2MFIA

Domain 1 of e. coli ribosomal protein s1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S1
publication title Resonance assignment of the ribosome binding domain of E. coli ribosomal protein S1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mfiA00
2WB1G 1CKOA 1VQAA 2B3GA 3L0OA 2PQAA 3KF6B 4OWXB 2BA1A 1G6PA 3CP0A 1VQCA 1WCMH 3JAMi 1G51A 5C4JH 1J5EQ 3HOVG 1YVCA 1XMQQ 5JJLA 3W1BA 1M1KC 1IBMQ 2UUAQ 5C4XG 1OXXK 3CW2C 3CCMA 4MZ9A 1R9TH 4JI4Q 4A3CH 2RCNA 2R7FA 3J7ZC 4A3BG 4H02A 2XTIA 4GLAC 1K3RA 3F8TA 4R4QA 2N8NA 2WAQE 3MXNB 5FJ8H 2DGYA 4NXNQ 4A3EG 5IYDH 4LF4Q 4LFAL 5J3BA 2CWAA 4LF8Q 1LTLA 5LMNQ 4HJAA 4AH6A 2WFWA 4DV2Q 4DNIA 3DLLA 4IPCA 4JV5L 1HZ9A 2VQFL 4DV6Q 1I5FA 4QL5A 3RLNA 2ZTCA 4QIWE 3AEVA 2CKZB 3GTQH 1XMOL 1PH5A 1N34L 3PSIA 2OQKA 4R4IA 4R4CA 1VQ4A 1YITA 1YJ9A 2PMZE 2VUMH 1UE7A 1PYSB 3A5ZB 4X66L 1E1OA 3CMEA 2JA9A 5IP9G 1L1OC 2VZAA 4DV7L 3B6YA 4BBSG 2OWOA 1Q82C 4OO1G 1UE5A 1RIPA 2UUBL 1E3PA 4HIKA 1I50H 1OXUA 4LUVA 3TEHB 1N36L 3PUVA 1AE2A 3S2DH 1C0AA 1Q8KA 1VQKA 2JA6G 2L15A 4DR1L 2B63G 5E7NA 2E2JH 2YTXA 1I94Q 1G291 3S16H 2MQHA 3M9BA 1PH6A 3K8AA 3U4VA 4O0AA 3OTOL 3RZDH 3CCLA 1XNRQ 4QQBX 2JQOA 3FKIH 4DV0L 4DV1L 4IFDG 4EQ5A 5M5XH 4OX9L 3S2HH 5IYCG 1QZHA 1Z47A 1EOVA 2VY3A 3PIPA 3PO3G 4RG1A 4LF7L 2R93H 1KXLA 4LFCL 5IT9c 4OWTB 1VQJA 3J7A5 1JJGA 1X55A 4DR3L 1B7YB 2N3SA 2NN6I 1QZGA 4NXMQ 2UU9L 4BA2I 1KC8C 1E24A 2ZM6Q 1K9MC 4LFBQ 2HIVA 1QVCA 5DLQE 4GLVB 2MO1A 4L5QA 1L2FA 5LMUL 4LUZA 4DUYL 1XNQQ 4JYAL 1VQ6A 5IE8A 2OTLA 1KHIA 4JBKA 1SROA 4B3TQ 1A8VA 3BU2A 1L1OA 1PH8A 1SR3A 3PF4A 3H0GH 1C9OA 5C0XI 4L5SA 2Q2TA 4A75A 2YTYA 2JK8A 1SFOH 1X65A 3W5OA 1JE5A 1YJWA 1E7ZA 4XTCS 2ALYB 3UDXA 1EWIA 1HR0L 3AQQA 4DV5L 4A93H 1K73C 3PO2H 4JI5Q 5EAYA 3HOWH 1NJIC 4A3FG 5JJKA 2GVBA 2QEXA 4DR7Q 4X62L 2K4KA 2RHSB 5IYBG 2HT1A 3D31A 2F3IA 3GTJH 1Q1BA 4JBJA 3ICEA 3JC66 3G4SA 2Z0SA 1WI5A 4YWMA 4JI2L 2N49A 1N32Q 1KRTA 3CCEA 4K0KQ 3J81j 3G71A 4X6AH 3CF5A 1AE3A 4PZ8A 3CMAA 3TRZA 1PHJA 2MFIA 1XMQL 2UUAL 1HNXQ 3HOXG 4QY7A 3GTGH 2Y0SG 5FLXc 1P16A 4HJ5A 1QUQB 2QGQA 4JI4L 3I2ZA 2PNHA 4GN5A 1VQLA 4JI7Q 4JBMA 1P8LA 3U50C 1HZAA 1VQNA 4L5RC 4C3IH 1V9PA 4LF4L 4BBRH 1VQ7A 1E1TA 2VNUD 3HKZG 1SMXA 4R4TA 4BY1G 3GDEA 3BZCA 1PH4A 4DV4Q 3FP9A 4BY7G 3JAMc 4UY8C 2YV5A 4DV6L 5IP9H 3HOZH 4BBSH 2EQSA 4A3MG 1VQOA 1X54A 2K52A 4YCVA 1PV4A 2E8GA 3ER0A 3T1HQ 1NMGA 5M3FH 4JI2Q 4GOPB 4YY3L 1Z9FA 4B3MQ 4BA1I 3KDFA 1VQBA 3HOYH 4PZ7A 4P74A 1PH1A 4IOAA 2LSSA 1W2BA 1CKNA 2IX1A 4JI1Q 2F52A 4KI0A 2RHQB 1KRSA 1Q12A 4JG2A 4YHHQ 4IOCA 4JI6Q 4A3LG 4IFDI 2VQEL 3CC7A 3KJOA 1JMCA 1T9HA 4GN3B 4A3JH 4X65L 2R7ZH 2N78A 1BBUA 3PO3H 4WJ4A 3I56A 1KD1C 4JI0Q 1I94L 1KL9A 3I7FA 2WB1E 3STBD 1EQQA 1IBLQ 5ELOA 1XNRL 3E0EA 3RZOH 3A74A 2I5HA 1VQEA 2KCMA 4JCVE 4JI8L 3M3YH 2JA7G 3T1YL 1M90C 3VDYA 4TVAB 4A76A 5BR8Q 2KCTA 4JBWA 2JE6I 1A0IA 2BH8A 1HZCA 1EUJA 1CUKA 4LF5Q 2E5LL 5C44G 4NXML 3HOUH 2IX0A 4A3IH 2K75A 1QVFA 1HH2P 1YBYA 5C0XJ 5JEAJ 4A3DG 1Y1WH 1MKHA 3CCUA 4GNXB 2CCZA 1BBWA 2IT1A 4DAMA 1SLJA 2C35B 5IP7G 2NVTH 3A5UA 2A19A 2GVAA 5C3EG 2CWPA 4P72A 3ULLA 5M5WH 3G48A 5IWAQ 3UE1A 4X64Q 5FLMH 1IXRA 4B3TL 2R92G 4KLKA 2K5HA 4B3SQ 3I4NH 1IBKQ 1PVOA 4APVA 4DV3L 3I4MG 1S72A 2UXBQ 2UXDL 3PV0A 3NBHB 4DR5Q 1ASZA 1U0LA 3EIVA 3E9HA 4JOIC 4DR2Q 2CFMA 2ASBA 2JA5H 3M4OH 4KHPQ 2A1AA 2LXJA 2R6GA 4JI5L 1PA6A 2JA8H 4DR7L 1I3QH 2NVQH 4DR6Q 2KBNA 2VW9A 1PYBA 4AYBG 1W3SA 2PQAB 1YZ6A 3MEFA 3PIOA 4OXPA 4PMWA 1PH3A 5M3MH 4DUZL 2IHFA 1GD7A 1K8GA 3UDGA 4UP8A 4A3KH 3KOJA 4BY7H 1O7IA 4IPGA 4JC0A 4O2DA 3AYHB 3M85A 4HJ8A 1VQHA 4LFAQ 4LWCA 1TWFH 1XPRA 4BXXH 3D0FA 3CD6A 1JT8A 3KFUA 2AMCB 4A3CG 3K7UC 2OQ0A 2MNAA 5HGQA 2VQFQ 3EN2A 3S14H 4GKKL 4Y7NH 1MJEA 2MO0A 3RLFA 1HR0W 5AJ3L 1Y1VH 5FJ8G 1S3OA 3PCOB 5IYDG 2HHHL 1XMOQ 4GKJQ 1E22A 4IFDJ 1B70B 4A3LH 4JOIA 4AQYL 4POGA 2ZTDA 5HY6A 1KAWA 3RN5A 1HNZQ 3GTMH 4B3ML 4DV7Q 3HOVH 3RLOA 3Q8DA 2I5LX 5C4XH 1LYLA 2AHOB 2UUBQ 2H5XA 2K5VA 4GLXA 4A3BH 1HNWL 1J6QA 5K36G 2WP8J 1N36Q 4JI1L 4YHHL 3PGZA 2HIXA 3KF6A 1OXSC 2RF4A 3AFQA 3J81c 4JI6L 2VUMG 4A3EH 2D0PA 2QA4A 1J5EL 1X56A 3KF8B 1YI2A 1IBML 3CXCA 1WYDA 2EIFA 4JI0L 3S15H 3HFZB 1IBLL 1Q81C 4DV0Q 4RMFA 1FL0A 4IO9A 3KYHC 2ATWA 2GN5A 1VQDA 5GROA 3H15A 4OX9Q 4NXNL 4LF9Q 2OCEA 2ES2A 2V1CC 4LFCQ 4ALPA 3BZKA 4LF8L 5LMNL 1AH9A 4KHZA 1FJGQ 3STBC 4DR4Q 2UUCQ 2Y0SE 4DR3Q 4PG3A 1IL2A 