY X;  2Q8I B;  4C3I B;  4NXN Q;  1DXM A;  2PZT A;  3PO3 B;  3KUP A;  4LMQ D;  1LUZ A;  3CCL A;  5JJI A;  3TP5 A;  1OXS C;  3IAY A;  4N8F A;  1B50 A;  2AHO B;  4DUY L;  5CV7 A;  3NHH A;  2EYP A;  2IWH A;  1KDC A;  3M4O B;  4C2M B;  2PI2 E;  2BH8 A;  3V2T A;  1SMY D;  4ID6 A;  1SBB B;  1F9R A;  3PQI A;  2M2L A;  3NQI A;  4NXM Q;  2PMZ B;  2D0P A;  4DUY Q;  2R7F A;  3J7A V;  3A56 A;  2RDF A;  3H91 A;  5CR3 A;  3HOU G;  3I90 A;  4XQJ A;  3CU7 A;  5CV6 A;  4KTA A;  4A3E G;  1HR0 W;  2C9O A;  1O7I A;  4XYO A;  1JB3 A;  2F3W A;  4KMU C;  4EQP A;  2JA8 B;  4NKL A;  3WDN A;  3ND8 A;  2JXM B;  1ILQ A;  4C3J H;  2Z6K A;  3I3C A;  3OW2 A;  2UUB L;  3J80 i;  2VQE L;  1PH9 A;  1TVX A;  3DWP A;  1WD1 A;  4BY7 G;  3BZC A;  4R4C A;  3S1M H;  1QNU A;  2GVA A;  1A15 A;  3U9S A;  3W1B A;  2CW0 D;  3A55 A;  1ONL A;  1B3A A;  3C1E A;  5CBE E;  1R9T H;  1VQE A;  2YTX A;  3R2T A;  1G51 A;  3I56 A;  2VQE Q;  2ICI A;  4KY7 A;  1VQ6 A;  1Q46 A;  4HR7 B;  1NMF A;  2HHH Q;  1D1K A;  2B8G A;  2LXK A;  3J7A F;  1HHV A;  2M9V A;  1S5C D;  3W5O A;  1NR2 A;  5EGT A;  3MC0 B;  3MHB A;  2B2Y C;  4PQX A;  4LFA L;  2EPB A;  1QB5 D;  1FNV A;  3I7F A;  2XWJ B;  2CWP A;  3S14 H;  4FYD A;  4UAI A;  3I2Z A;  1JE4 A;  5C3X A;  5DNF A;  2UU9 L;  4LFB Q;  3FP9 A;  4A3C H;  5TSS A;  1E2W A;  3H0G G;  4FXD A;  1D5M C;  3T1Y Q;  4DR6 Q;  1HRJ A;  1TII D;  5KNC A;  3K5N A;  3S1N B;  2CQO A;  2F4V L;  2LKV A;  1FR3 A;  3MFG A;  4P73 A;  2CQA A;  2KA7 A;  2C5C A;  4KHV A;  5IP7 G;  1A3V A;  2N78 A;  1Y1V G;  2VL6 A;  1I6H H;  5CMD A;  1EQQ A;  4R8N A;  3C46 A;  1CHQ D;  1JWM D;  4A3K H;  2CHB D;  3RN5 A;  1Y8N B;  1CSP A;  5ELE A;  1ESF A;  3CCQ A;  1GXD C;  4EQN A;  3PUW A;  4ME5 A;  3F2C A;  3FDT A;  4A3I G;  1M8A A;  3GV3 A;  1ILP A;  4KN4 C;  4JI4 L;  1D2B A;  1EEF D;  2Y0S E;  1PA6 A;  3H94 A;  2UXD Q;  4RG1 A;  1FNU A;  2F03 A;  1AH9 A;  4RWS C;  4KHZ A;  1BCP D;  5J3B A;  3RZO H;  1XMO Q;  3M7G A;  1Y14 B;  3S16 B;  5KRU A;  2KCC A;  4V0B A;  4OO1 H;  2ASB A;  3HKS A;  1AZP A;  3T1H Q;  4X64 Q;  4TKO B;  4DN4 M;  1D5X C;  2ZT9 C;  5BN3 A;  3VDY A;  1N33 Q;  1SJH D;  2Q2U A;  1IYV A;  1BBU A;  5IOD A;  1XMO L;  4G7O C;  2HQL A;  4YWL A;  2B3G A;  1HZA A;  4X65 L;  2PQA B;  1UE5 A;  3MXP A;  4CJ0 B;  4JI0 L;  4BY7 H;  4Y7N B;  4OGQ C;  3HS0 C;  4XQQ A;  3TSS A;  1YIT A;  3STB D;  3OMG A;  4OON A;  4BBS G;  2UUA L;  4JI3 Q;  1EU4 A;  2E2J H;  2ICE C;  1YNJ C;  4QMG A;  2OQK A;  3VR2 A;  1HTP A;  2F0L A;  5H1S E;  1SFO H;  1B44 D;  3H3V I;  1YJ9 A;  5A2Q E;  1UWV A;  2QCP X;  3KK7 A;  3AEV A;  3A74 A;  4JI1 Q;  1SJE D;  5EPL A;  3O13 A;  4DK0 A;  5A35 A;  1EU3 A;  1TY0 A;  4IUR A;  4KY6 A;  3J81 j;  3GTO H;  2QW7 A;  3TME A;  3TEH B;  4R4O A;  3GTQ B;  1QG7 A;  2F0O A;  1VQA A;  4IFD I;  4GN3 B;  4KK7 A;  2FHT A;  4X62 L;  2EOT A;  4JBW A;  1WJJ A;  2UXC L;  1VQJ A;  1V1P A;  5G3L D;  1FL0 A;  4DNR B;  3KF6 B;  2JQO A;  4XXE A;  3PSI A;  1I3Q H;  2WAQ E;  1PH5 A;  4IUU A;  1A0I A;  5AFW A;  2K01 A;  3FPU B;  3WOE A;  3QOJ A;  3U4V A;  4CKB A;  2KVM A;  3KJO A;  2AWO A;  2VUM G;  3HFZ B;  4OIJ A;  4YY3 Q;  4A3F B;  4EVO A;  4DXG A;  1TWG B;  5IP9 G;  1HNZ L;  4ME3 A;  1HFN A;  4GKK Q;  1YI2 A;  3L0O A;  3OOC A;  3Q22 A;  1PYS B;  5C3E G;  4BWG B;  1PFS A;  1XJV A;  2NVY H;  1I50 H;  4GN4 B;  1V1O A;  3DMU A;  2A5H A;  1M1K C;  2FFK B;  4X66 L;  3SK8 A;  1Y1V B;  1TT2 A;  1J6Q A;  4GKK L;  5EPJ A;  4WJ3 M;  1I50 B;  4JI5 Q;  3PF4 A;  5ELF A;  1PXU A;  2DY8 A;  2KHS A;  1GUN A;  2KBN A;  3CCS A;  3I8Z A;  2K5H A;  3TZD A;  5G3L F;  2K32 A;  3SGI A;  4B3S L;  5FK9 C;  1WTH A;  2L11 A;  4KHP L;  3NWT A;  1XWE A;  4X66 Q;  2F0I A;  2IL8 A;  4C1N K;  1XNQ Q;  1PTO F;  2LXJ A;  3BZK A;  3FHW A;  2WKD A;  4RGT A;  4UPA A;  2IHE A;  5IGC A;  4A3E B;  2E2H H;  2NTS A;  3MWY W;  1WCM G;  1K83 B;  4DKA C;  2DJF C;  2MO1 A;  3MVV A;  1IKL A;  1TWH B;  4C56 C;  3J7A 5;  1TU2 B;  2Q2H A;  1N36 Q;  3AFQ A;  1SND A;  1B70 B;  1M90 C;  3JC6 6;  1X3E A;  5ISR A;  5EKI A;  4H0L C;  2WB1 E;  4JI8 Q;  4BY1 G;  3JAM i;  4RGN A;  5BR8 Q;  3CCU A;  5ELN A;  4JYA Q;  3K7U C;  3OIP A;  4LW1 A;  4CKC A;  1M4V A;  1UEA B;  1O80 A;  3AQQ A;  4TVA B;  2ID0 A;  1N32 L;  5IGE A;  5COR A;  1HZB A;  1VQ8 A;  3F2D A;  1PH4 A;  1XNR Q;  1PRT B;  1EUJ A;  3D4W A;  4APV A;  3S1R H;  5IYD H;  4KKS A;  2VS1 A;  2ZTD A;  5BR8 L;  1NE3 A;  3QB3 A;  5LHY 1;  1ASZ A;  1HNX Q;  4JYA L;  4A3B B;  3CF5 A;  4RCN A;  3MEH A;  4JCV E;  1F2L A;  2A6H D;  4B3T Q;  1EY7 A;  3S1N H;  2F0F A;  4IUN A;  2IJ0 A;  4DV3 Q;  2PW5 A;  2BA1 A;  1E1T A;  5C5L A;  1MI2 A;  1XNR L;  2XRS D;  1N34 L;  4JK1 C;  4CJ1 B;  1OXX K;  2OWO A;  3S14 B;  1UNS A;  2QEJ C;  3G7L A;  3JAM E;  5ELC A;  4ZRZ A;  4DV2 Q;  1XYI A;  4S3S A;  3GQB A;  2JEA I;  4C2M H;  4XQN A;  1KLG D;  3S1Q B;  3D8G A;  2YYZ A;  2NVQ B;  1AEX A;  3I4M G;  3NBH B;  1HQM C;  4KD4 A;  2HD3 A;  3GTO B;  3D6C A;  2F3I A;  1ET9 A;  5C4J H;  1VQD A;  1NTG A;  5CV5 A;  1JOR A;  1WI5 A;  1PFM A;  2H4O A;  3AU7 A;  4X3T A;  4ZK9 B;  1D5Z C;  1QVF A;  1GO3 E;  2RSN A;  3A8I E;  1STB A;  1GOZ A;  2NN6 I;  1PZJ D;  1FYC A;  2ZXP A;  1T9H A;  4AYB G;  1AFP A;  1G91 A;  2R3Z A;  3PGZ A;  4OWX B;  2G9H D;  4JV5 Q;  3KJP A;  2VUM B;  3NTK A;  3K6O A;  1KAB A;  3M4Q A;  4QJF A;  4DR4 Q;  3NQT A;  4GN5 A;  4RKB A;  4NB3 A;  3SR1 A;  2BE5 D;  5IIF A;  3X3N A;  3K59 A;  1Z47 A;  4AYB B;  1CK1 A;  5FJ8 H;  4DV0 Q;  4R9W A;  2M00 A;  2LSS A;  2KHI A;  1EZ8 A;  2Z9H A;  2QKI C;  4GNX B;  3CRL C;  4DR4 L;  1EQV A;  4GOP B;  4QF4 A;  4DAP A;  3GO5 A;  3MAQ A;  3S16 H;  2F0S A;  2X69 A;  3ERQ A;  4HN7 A;  3VR3 A;  1HCZ A;  1B53 A;  4PNY A;  5E4W C;  4DV4 Q;  1FGB D;  2XVS A;  1LAC A;  4RGM A;  3E0J A;  2VB3 X;  1VQP A;  4A3D B;  1XMQ L;  3GTL H;  4HJ5 A;  1SN8 A;  4NPS A;  2JA5 B;  1E2Z A;  3Q24 A;  5FLX c;  2B2W A;  1SRU A;  3GTJ B;  4A3G H;  3OWE B;  1ZEQ X;  3EIV A;  1ASY A;  5C4X G;  2K33 A;  3OMC A;  2DY7 A;  2YU9 H;  1XMQ Q;  2EY2 A;  5C5M A;  3HOZ G;  5C4X H;  2LS0 1;  5JVH 3;  2RQX A;  2JA5 G;  2WKC A;  3Q0A A;  3SK6 A;  5M3F H;  2B29 A;  1GKH A;  2Q2T A;  2ZTE A;  2N55 A;  1WTP A;  1W6J A;  1LTL A;  1VMC A;  1XPO A;  1EY8 A;  2IX3 A;  3LWE A;  2O5J C;  1EIH A;  3VA7 A;  3X3M A;  4R4I A;  4IOC A;  4BY7 B;  3CXC A;  4MZ9 A;  1KAW A;  1Q90 A;  3PO2 H;  2JSO A;  3HOW G;  4TRD A;  3M4Y A;  2BH2 A;  2EYJ A;  1LO5 D;  5M3M H;  2VZA A;  5K36 H;  3HKZ G;  2XN9 C;  2J0T D;  3VR4 A;  2I46 A;  1VQ7 A;  3PIO A;  1HA6 A;  1LTR D;  2NVX B;  1LTA D;  4HIK A;  1PFN A;  4A3F G;  2E2I H;  3VR6 A;  4IAL A;  3EJI A;  4L5R C;  4IN3 A;  1I4X A;  1LTI D;  4DF7 A;  1VQO A;  2L0C A;  1VCI A;  4A3I H;  1XX8 A;  1U0L A;  2UXB Q;  1PRT D;  1ET6 A;  5IYB H;  1X56 A;  4QL5 A;  1ICF B;  2XGT A;  1SDF A;  4OIK A;  2G9D A;  3H09 A;  4IUP A;  4DUZ Q;  1HA5 A;  3A8J E;  1GM5 A;  1S5D D;  2JP1 A;  3HEJ A;  2A68 C;  4A4I A;  1I94 Q;  4C1N I;  4DU9 A;  1EY9 A;  1A3U A;  2K04 A;  3M7N A;  1KL9 A;  1OXT A;  1E22 A;  2E76 C;  3KLW A;  3CQZ B;  1I5F A;  5F2D A;  5EJW A;  5JJL A;  3QO2 A;  2AQ1 B;  3PV0 A;  4TSS A;  2D0O A;  5C44 G;  4BBR B;  4B3M L;  1GJX A;  3UDF A;  4LK1 C;  2L15 A;  1SMY C;  4DR3 L;  3M4O H;  3E6Z X;  4HTH A;  4DV5 L;  5FLX E;  1Q82 C;  1Q86 C;  1IKM A;  4UY8 C;  1SNC A;  2NYZ D;  3R2I A;  2UU9 Q;  1TWH H;  4LFB L;  2F0H A;  5JVG 3;  1K83 H;  1X3P A;  2WAQ G;  4R8I A;  4IPH A;  1BCP C;  5FLX L;  4BBS H;  1H9S B;  1II3 A;  5FLM H;  4LFC Q;  1JJC B;  4I7Z C;  3UI2 A;  1I6V C;  4X3K A;  2NN6 G;  4P72 A;  5T1I A;  2ZJQ A;  4BS9 A;  4OEL B;  4FNF A;  5GAD C;  4GZY C;  2UUC Q;  3A8K E;  3ULP A;  2DNE A;  2O2L D;  4CDF C;  4KD3 A;  1EOV A;  4A3B G;  1S5E D;  1V9P A;  2HUG A;  4LFC L;  3ERO A;  4IJL A;  3G48 A;  3R93 A;  2DNC A;  4IJH A;  2VW9 A;  1HFG A;  5LMN Q;  4I65 A;  3S1M B;  3VYT A;  4CHT B;  3ER0 A;  1L2F A;  2VXW A;  4LUV A;  4FXK C;  1SNO A;  2IX0 A;  5I6Y A;  2UXD L;  4A76 A;  2RKS A;  3TDQ A;  1JB7 A;  1MD2 D;  4DXF A;  3S2H H;  3CW2 C;  4OEM B;  3IRB A;  1H9S A;  1K8A C;  4F88 A;  2HIV A;  1AZQ A;  2PZU A;  1TS4 A;  4KKU A;  4HAE A;  4IUV A;  3QIA A;  3HP3 A;  5CV8 A;  1YEZ A;  1TWC H;  1B3Q A;  1EYD A;  3FKI G;  2JA6 H;  3N52 A;  4KY5 A;  1K73 C;  1STG A;  2L1B A;  4O2D A;  1TS5 A;  5IYC H;  3RNU A;  2ZM6 L;  3EVQ A;  1JWS D;  1TXY A;  1YHA A;  4AIM A;  4DV1 L;  2L9H A;  1FGU A;  3CCE A;  5LMN W;  2BE5 C;  2R61 A;  2BA0 A;  3CME A;  2ZJP A;  1BR9 A;  1MHW C;  3KF8 A;  3PIP A;  4LF4 Q;  2SNS A;  4JVZ A;  2XIW A;  3AB9 A;  1KAA A;  2NBF A;  1Y1W G;  1S5F D;  3I4M H;  3T4A C;  1PHJ A;  3S2D H;  5LMU Q;  4PMC A;  4O42 A;  2D5D A;  4MIU A;  3Q23 A;  5J39 A;  5ELB A;  2QGQ A;  1L0W A;  1X32 A;  3K5O A;  2IT1 A;  4JW0 A;  1X3Q A;  3HGB A;  4C3I H;  4L63 B;  4DR1 Q;  4LF4 L;  2EJF C;  4CDC C;  2EYH A;  2YTV A;  4B3R Q;  4ALP A;  4UDU C;  4C3I G;  4X3S A;  2F4V Q;  4J1M A;  5DM7 3;  1EQT A;  4ODG A;  5EBD A;  3M3Y B;  4NP5 A;  4JI6 L;  1SR3 A;  2O4X A;  3P20 A;  2DJG C;  5JEA G;  1Q3L A;  1E0B A;  4DR1 L;  3C3L A;  5C3E B;  1DOK A;  4A93 B;  1PH1 A;  5GAG C;  1AE3 A;  1I6H B;  3I73 A;  4X62 Q;  3SK5 A;  1VF7 A;  1SNM A;  3TP6 A;  1YNJ D;  5EKK A;  3DXJ C;  4QCL A;  4LF6 L;  5FKA C;  2KHJ A;  2F0G A;  5A2Q L;  4JI4 Q;  1QWY A;  5IE8 A;  4F87 A;  1J9O A;  5I4D A;  5C4Z A;  4JPB W;  2Y0S B;  2F0Q A;  5IGG A;  2RSO A;  1PMR A;  1KLU D;  1S5B D;  2E2H B;  1A3T A;  1QUQ B;  4GNX C;  3C1F A;  2CH4 W;  3T56 B;  5C4J B;  2TMP A;  3CRK C;  4R4T A;  3GTM H;  2E8G A;  2GVB A;  1VMP A;  1CSQ A;  3TQY A;  1EWI A;  2IPK D;  2WAQ B;  5CBA E;  3GTK B;  