4DV2L 1YIJA 2JA7H 3J81i 2Q2UA 3FKIG 3GD7A 2F4VQ 4OO1I 4HIOA 4PZ6A 4HJ7A 3I4OA 1YJNA 2R93G 1X3GA 1X3FA 4DUYQ 1NE3A 1PH9A 3HKZE 1HZBA 1CSQA 1UEBA 4QGUA 3KJPA 2YU9H 2NN6G 2JA6H 1C7YA 2B63H 3PUXA 1L1OB 1B8AA 4A3GG 2B29A 1RL2A 1WOCA 5IWAL 4X64L 1EQRA 1D7QA 1WJJA 1LM0A 1EIFA 1IBKL 2K5NA 5IYCH 3GTKH 1Y14B 5IY0A 2PI2A 5GAHC 3S24A 3RNUA 4DK3C 3G6EA 4DR5L 1JJ2A 3H0GG 4POFA 2EXDA 3I55A 1IYJB 4DV5Q 1HR0Q 3CC2A 4QJFA 4YCUA 2ID0A 1XPOA 5C0XG 5JEAG 4YWKA 2AWNA 1OXVA 1WFQA 4X62Q 1KQSA 1GO3E 1YEZA 2D0OA 2BH2A 3PUYA 2K14A 5GADC 3J80c 4DPGA 4LF6Q 4A93G 1NMFA 3PO2G 2WAQG 3HOWG 3S1MH 3CCVA 1K8AC 1QVGA 2ZM6L 4B3RQ 4LFBL 1YHAA 3S1NH 1EYGA 1XNQL 3HKSA 3PF5A 3U4ZA 4DAYB 3L7ZC 1V1QA 3L2PA 4JI3Q 3BJUA 1N33Q 1GVPA 1KIXA 3KLWA 3S1RH 4XIGS 3M4QA 3J80i 5ELNA 1FGUA 2UXCQ 2AWOA 1MJCA 4GN4B 2D62A 1NY4A 3CQZH 3U58A 4A3FH 3TS0A 2ZTEA 4UP9A 4P73A 5IYBH 4IJHA 4IPHA 1CKMA 1K0RA 4BBRG 1N9WA 1XPUA 4OONA 5GAEC 4GOPC 3NELA 3OW2A 4YY3Q 4GKJL 4OWWB 1PFSA 1SN8A 4DKAC 4LNQA 3KDFB 3M7NA 3TQYA 1UE1A 1DGSA 3AFPA 2I5MX 3EBEA 3WWVA 1HNZL 3HOZG 4DR4L 3HOXH 1CKNB 4A4IA 4IJLA 1N32L 3K0XA 1EFWA 1VQFA 5M3FG 4K0KL 2VQEQ 3CCJA 2KHJA 1EIYB 4NPSA 3RR5A 1LUZA 4X65Q 2ZJPA 1OTCA 4FDBA 2VL6A 3HOYG 4BY1H 3S1QH 4HIDA 2A8VA 3A0JA 1HNXL 4YWLA 5GQOA 1K83H 4AYBE 1UE6A 1QUQA 4JI7L 1SRUA 4JI8Q 1WCMG 3GO5A 3UE0A 3PUWA 3T1YQ 4A3MH 3PUZA 1CSPA 1PH2A 4A3JG 4LF9L 2R7ZG 4Y52H 4HIMA 4R1JA 4UP7A 3FHWA 2Z6KC 4J15A 3CPWA 4MTNA 3F2DA 1X6OA 4DV4L 3CCSA 2UUCL 1XTDA 3F1ZA 1VQ8A 2E5LQ 4GS3A 2E2HH 3H3VI 4A3GH 2F4VL 3UDIA 3H3VH 1N34Q 3DM3A 1TWGH 3K80C 3NEMA 3OYYA 4GNXC 1YHQA 1VCIA 2PI2E 3UDFA 3T1HL 2OTJA 4GOPA 4X66Q 4DK6C 5GAGC 2Q2IA 3ULPA 3HOUG 3F2CA 1Q1EA 2XGTA 3TREA 4A3IG 3TS2A 1TWCH 1UWVA 3K81C 2DUDA 1Y1WG 1Q7YC 1L0WA 4LUOA 2AKWB 2YTVA 2HQLA 3CAMA 4DV3Q 4DR1Q 1A62A 3M4PA 1VQMA 2FXQA 3ERSX 4AIMA 1Q86C 4NB3A 1VQ9A 3LGJA 2UXDQ 4IPDA 4JV5Q 5FLMG 3ULJA 3OTOQ 1SE8A 4C3HH 1BKBA 2K50A 4YCWA 1TWHH 3CCRA 1FJGL 4L5TA 1D8LA 2ZJRA 3NENA 4DV1Q 3GTOH 3I4NG 3E9IA 5C44H 1GM5A 5LMNW 2JEAI 3S17H 5H1SE 1PH7A 4LF7Q 2NZHA 4A3DH 1VQGA 1HJPA 3GTPH 2IY5B 5M5YH 1MIUA 4LW1A 5IP7H 5BR8L 2UU9Q 1YHBA 1VQ5A 2Z6KA 4LF6L 5C3EH 2JA5G 