1EWH A;  4J8Q A;  4CJ2 C;  4YHH L;  2AQ3 B;  4WJW A;  1JOK A;  4I7A A;  1N33 L;  3GTG H;  1GUG A;  4PZ7 A;  1U4R A;  4HED A;  1BBW A;  4LWC A;  2FJ2 A;  3K81 C;  4QQB X;  2JYO A;  3TZU A;  2HQE A;  1RTN A;  2JA7 G;  2TSS A;  2A6E C;  4X65 Q;  1VQ9 A;  2AKW B;  4FO2 A;  4BY1 B;  1WTQ A;  3K0Y A;  1PYB A;  4LUO A;  1S3O A;  4DR7 L;  1I4H A;  1LT4 D;  4OX9 Q;  5M5X B;  2RVL A;  4YCW A;  5CC4 A;  3J7Y W;  1R4Q B;  4BXX H;  3T53 B;  5T1G A;  1IXR A;  4IFD J;  3G71 A;  1HJP A;  4IPD A;  2DN8 A;  3CCR A;  1JCK B;  4L5T A;  1UEB A;  2VB2 X;  2JA7 B;  2OEO A;  4OX9 L;  4B9W A;  1D1I A;  3FVQ A;  1KIX A;  1IBM Q;  3HOY H;  4GNX A;  4L6T B;  5IY0 A;  2E2I B;  1EOT A;  1H9K A;  5FO9 B;  4JC0 A;  5C6A A;  3I4O A;  3HOY G;  2L12 A;  2NVX H;  1K28 A;  2JA9 A;  4NXN L;  2R7Z B;  4A3D H;  4LF7 Q;  1IBM L;  4XIG S;  4FF1 A;  1YIJ A;  2F52 A;  2PW7 A;  1F9Q A;  3VA5 A;  2NVT B;  1P8L A;  4R4Q A;  4K6D A;  2R6G A;  3MXN A;  1GUT A;  4QGU A;  2CCZ A;  5KNB A;  4FDB A;  3HOY B;  4HSP A;  4BA2 I;  5J1Z A;  4DPG A;  5IT9 L;  1EYA A;  1JJ2 A;  2OF1 A;  4AQY Q;  2VUM H;  1EY6 A;  4RCO A;  1LTT D;  1WTX A;  3P7J A;  4BBR H;  1VQH A;  1SYD A;  3PCO B;  3E3X A;  1HNZ Q;  1B9M A;  3CKI B;  1SE2 A;  4BBR G;  3PUX A;  4AQY L;  2E74 C;  1YVC A;  3CCV A;  2B2U C;  1V1Q A;  2J4X A;  3BYY B;  4TQU S;  4OHJ A;  2Q8R E;  3A0J A;  2PQA A;  3HRZ C;  2K4K A;  2WB1 G;  3GD7 A;  3J81 L;  1WTO A;  5M5W H;  2MP1 A;  4A3C G;  3EA6 A;  1WTV A;  1CKO A;  2Q2I A;  5FO7 B;  2LFN A;  1N8R C;  2E5L L;  1P16 A;  1PZI D;  3GTL B;  4OWT B;  1J5E Q;  1DON A;  1B8A A;  1STY A;  1DD2 A;  1NJI C;  1MSH A;  1A2U A;  4G7Z C;  1CT1 D;  1STN A;  3TRE A;  3NPP A;  3FMC A;  5DLQ E;  2JE6 I;  2E5L Q;  2JA7 H;  4BBS B;  2FIN B;  2FMC A;  1HPC A;  1T5X D;  2BDO A;  3QWN A;  4A3J B;  2WII B;  4A3L G;  3U4Z A;  1NSN S;  1SNP A;  1K8M A;  3SDZ A;  2JN4 A;  5CYU A;  4JV5 L;  5HUR A;  1LM0 A;  4DR5 Q;  1B1Z A;  1RTO A;  4K0K L;  2B39 A;  2LY7 A;  3U50 C;  1RHP A;  1YHB A;  5KYI A;  3CAM A;  4BY1 H;  1PYW D;  3D4D A;  2H1E A;  1VQ5 A;  1WD0 A;  2B2U A;  2EXZ A;  3LNN A;  4N9T A;  4JI8 L;  3T1Y L;  3KFU A;  2VNU D;  1G6P A;  1G2T A;  4LF5 L;  1PH8 A;  1AN8 A;  4A3K B;  1PDQ A;  1SNQ A;  4N9P A;  4L5S A;  3NXW A;  2XSC A;  3KDF A;  1CI3 M;  1X54 A;  2BDN A;  2F0P A;  2OXP A;  5M9O A;  1JE5 A;  1HZC A;  4UP7 A;  1ENF A;  1NMG A;  4MTK A;  4A75 A;  5C4H A;  1WVL A;  4DAY B;  1WOC A;  4LF5 Q;  1IW7 D;  1NUC A;  3KLS A;  1TWA H;  1E1O A;  3BDL A;  4O0A A;  4DV4 L;  3BJU A;  4A3K G;  1SYG A;  1Q12 A;  4ZLT F;  4DR2 L;  3I4M B;  3LWU A;  3RLF A;  3AYH B;  1VQN A;  4K2L A;  1DM0 B;  4JBJ A;  4L8J A;  5EQ0 A;  2PZW A;  2JA6 G;  2CKZ B;  2O5I C;  2A73 B;  1K9M C;  4V19 0;  2MFI A;  4MNO A;  3IL8 A;  2KQ3 A;  2PO4 A;  3PUV A;  1QCB D;  4R1J A;  3SHL A;  2F0E A;  2EZV A;  3F2B A;  3HOW B;  1I4Q A;  3UE1 A;  3BZD B;  3HG9 A;  4A3M G;  5FJ8 G;  1QNK A;  4DR2 Q;  3IFD A;  3PMF A;  5KIX A;  3BYT B;  3LX0 A;  3E5S A;  4X64 L;  2A19 A;  4E6I A;  2F0K A;  1Z6H A;  3M3Y H;  3C2P A;  2JA6 B;  2EYO A;  3NSW A;  5E1F A;  4ZAI A;  4A93 G;  1O7Y A;  3SEB A;  1F77 A;  1YJN A;  1HUM A;  3PUZ A;  2PCF B;  5L37 A;  4LF9 