4MNOA 1H95A 4DUZQ 4LF5L 1I6HH 1HNWQ 4EX5A 2JA8G 5LMUQ 3CPFA 1BVSA 2KHIA 1TWAH 1XJVA 2R92H 4JYAQ 4B3RL 4WJ3M 1Q46A 4TQUS 3CCQA 1FVIA 4GNXA 1X3EA 2NVXH 4P75A 2YYZA 2I0QA 1OXTA 3I4MH 3K7AH 3ZJYC 5JJIA 1V43A 1U5KA 5M3MG 2Q2HA 4JI3L 3F2BA 2IHEA 1N33L 4R4OA 2CQOA 3IRBA 4C2MH 4A3KG 4B3SL 4GKKQ 2UXCL 1VQIA 1NTGA 4C3JH 2ZJQA 1GKHA 2LXKA 5AJ3Q 3W1GA 1X9NA 2HHHQ 2UXBL 3SGIA 2BA0A 3GTLH 1IZ6A 4HJ9A 1VQPA 4BXXG 1JJCB 1ASYA 1YNXA 1N8RC 3CC4A 2JEBI 4DR2L 4AQYQ 4KHPL 2E2IH 2NZOA 2JJQA 4ME3A 3RN2A 1VS0A 1S40A 2VS1A 1A63A 4UPAA 1TXYA 4P71A 1Y1VG 2KENA 1JB7A 2R7DA 2NVYH 4DR6L 1NBWA
chains in the Genus database with same CATH superfamily
2PQAA 2PCFB 1OO9B 1PZID 3KF6B 5C3EB 1WCMH 1J5EQ 5C4JH 1SMYD 3HOVG 2DNEA 1WD1A 2R92B 5C4XG 1SBBB 5CR3A 4JI4Q 4A3BG 3UI2A 2XTIA 3T4AC 1A3UA 1NR4A 4R4QA 4A3EG 4LF4Q 4LFAL 5J3BA 1LTLA 5LMNQ 5I6YA 4LK1C 1D5XC 4AH6A 3DLLA 4DV6Q 1Z6HA 2CKZB 5K36H 4F87A 1RF2D 1B4OA 1YJ9A 3CU7A 2VUMH 2NBFA 1KNAA 3NXWA 3A5ZB 1BOSA 1E1OA 1FNWA 3FVQA 4BBSG 5JJZA 4DV7L 1G2TA 1EYCA 1RIPA 4F8MA 4HIKA 3AB9A 1H9SA 4LUVA 1C0AA 4CDFC 1VQKA 2JA6G 4X3UA 2TMPA 2YTXA 3KF8A 4FXGC 5CGKA 1I94Q 1T5XD 3R2TA 2KA7A 4K5XA 3RZDH 4IFDG 5ELCA 3DEPA 1Z47A 3P75A 3PIPA 4FF4A 3NWSA 4LF7L 4LFCL 2AQ1B 3J7A5 2P5ZX 3OMGA 3C1EA 3PMFA 1KC8C 4K2KA 4LFBQ 2SNMA 5DLQE 4CDEC 1CK1A 2SOBA 1VQ6A 4DAVA 2B39A 2XSCA 1SROA 1A8VA 4M1UB 1HXYD 1J8IA 1B1ZA 5K5PA 2A6ED 3F2UA 1M4VA 4DFAA 2SDFA 1PTOB 1YJWA 1EWIA 3OHXC 4JI5Q 1SNPA 2D2CC 1QWYA 2QEXA 4DR7Q 3S2HB 4HSVA 2K4KA 2F0JA 2F3IA 2N49A 4B9XA 4LAAA 4X6AH 3CF5A 3BVMA 4TKOB 1AE3A 4PZ8A 4A3GB 4ZYSA 2XWBB 5IIFA 4EVOA 1HNXQ 4QY7A 2RDFA 3A8KE 4JI4L 1WTXA 1B3QA 4NMZA 3I2ZA 1K3BC 1P8LA 2A69D 1SMYC 4C3IH 3R93A 4LF4L 4BBRH 1VQ7A 2KHSA 1PH4A 4M8AA 3FP9A 3NQIA 4F88A 4UY8C 4DV6L 1VQOA 4YCVA 1ICWA 3ZYYX 4YY3L 4R8NA 4B3MQ 3HOYH 2FINB 4KMUC 1SNMA 4RAUC 4JI1Q 2F52A 4QF4A 2RHQB 1KRSA 1WTPA 3DMUA 4RGNA 1WTRA 1AEXA 4OEMB 1FNVA 2DJFC 4GN3B 4A3JH 2N78A 1BBUA 1I94L 3I7FA 5T1IA 3VA7A 4JCVE 2RDHA 2NB0A 3VDYA 4U68A 4XYOA 4JBWA 2CW0D 1PZKD 1EUJA 1CUKA 3HOZB 4BBSB 2IX0A 4A3IH 2K75A 1QVFA 2AUJD 5JEAJ 1E2ZA 3SHLA 3VR2A 1XYIA 1BBWA 3NP8A 3NPPA 2C35B 3A5UA 2A19A 