L;  1PH2 A;  3D4R A;  3CPW A;  1U4M A;  2ENB A;  3F1Z A;  4LAA A;  3NP8 A;  4M1U B;  1EEI D;  1DCZ A;  1HTL D;  2B2Y A;  5M3M G;  4UP8 A;  1YNN D;  2CH4 A;  2G5D A;  3AFP A;  1QOH A;  2D9U A;  2IHF A;  1PLF A;  3P1H A;  4QB4 A;  3NE5 B;  4A3L H;  1BDO A;  1K3B C;  1DZ1 A;  4JI1 L;  1Q7Y C;  5M3M B;  1B4O A;  2HIX A;  1NBW A;  3RLO A;  4LF8 L;  2WB1 B;  3IFT A;  4DK3 C;  2Z6B A;  5ELD A;  3RR5 A;  1RD9 D;  2KCT A;  2A6E D;  4XT1 B;  1YHQ A;  2KUM A;  1CKM A;  1E2V A;  4A3J H;  2WFW A;  3NBI A;  1VQC A;  4B9X A;  1ENA A;  3K7A H;  4FP5 D;  3S15 B;  3TS0 A;  1JJG A;  5C0X J;  3S17 H;  1I94 L;  3QJY A;  3HOZ B;  4IPC A;  5JEA J;  3VYS A;  1RCV D;  5IYD G;  3CC7 A;  1ZYR C;  4DNT B;  3GTQ H;  3ICE A;  2V1C C;  4J15 A;  4RGO S;  2B2T A;  1YNX A;  1STE A;  1CUK A;  5KYL A;  1OXU A;  4X6A H;  4H44 C;  1KC8 C;  3HOZ H;  3KBX A;  2JK8 A;  4UP9 A;  1AP0 A;  4IFD H;  1K3R A;  1GHK A;  2QDB A;  2Z1C A;  4XTC S;  4J6H A;  2ATW A;  5C0X G;  5IOC A;  2R92 G;  3KF6 A;  4CKE A;  3I4L A;  1I3Q B;  2EQS A;  1GHJ A;  3HOV H;  3DLL A;  3H6M A;  4NXM L;  3GTP B;  1KRS A;  4FF3 A;  3A7A B;  2N8N A;  4H13 C;  1Y69 U;  3FKI B;  2OTL A;  2EIF A;  3BVZ A;  2K1B A;  1PTO H;  5I2X A;  5IGD A;  3CCJ A;  1SYE A;  2MHV A;  3BG3 A;  4Q0F A;  4AH6 A;  3S1Q H;  4L5Q A;  2FMM A;  2N88 A;  3CCM A;  1H9M A;  1I4P A;  2XWB B;  1YBY A;  5M5Y H;  3PO2 B;  1A6X A;  1SRO A;  1R9T B;  1X55 A;  2UUB Q;  1TS2 A;  1BUV T;  4RKL A;  1EIY B;  1Y1V H;  4PZ8 A;  5IWA Q;  1LTG D;  1G29 1;  1LT3 D;  1RDP D;  1N36 L;  4MHE A;  4IUT A;  1SYB A;  1BF4 A;  1JMC A;  2KOL A;  3BU2 A;  3BVM A;  1EIG A;  4UHV A;  2RDG A;  1XTD A;  2BOS A;  3L2P A;  1EYC A;  3I70 A;  2HHH L;  2RHQ B;  1SMX A;  1ZXT A;  1FJG Q;  5KEE A;  2ZM6 Q;  1C8C A;  4Q5V A;  2F0N A;  1UUP A;  3UDX A;  4A3J G;  1Z7T A;  1GD7 A;  3PUY A;  4H02 A;  1QZG A;  1FNW A;  2SNM A;  1LAB A;  4JBK A;  1VQF A;  3J81 c;  2AQ2 B;  3S17 B;  1NR4 A;  1MJC A;  5LMU L;  5KND A;  2SEB D;  3GP7 A;  3CD6 A;  3MFY A;  1F9P A;  3GTK H;  3PF5 A;  1GUS A;  1CQF A;  2GN5 A;  2R93 H;  4DV5 Q;  1XPU A;  1IL8 A;  1GVP A;  1SE3 A;  4RFB A;  1D7Q A;  3RZO B;  3F2U A;  1NY4 A;  1WCM H;  1PVO A;  2K05 A;  1PV4 A;  5I2Y A;  3HOV B;  3UE0 A;  2NZ1 D;  1CKN B;  1N9W A;  4HSV A;  3RMH A;  3G6J B;  3T16 A;  5KGU A;  1ML0 D;  5AJ3 Q;  1KNA A;  1D6E C;  3S1R B;  1W3S A;  4DGZ A;  1TR5 A;  1T5E A;  2KEN A;  2K50 A;  1SAP A;  3MA2 B;  1SFO B;  4YWK A;  2A6H C;  4G57 A;  1A8V A;  4OO1 G;  1BO0 A;  1PRT F;  4U68 A;  3HOV G;  1O7L A;  1Y1W H;  1SE8 A;  3IKJ A;  4RMF A;  4GLA C; 
#chains in the Genus database with same CATH homology
 1J6Q A;  4GKK L;  4WJ3 M;  3HOU H;  1CSQ A;  1Q1B A;  2MO0 A;  3TQY A;  5LMN L;  4JI5 Q;  3PF4 A;  1S72 A;  1EWI A;  1QVG A;  3T1H L;  2KBN A;  3CCS A;  2K5H A;  3DM3 A;  4YHH L;  4PG3 A;  5GQO A;  3SGI A;  3UDG A;  2EXD A;  4B3S L;  3PO3 G;  1EQR A;  3CC4 A;  1N33 L;  3GTG H;  4GLV B;  5ELO A;  4PZ7 A;  4KHP L;  4X66 Q;  1BBW A;  3M85 A;  4IO9 A;  4LWC A;  1HR0 L;  1XNQ Q;  3K81 C;  5M5X H;  2LXJ A;  2YV5 A;  4QQB X;  3BZK A;  3FHW A;  3NEL A;  1W2B A;  3W1G A;  1B7Y B;  2NZH A;  3OYY A;  2JA7 G;  4UPA A;  2IHE A;  4IPG A;  