4P72A 5M5WH 5IWAQ 3QR8A 1U4RA 3UE1A 5KEEA 4KLKA 3I73A 4B3SQ 2MPMA 4APVA 1PVOA 2ICIA 1S72A 3K5NA 2UXDL 1TY2A 3PV0A 3E6ZX 5IGGA 2RSNA 2CFMA 2ASBA 2XVSA 4JI5L 4DR7L 4IUVA 3SXHA 3ND8A 1HFNA 2QF7A 4N8FA 4AYBG 1W3SA 1V8QA 3PIOA 3KBXA 1LABA 2WINB 5M3MH 3D4RA 2G5DA 2KCNA 3I3CA 3UDGA 1Y1WB 4UP8A 1UEAB 3KOJA 3MZ5A 2EDGA 3K5OA 4HJ8A 1D1IA 4K8IA 1VQHA 1XPRA 2EY2A 4LWCA 4BXXH 1HTLD 4DU9A 5I4DA 3KFUA 3I70A 3VYSA 2F3WA 3QG1A 1Y1VH 5IYDG 2E2JB 2HHHL 3PQIA 4I7ZC 1TT2A 4A3LH 2JA5B 2M2LA 2MUYA 3FPPA 4JOIA 4AQYL 2A6HC 2HDMA 3MXGA 4RKLA 3HOVH 2JA8B 4B3ML 1GJXA 5C4XH 1DM0B 2UUBQ 1KDAA 2H5XA 4GLXA 4A3BH 1J6QA 2WP8J 4CDCC 1N36Q 4JI1L 4KHVA 2JXMB 3DUZA 2RF4A 3AFQA 4A3EH 3OWEB 2D0PA 1S5DD 3EROA 1SNDA 1K8MA 4FXDA 4NXNL 2OCEA 1TWFB 2NTTA 4V0BA 3K59A 2V1CC 2ES2A 3BZKA 2A5HA 2HDLA 1FJGQ 4DR4Q 1JCKB 1EL0A 2WV6D 2ZXOA 4PZ6A 4HJ7A 2R93G 1X3GA 4DUYQ 1NE3A 1PH9A 3KJPA 1CTMA 2NN6G 2JA6H 1C7YA 4HCEA 4JK1C 1L1OB 4CKEA 3DEOA 3OW7A 5IWAL 1EQRA 1S5FD 1D6EC 1EZ8A 1EU3A 4IFDH 3NTKA 1IHZA 1EIFA 2B2WC 4S3SA 1Y14B 1GUNA 4IALA 3S24A 3IKJA 1HR0Q 3H0GG 4POFA 3WOFA 2F0IA 5C0XG 2C5CA 1WFQA 2EPBA 3FEWX 1YEZA 1LTGD 3HP3A 5GADC 4UAIA 3MA2B 2F0FA 4K5VA 2K01A 2L12A 3GV3A 2WAQG 5I9PA 3PO2G 3CCVA 1K8AC 4XT1B 5FOBB 5E4WC 1TR5A 3K5MA 3HKSA 5I9OA 4DAYB 4ZLTF 5FLXL 3T13A 2B63B 1EIHA 3S1RH 3J80i 2LKVA 2MP1A 4R9WA 2UXCQ 2AWOA 1LT6D 1NY4A 2F0EA 4P73A 3Q0AA 3PO3B 3TBIB 2J4XA 1CKMA 1K0RA 2SEBD 3NELA 3RZOB 4DN4M 1PFSA 1SN8A 1TIID 1SE2A 4DKAC 5JPNC 3KDFB 1UE1A 3KUPA 1CHPD 1F9QA 3EFXD 3QJYA 3K0XA 5M3FG 1SYEA 3CCJA 3S1MB 3QO2A 1EIYB 2ZJPA 1OTCA 3D8GA 4FDBA 2VL6A 4IN3A 1ONLA 3MFGA 1TY0A 4AYBE 1QUQA 4JI7L 1SRUA 2EYJA 1WCMG 3GO5A 1U4LA 1PH2A 3P1HA 2B2YC 1GUTA 4JV5Q 4DV4L 1FJGL 4DR4L 2WKDA 2ZXRA 3F1ZA 5FO8B 3DM3A 1TWGH 3K80C 4KD4A 5EQ0A 2XRSD 2OTJA 4GOPA 2DJGC 4DK6C 1VF7A 2AQ2B 3F2CA 1XTCD 3J7AV 3K81C 1HQRD 2EYMA 5EBCA 2F0PA 2YTVA 4DV3Q 2Z6BA 4KJOA 5TSSA 4DR1Q 1VQMA 2RDGA 1Q86C 4NB3A 1SNCA 3LGJA 1UAPA 3HKZB 4BY1B 3KLSX 3MXUA 3CCRA 1D8LA 2ZJRA 3NENA 5CMDA 3GTPH 3H6MA 1YHBA 1VQ5A 2PZUA 2Z6KA 5JVG3 4MNOA 4DUZQ 4LF5L 5I2XA 1I6HH 4IURA 1W6KA 4EX5A 1BVSA 1TWAH 4JYAQ 4TQUS 4GNXA 1FVIA 1V1PA 1STEA 2I0QA 2MJ8A 5C4ZA 3URYA 1TWCB 2UXCL 1CA5A 4C3JH 2SNSA 4CKCA 2QEJC 1ASYA 4L8JA 3CC4A 4KHPL 4KKSA 2E2IH 2NZOA 5C44B 4ME3A 1VS0A 3S17B 4NW2A 4UPAA 4Y7NH 2R7DA 3GTKH 2WB1G 1PRTD 1B3AA 3L0OA 3G6JB 4FYDA 1G51A 1PZJD 1EYAA 1F77A 1YVCA 1XMQQ 1IBMQ 1C4QA 1OXXK 2RCNA 3J7ZC 1K8OA 4GLAC 2BE5D 3F8TA 1SDFA 1GUGA 2WKCA 3I4MB 2WAQE 3MXNB 5IYDH 4PV1C 4HJAA 1TS4A 4K8JA 4IPCA 2EJMA 3T16A 4JV5L 1I5FA 4QL5A 3RLNA 1DXMA 4C3IG 4EGVA 3GTLB 3GTQH 4FF1A 5KYIA 4R4IA 1CQVA 4R4CA 1VQ4A 4GZYC 2PW5A 3MEHA 2B2UA 2PMZE 3CMEA 1A3TA 4DK1A 3B6YA 3QWNA 2OWOA 2NVYB 1UE5A 1E3PA 1I50H 2K32A 3Q6SA 3PUVA 1AE2A 1WCMB 5C4JB 1Q8KA 4DR1L 4O42A 2L5TA 2MQHA 1PH6A 4O0AA 2K5WA 1K0SA 3CCLA 1C48A 4DV0L 5KRUA 5M5XH 3NHHA 4OX9L 5IYCG 1EIGA 2V4DA 2R93H 1KXLA 4RG1A 5CORA 3CKIB 3VA5A 3SEBA 5IODA 2NN6I 2NN6H 2ZM6Q 1QOHA 2HIVA 1QVCA 1SYFA 1JE4A 4J8QA 4JYAL 2VUMB 3QIAA 2OTLA 4OIKA 2WIIB 4N9TA 2D9UA 1PH8A 3PF4A 3H0GH 2QKIC 5C0XI 1SE3A 5C0XH 1K28A 2DN8A 1X65A 1D5MC 1DD2A 1F2MA 1CZWA 2FJ2A 4XTCS 3RZDB 3RMHA 3AQQA 3C46A 1E2WA 5IOCA 4DV5L 2OXPA 3QB3A 3PO2H 1JQYD 1GUWA 4QMGA 4X62L 1PFNA 2RHSB 4KJNA 2F0KA 2HT1A 3D31A 3GTJH 1Q1BA 4JBJA 3V2TA 5A2QL 3ICEA 4YWMA 4ZKBB 3CCEA 4K0KQ 1JC7A 2ICEC 2PZTA 3J81j 3CMAA 3TRZA 5IGFA 3J7AF 1XMQL 1S5ED 3ERQA 1ZKOA 3KLSA 3HOXG 1PRTC 3LNNA 5FLXc 1P16A 2PNHA 3A8JE 3GV6A 1VQNA 3HEJA 4L5RC 1BCPD 2VNUD 2CVRA 4C1NK 2BE5C 2K33A 5EPKA 2YV5A 1SNQA 3C3LA 1PV4A 1EY8A 1B44D 5M3FH 1EZ6A 2EY5A 1VQBA 1RTOA 3FDTA 4P74A 2LSSA 3QOLA 1W2BA 1CKNA 2IX1A 4OGQC 4A3LG 5M9OA 2VQEL 3QOJA 3KJOA 5FLXE 1T9HA 4X65L 1PTOC 3I56A 5KNDA 1KD1C 1PRTF 4JI0Q 4X3SA 3IAYA 1KL9A 2WB1E 1IBLQ 2EYFA 3D4WA 5ELOA 4IUQA 2N55A 3E0EA 5ELFA 4JI8L 2OT2A 4HAEA 3T1YL 4BBRB 2F0TA 4B08A 1BO0A 3ONAB 2MGSA 5BR8Q 3U9SA 2B2VA 2OEOA 4N9PA 1A0IA 2BH8A 3V05A 2E5LL 5KNBA 4A3DG 1YBYA 4Z9CB 4K6DA 4UHVA 4DA2A 2CCZA 2RCFA 5IP7G 4DAMA 2GVAA 3NK9A 3HOYB 3G48A 1MHWC 4X64Q 1M8AA 4E6IA 2K5HA 3IFTA 4G57A 2K03A 3SK5A 3HRZC 4A3JB 3D6WA 1R9TB 4DR5Q 4HEDA 4QB4A 1ENFA 1EY9A 4JOIC 1WTOA 4FO2A 1ET9A 2A1AA 5CBEE 4H0LC 1L0YB 1BDOA 3TN2A 2KBNA 1DOLA 2KOLA 2NTSA 3NSWA 1A2UA 1YZ6A 3MEFA 4OXPA 1PH3A 1HRJA 4A3IB 2F0QA 1R4QB 2K7VA 2OF1A 4WJWA 