4X65 Q;  3J80 c;  2AKW B;  1YZ6 A;  1VQB A;  3NEM A;  1VQ9 A;  2E2H H;  1PYB A;  4LUO A;  4DV0 L;  1S3O A;  2AMC B;  4JI0 Q;  4DR7 L;  1E3P A;  4OX9 Q;  3ZJY C;  4YCW A;  1WCM G;  5IWA L;  4DKA C;  2MO1 A;  1HR0 Q;  4EQ5 A;  4BXX H;  2UUA Q;  4OXP A;  3M4P A;  2FXQ A;  3J7A 5;  1IXR A;  3ERS X;  4A3B H;  3G71 A;  4IFD J;  1CKN A;  1HJP A;  2Q2H A;  3MEF A;  4IPD A;  1N36 Q;  3AFQ A;  3K80 C;  3CC2 A;  5EAY A;  1B70 B;  2VY3 A;  2XTI A;  1M90 C;  3JC6 6;  3CCR A;  1X3E A;  1Q81 C;  1X9N A;  1C7Y A;  2WB1 E;  1UEB A;  4L5T A;  4BY1 G;  4JI8 Q;  3K0X A;  3JAM i;  4OX9 L;  5BR8 Q;  3CCU A;  2IY5 B;  5ELN A;  1KIX A;  1IBM Q;  1HNX L;  3HOY H;  3K7U C;  4LW1 A;  4GNX A;  4JYA Q;  5IY0 A;  1VS0 A;  3U58 A;  4TVA B;  2ZJR A;  3AQQ A;  4OWW B;  1FJG L;  2ID0 A;  4JC0 A;  1N32 L;  4DV3 L;  3I4O A;  3HOY G;  1HZB A;  1VQ8 A;  3F2D A;  1PH4 A;  1XNR Q;  2NVT H;  1EUJ A;  5IP7 H;  3OTO Q;  1IBK L;  4APV A;  2NVX H;  3S1R H;  5IYD H;  2JA9 A;  4NXN L;  2VS1 A;  1VQ4 A;  2ZTD A;  4A3D H;  5BR8 L;  2JEB I;  4LF7 Q;  1NE3 A;  1ASZ A;  1IBM L;  1HNX Q;  4XIG S;  4JYA L;  4PZ6 A;  5C44 H;  1YIJ A;  2F52 A;  3L7Z C;  3CF5 A;  4HIM A;  4JCV E;  4YWM A;  4B3T Q;  1WFQ A;  3S1N H;  1P8L A;  4R4Q A;  4B3R L;  4JOI C;  1HH2 P;  2VQF Q;  4DV3 Q;  2BA1 A;  2R6G A;  4QGU A;  1E1T A;  3RN2 A;  1YJW A;  3MXN B;  4HJ7 A;  2CCZ A;  1L1O C;  1E24 A;  2I5M X;  4EX5 A;  3OTO L;  4FDB A;  1N34 L;  1IBK Q;  2R93 G;  3HOX H;  4Y52 H;  1A62 A;  4BA2 I;  1FVI A;  2Y0S G;  4DPG A;  4JI6 Q;  1OXX K;  3UDI A;  4AQY Q;  1JJ2 A;  5HY6 A;  2OWO A;  3WWV A;  4IFD G;  4OO1 I;  4JOI A;  2VUM H;  4P71 A;  3H3V H;  4KI0 A;  4JI2 Q;  5FLM G;  4DV2 Q;  1EIF A;  2JEA I;  4C2M H;  4POG A;  2VQF L;  4BBR H;  1U5K A;  1VQH A;  3S15 H;  3TRZ A;  2PMZ E;  4YCV A;  3PCO B;  2B63 H;  1VQI A;  2I5L X;  2YYZ A;  5GAE C;  3CPF A;  5C0X I;  2MNA A;  1HNZ Q;  1K0R A;  4BBR G;  3PUX A;  3A5U A;  3I55 A;  4AQY L;  1Q86 C;  4LF6 Q;  3NBH B;  3I4M G;  1YVC A;  4BA1 I;  3CCV A;  4JI2 L;  1V1Q A;  4TQU S;  2F3I A;  5C4J H;  3A0J A;  1VQD A;  1NTG A;  1BKB A;  2PQA A;  2RCN A;  1WI5 A;  3STB C;  2K4K A;  1RIP A;  2WB1 G;  3GD7 A;  5M5W H;  3E9H A;  1QVF A;  4A3C G;  1GO3 E;  2KCM A;  2NN6 I;  1CKO A;  2Q2I A;  3A5Z B;  1H95 A;  1N8R C;  3ULL A;  2E5L L;  1T9H A;  2R7Z H;  1X65 A;  4AYB G;  1P16 A;  1HZ9 A;  2RF4 A;  4A3G G;  4OWT B;  1J5E Q;  3PGZ A;  4OWX B;  4DV7 L;  3Q8D A;  1B8A A;  4A3D G;  2JA8 H;  1NJI C;  4JV5 Q;  3KJP A;  1VQM A;  3TRE A;  2QEX A;  2JJQ A;  5JJI A;  4LUZ A;  1K8G A;  5HGQ A;  1KHI A;  2UXB L;  1IBL L;  5DLQ E;  2JE6 I;  4JG2 A;  4QJF A;  3M4Q A;  3ULJ A;  2E5L Q;  2JA7 H;  4DR4 Q;  4A3L G;  1QUQ A;  4GN5 A;  5IYB G;  4JBM A;  3U4Z A;  3E9I A;  4NB3 A;  2N49 A;  3GTJ H;  2ZTC A;  2NVQ H;  4BXX G;  3CP0 A;  4AYB E;  1Z47 A;  2K5V A;  2C35 B;  1RL2 A;  5M3F G;  4DV7 Q;  5IP9 H;  2DGY A;  5FJ8 H;  4DV0 Q;  4JV5 L;  4LFA Q;  4DAM A;  5IYC G;  1LM0 A;  2LSS A;  2KHI A;  4DR5 Q;  2B63 G;  4K0K L;  4IOA A;  4GNX B;  5JJK A;  1IBL Q;  1X6O A;  3U50 C;  4DR4 L;  1SLJ A;  1YHB A;  4GOP B;  4A3E H;  1MJE A;  3CAM A;  4BY1 H;  1Y1W H;  3GO5 A;  2R92 H;  3E0E A;  1VQ5 A;  2K52 