2VXWA 4IPGA 4BY7H 4JC0A 1TS3A 4O2DA 3M85A 5M5WB 2CH4A 3CD6A 1BF4A 2PQEA 3K7UC 3S2DB 5ELEA 5BN4A 5HGQA 2LS01 2MNAA 2VQFQ 3S14H 3S9WA 3RLFA 2PW7A 5AJ3L 5FJ8G 1BCPC 2EYHA 1XMOQ 2XWJB 4GKJQ 4IFDJ 3EQLC 2JSOA 1KAWA 5C6AA 1A6XA 3RLOA 3HZXA 2I5LX 1LYLA 2AHOB 4BS9A 2K5VA 3D3RA 2KCCA 1NCVA 2K28A 1F2LA 1U4MA 1OXSC 3KF6A 3J81c 5M3MB 2LFNA 2QA4A 1J5EL 1YI2A 5G3LD 1WYDA 3CRLC 5IGBA 2EIFA 4JI0L 1LTSD 1IBLL 1MSHA 1VQDA 1PFMA 5GROA 1SE4A 4LF9Q 4ZKCB 5LMNL 1AH9A 4KKTA 4DR3Q 4PG3A 2J7ZA 2A6HD 4WFN3 2BDOA 2Q2UA 3FKIG 1Y1VB 5DM73 1BCPF 1ML0D 1NR2A 3SR1A 2F0WA 1HZBA 1CSQA 1TKWB 3SVMA 3MTSA 1EY6A 3HOVB 3BYYB 2YU9H 4K6LA 1J9OA 5C4XB 3VYUA 1B8AA 1RL2A 1WOCA 4A3BB 1JR0D 2F0MA 3RD4A 2NZ1D 4X64L 3O13A 1LM0A 2K5NA 4A3EB 5IYCH 2LMCB 2PI2A 1WVLA 3RNUA 1MBYA 2L9HA 3ND9A 4DK3C 4RWSC 4DR5L 1MGSA 1RCVD 4YCUA 4PMBA 5JEAG 2AWNA 1I4PA 4XT3B 1KQSA 2QW7A 3CHBD 4LJZC 2BOSA 4A93G 3HOWG 1EQVA 4B3RQ 1LTAD 1YHAA 4X3KA 4LFBL 3S1NH 1X32A 3U4ZA 1V1QA 3L2PA 2JA6B 5EBDA 2JP1A 1DZ1A 1EY5A 1LO5D 3M4QA 5ELNA 1MJCA 4GN4B 2XNAC 4UP9A 3I72A 4FF2A 1STAA 2AUKA 1N9WA 4GOPC 3OW2A 2QDBA 1HA5A 4GKJL 1Y8PB 4OWWB 1JOKA 4C3JG 3M7NA 1DGSA 3AFPA 3FMCA 2MHVA 1GUOA 3WWVA 3HOXH 2KECA 3DXJC 4A4IA 3OMCA 1F9RA 1QNKA 2M9VA 3TP6A 2KEEA 1LUZA 5C3WA 3S1QH 4HIDA 2QCPX 3A0JA 1HNXL 1A2TA 5F2DA 3MC0B 5GQOA 1EYDA 4MIUA 1JWUD 4DNRB 1I4GA 2O5IC 3PUZA 1EY7A 4LF9L 2R7ZG 3S1RB 1QE6A 3E5SA 1KDCA 2Z6KC 4J15A 3CCSA 4HN7A 4HMJA 3BYTB 1EU4A 4GS3A 4A3GH 3UDIA 5A2QE 4GNXC 1QILA 1SJHD 3D6CA 3A55A 3ULPA 3HOUG 2NVQB 2Q8IB 3DHQA 1UWVA 2DUDA 1UUPA 2WACA 3P7JA 2AKWB 1L0WA 2HQLA 3CAMA 1IKLA 2KEDA 3M4PA 5JJIA 1VQ9A 1RJTA 4AIMA 2L1BA 1BKBA 4YCWA 4L5TA 4DV1Q 3GTOH 3I4NG 3E9IA 4RCOA 4RHSA 5LMNW 2FHTA 2NZHA 5G3LF 4A3DH 4C1NI 3KK7A 1HJPA 4WORA 2IY5B 5M5YH 1MIUA 4Q0FA 5IP7H 1GHKA 2UU9Q 1IYUA 4MN3A 1AN8A 1TWGB 2KHIA 4B3RL 4WJ3M 1ICFB 1Q46A 2NVXH 3EJIA 2VB2X 1V1OA 5EGTA 4X3TA 1OXTA 2ENBA 3K7AH 1V43A 2Q2HA 3OPOA 1EWCA 4XQQA 2RA4A 2Z9HA 4C2MH 4A3KG 4B3SL 2RSOA 4GKKQ 4IQZA 1VQIA 3MAQA 1HA6A 3SGIA 1B53A 1VQPA 2KQ3A 1VMPA 2ZT9C 2B2UC 4EQOA 4R8IA 5KNCA 3RN2A 2JJQA 2F1MA 4G7OC 1A63A 1STNA 1LT5D 1KTKA 4JI2Q 4DNIA 5HURA 1JB7A 3GTPB 1HNWQ 