A;  1PH7 A;  2VNU D;  3KFU A;  4JI8 L;  3T1Y L;  3S16 H;  4DR6 L;  1QVC A;  1IZ6 A;  1BVS A;  1G6P A;  4LF5 L;  3HKZ E;  1PH8 A;  4B3M Q;  3GDE A;  3H0G H;  1VQK A;  3PO2 G;  3I4N G;  2NZO A;  4DR5 L;  1IL2 A;  5K36 G;  4K0K Q;  4DR3 Q;  4L5S A;  2I5H A;  1Q8K A;  4DV4 Q;  2Z0S A;  4DV6 Q;  3KDF A;  1X54 A;  4HIO A;  4P75 A;  1L1O A;  3RZD H;  1N32 Q;  1VQP A;  1JE5 A;  1HZC A;  4A3F H;  4UP7 A;  1XMQ L;  1NMG A;  2Z6K C;  4HJ5 A;  3GTL H;  4MTN A;  4A75 A;  1SN8 A;  4NPS A;  4NXN Q;  4DK6 C;  1VQG A;  4DAY B;  1WOC A;  4LF5 Q;  2IX1 A;  4LF7 L;  5FLX c;  2UXB Q;  1SRU A;  1TWA H;  4A3G H;  1E1O A;  3CQZ H;  4O0A A;  1LUZ A;  3BJU A;  3EIV A;  4DV4 L;  4DV6 L;  1UE6 A;  4A3K G;  1Q12 A;  3CCL A;  1OXS C;  2AWN A;  4YCU A;  4DR2 L;  1ASY A;  3D31 A;  3RLF A;  5C4X G;  3AYH B;  3KOJ A;  2AHO B;  1VQN A;  4JBJ A;  4DUY L;  2YU9 H;  4JI7 L;  2JA6 G;  1XMQ Q;  2CKZ B;  3D0F A;  2MQH A;  3HOZ G;  5C4X H;  1L1O B;  1K9M C;  2MFI A;  4MNO A;  2OQ0 A;  3PUV A;  2JA5 G;  2PI2 E;  4R1J A;  2BH8 A;  2I0Q A;  1IYJ B;  3F2B A;  4DV2 L;  5M3F H;  2B29 A;  1GKH A;  3UE1 A;  1KQS A;  4A3M G;  5FJ8 G;  2Q2T A;  2ZTE A;  4DR2 Q;  1LYL A;  4KLK A;  4NXM Q;  2CWA A;  2D0P A;  4DUY Q;  4JI7 Q;  1LTL A;  2R7F A;  1XPO A;  4X64 L;  2A19 A;  3HOU G;  4R4I A;  3M3Y H;  4IOC A;  4A3E G;  1HR0 W;  1MKH A;  4A93 G;  3CXC A;  3KYH C;  1O7I A;  4MZ9 A;  1OXV A;  1KAW A;  3H15 A;  1YJN A;  2ALY B;  3PO2 H;  3PUZ A;  3HOW G;  3I4N H;  1A63 A;  2RHS B;  2BH2 A;  5M3M H;  4LF9 L;  2VZA A;  3HKZ G;  1UE1 A;  1PH2 A;  3CPW A;  1HNW Q;  4C3J H;  2Z6K A;  3OW2 A;  2UUB L;  3F1Z A;  3J80 i;  1VQ7 A;  2VQE L;  1PH9 A;  2JA5 H;  3PIO A;  5M3M G;  4BY7 G;  4UP8 A;  3BZC A;  4HIK A;  4A3F G;  2E2I H;  4R4C A;  4JI3 L;  1J5E L;  3GTP H;  4L5R C;  3S1M H;  2GVA A;  3AFP A;  3W1B A;  1VQO A;  2IHF A;  1VCI A;  5GRO A;  4DV1 Q;  4A3I H;  1HNW L;  1R9T H;  1U0L A;  1VQE A;  2YTX A;  1G51 A;  3I56 A;  4LNQ A;  5IYB H;  3PO3 H;  1X56 A;  4QL5 A;  4A3L H;  2VQE Q;  2XGT A;  1VQ6 A;  3EBE A;  1Q46 A;  1MIU A;  1NMF A;  2LXK A;  4JI1 L;  2HHH Q;  1Q7Y C;  2ES2 A;  3W5O A;  2HIX A;  1NBW A;  3RLO A;  4DUZ Q;  4LF8 L;  1KXL A;  1X3F A;  3B6Y A;  1GM5 A;  4DK3 C;  4LFA L;  4A4I A;  1I94 Q;  3I7F A;  3RR5 A;  2CWP A;  2WP8 J;  3S14 H;  2KCT A;  4POF A;  1YHQ A;  1CKM A;  3M7N A;  4A3J H;  1KL9 A;  1OXT A;  1E22 A;  2WFW A;  3I2Z A;  1KRT A;  2UU9 L;  4LFB Q;  3KLW A;  3FP9 A;  1I5F A;  1VQC A;  4A3C H;  2D62 A;  5JJL A;  3H0G G;  3K7A H;  3T1Y Q;  3PV0 A;  4DR6 Q;  2D0O A;  5C44 G;  2CQO A;  2R7Z G;  2F4V L;  3HOW H;  4B3M L;  3TS0 A;  2UXC Q;  1JJG A;  3UDF A;  5C0X J;  3S17 H;  2L15 A;  1I94 L;  4DR3 L;  4P73 A;  3M4O H;  3LGJ A;  3G4S A;  2PI2 A;  1AE2 A;  5IP7 G;  1Q82 C;  2N78 A;  2VL6 A;  1Y1V G;  3FKI H;  4IPC A;  2CFM A;  5JEA J;  5IYD G;  3CC7 A;  4DV5 L;  2UU9 Q;  5E7N A;  1TWH H;  4UY8 C;  3GTQ H;  3TS2 A;  4LFB L;  1I6H H;  3ICE A;  1EQQ A;  2V1C C;  4J15 A;  1K83 H;  2WAQ G;  4A3K H;  4IPH A;  3RN5 A;  2A8V A;  4GOP C;  1CSP A;  4HJA A;  4BBS H;  1YNX A;  5FLM H;  4LFC Q;  1JJC B;  1XNR L;  3CCQ A;  4YY3 L;  2NN6 G;  3PUW A;  4P72 A;  1CUK A;  3F2C A;  2ZJQ A;  4A3I G;  4HID A;  1VQL A;  1OXU A;  1Q1E A;  5GAD C;  2UUC Q;  4X6A H;  1KC8 C;  1TWF H;  4JI4 L;  3HOZ H;  2JK8 A;  4UP9 A;  3ULP A;  1K3R A;  4GLX A;  2Y0S E;  1S40 A;  1EOV A;  1PA6 A;  4A3B G;  2UXD Q;  4RG1 A;  1KD1 C;  1V9P A;  4XTC S;  4LFC L;  2ATW A;  5C0X G;  1AH9 A;  4QY7 A;  2HT1 A;  4KHZ A;  2R92 G;  3KF6 A;  3G48 A;  3NEN A;  4IJL A;  5C3E H;  5J3B A;  3RZO H;  2EQS A;  1XMO Q;  3HOV H;  1Y14 B;  4IJH A;  4JI5 L;  2YTY A;  2VW9 A;  3DLL A;  1UE7 A;  5LMN Q;  1EYG A;  4NXM L;  4A93 H;  2ASB A;  3HKS A;  1KRS A;  3ER0 A;  1L2F A;  3T1H Q;  2N8N A;  4LUV A;  3RLN A;  4X64 Q;  2OTJ A;  4YHH Q;  2IX0 A;  2OTL A;  2EIF A;  4A76 A;  2UXD L;  2H5X A;  3VDY A;  1JB7 A;  1N33 Q;  4KHP Q;  3CCJ A;  3S2H H;  2Q2U A;  4AH6 A;  3S1Q H;  1BBU A;  3CW2 C;  2K14 A;  4L5Q A;  3CCM A;  3IRB A;  1XMO L;  1K8A C;  2HQL A;  2HIV A;  1YBY A;  5M5Y H;  1TWG H;  4YWL A;  2B3G A;  1HZA A;  4LF9 Q;  1SRO A;  4X65 L;  2A1A A;  2PQA B;  1X55 A;  1UE5 A;  2UUB Q;  4JI0 L;  4BY7 H;  1E7Z A;  4DR7 Q;  1YEZ A;  1TWC H;  1Y1V H;  3FKI G;  4PZ8 A;  4GOP A;  1EIY B;  2JA6 H;  5IWA Q;  1YIT A;  3STB D;  4OON A;  4BBS G;  2UUA L;  4JI3 Q;  1K73 C;  1G29 1;  4O2D A;  2E2J H;  5IYC H;  1DGS A;  2OQK A;  1EFW A;  3RNU A;  1N36 L;  3HOX G;  2ZM6 L;  4WJ4 A;  4GKJ L;  5H1S E;  1TXY A;  1YHA A;  4AIM A;  5IT9 c;  4DV1 L;  1SFO H;  1QZH A;  1FGU A;  2PNH A;  4HJ8 A;  1JMC A;  3CCE A;  5LMN W;  3BU2 A;  2BA0 A;  1YJ9 A;  3CME A;  2OCE A;  2ZJP A;  4HJ9 A;  3H3V I;  1C0A A;  1UWV A;  1XTD A;  4QIW E;  3AEV A;  3A74 A;  3L2P A;  3PIP A;  4LF4 Q;  3KF8 B;  4JI1 Q;  2HHH L;  2RHQ B;  1SMX A;  3J81 i;  3G6E A;  1Y1W G;  1FJG Q;  4DUZ L;  4LF8 Q;  1WYD A;  3I4M H;  1PHJ A;  3S2D H;  5LMU Q;  3J81 j;  2ZM6 Q;  2DUD A;  4GS3 A;  4DNI A;  3J7Z C;  3GTO H;  4GKJ Q;  3K8A A;  2N3S A;  3UDX A;  3JAM c;  4A3J G;  2QGQ A;  1JT8 A;  1GD7 A;  1L0W A;  3PUY A;  4H02 A;  4PMW A;  4R4O A;  3TEH B;  1QZG A;  2IT1 A;  4C3I H;  4DR1 Q;  4JBK A;  4LF4 L;  1VQF A;  3J81 c;  4B3T L;  1VQA A;  4IFD I;  4GN3 B;  2YTV A;  3S24 A;  1XPR A;  4B3R Q;  4X62 L;  1Z9F A;  1MJC A;  5LMU L;  4ALP A;  4JBW A;  1WJJ A;  2F4V Q;  2UXC L;  1VQJ A;  1N34 Q;  3CD6 A;  3M9B A;  3GTK H;  3KDF B;  3PF5 A;  1FL0 A;  2GN5 A;  1OTC A;  2JA8 G;  4JI6 L;  3KF6 B;  2R93 H;  4DV5 Q;  2JQO A;  1SR3 A;  1XPU A;  3PSI A;  1GVP A;  5JEA G;  4DR1 L;  1D7Q A;  1I3Q H;  2WAQ E;  1PH6 A;  1PH5 A;  1A0I A;  1NY4 A;  2K5N A;  4C3H H;  1PH1 A;  1WCM H;  5GAG C;  2R7D A;  1PVO A;  1AE3 A;  3U4V A;  4X62 Q;  1PV4 A;  3UE0 A;  3EN2 A;  4Y7N H;  3KJO A;  1D8L A;  2AWO A;  1CKN B;  3CMA A;  1N9W A;  2VUM G;  3HFZ B;  4YY3 Q;  5AJ3 Q;  5IP9 G;  1HNZ L;  4ME3 A;  4LF6 L;  1V43 A;  4GKK Q;  1YI2 A;  2KHJ A;  1W3S A;  3L0O A;  1PH3 A;  2UUC L;  2KEN A;  4JI4 Q;  2K50 A;  1PYS B;  5IE8 A;  2QA4 A;  4YWK A;  5C3E G;  1PFS A;  1XJV A;  1X3G A;  1A8V A;  1I50 H;  1C9O A;  2NVY H;  2K75 A;  4B3S Q;  4GN4 B;  4P74 A;  4OO1 G;  4A3M H;  1QUQ B;  4GNX C;  1M1K C;  4X66 L;  3HOV G;  1XNQ L;  4R4T A;  5AJ3 L;  5GAH C;  2E8G A;  3GTM H;  2GVB A;  1SE8 A;  3F8T A;  4RMF A;  4GLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...