1STBA 1VQAA 1QG7A 4H44C 2BA1A 1DOKA 3CP0A 1VQCA 4C56C 4EQNA 1S4ZA 1I6HB 5C5LA 1FGBD 5FKAC 3W1BA 3SK6A 3K58A 1M1KC 2UUAQ 1SYBA 1TWAB 2KUMA 3CW2C 4MZ9A 3H94A 3C1FA 4H02A 5NUCA 1K3RA 1S5BD 3N52A 5FJ8H 1CZGA 3X3NA 4LF8Q 1CT1D 3R8BA 5E1FA 2RQXA 4DV2Q 3IL8A 1NUCA 2ZTCA 2RVLA 4TSSA 1QJOA 4QIWE 1EY0A 4AYBB 1PH5A 1Y8NB 1STHA 2E2IB 1PYSB 2JA9A 5EPLA 4Y7NB 4OO1G 5EPJA 3GTKB 2UUBL 2I46A 4ULLA 3SK4A 1N36L 1ESRA 1VMCA 5DEHA 2E2JH 3S16H 3M9BA 3MXPA 3K8AA 3TP8A 4RCNA 1QNUA 2F3VA 1XNRQ 1U9RA 4FP5D 3FKIH 4HMIA 4DV1L 4EQ5A 3E3XA 3AMUA 4OWTB 1VQJA 4DF7A 1JJGA 1X55A 2N3SA 1Y8OB 1QZGA 4NXMQ 2UU9L 4JVZA 1Q3LA 4RGTA 1K9MC 2F0OA 5IGEA 3GTQB 2MO1A 3I91A 4DUYL 3TSSA 1XNQQ 1QB5D 5IE8A 1LLRD 5DM63 4B3TQ 1PDQA 1L1OA 1SR3A 4DGZA 4RHRA 1C9OA 3NBIA 3NWTA 1I50B 1DYQA 4L5SA 5JOBA 2Q2TA 5JEAH 4A75A 2JK8A 1SFOH 3E0JA 1JE5A 1GHJA 1E7ZA 2L55A 1HR0L 4A93H 4ZUIA 5EAYA 3HOWH 1NJIC 4A3FG 5JJKA 3EVQA 5M5XB 3A8IE 3L9AX 1DOMA 3G7LA 5IYBG 1HUMA 2R93B 1RHPA 1A15A 4H13C 1WI5A 1JOOA 4JI2L 1N32Q 1KRTA 2Z4HA 3G71A 2EYPA 4XXEA 2MFIA 3EA6A 4QUCA 1NSNS 3FPUB 2UUAL 3GTGH 2Z8LA 2Y0SG 4HJ5A 5COYA 4GN5A 4DAYA 2PNRC 5FK9C 4JBMA 1V9PA 1BBXC 2EZVA 3H0GB 2HCCA 2CQAA 1SMXA 4R4TA 2B2VC 3GDEA 4CGYB 4BY7G 2HCIA 4ZCKA 5IP9H 4FVMA 2EQSA 1O7ZA 4A3MG 2NYZD 1F9PA 2IX3A 1I4XA 1NMGA 4O1NA 3T1HQ 3PO2B 2WAQB 3PIP3 1Z9FA 2F0LA 2E74C 2NUCA 3MFYA 3KDFA 1GOZA 4IOAA 3GTJB 1G2SA 4KI0A 3TP5A 4YHHQ 4IOCA 2EE1A 5I6WA 1JMCA 3J81L 2R7ZH 4WJ4A 3PO3H 2PMZB 3STBD 1I4QA 1XNRL 3RZOH 3A74A 2KCMA 3M3YH 1CI3M 4KY6A 1M90C 2JA7G 4RKBA 1E0BA 1G8ZD 4TVAB 4C3HG 2KCTA 1YNND 2CH4W 1ESFA 3HOUH 4NXML 4ZQ3A 1LT4D 3CCUA 5M3FB 2IT1A 1X3PA 4LMQD 2NVTH 3H09A 5C3EG 2CWPA 1PTOD 4B3TL 5D3DA 2R92G 3GP7A 2I07B 1IBKQ 3I4NH 5E4XA 4DV3L 4IUUA 1SNOA 2UXBQ 4G7HC 3NBHB 2Z1CA 2XN9C 4I7AA 3E9HA 1XWEA 4DR2Q 3M4OH 2KJXA 3X3MA 1I3QH 4DR6Q 1HHVA 2VW9A 2PQAB 3I4LA 3SK8A 4ODGA 1MD2D 2BDNA 4PMWA 5ISRA 4DUZL 2IHFA 2QDLA 1GD7A 1K8GA 4ZRZA 1I4RA 2J0TD 4A3KH 2EYLA 3TP7A 1RD9D 3A56A 1CA6A 1JOQA 4LFAQ 3D0FA 1JT8A 2R61A 4A3CG 2EYOA 2F0UA 2OQ0A 4V190 1MJEA 3AU7A 3OIQA 4RH6A 1HR0W 3PCOB 2L11A 3NQTA 5LHY1 4K14A 1E22A 1C8CA 3GTMH 2A68C 3RN5A 4DV7Q 2A73B 1W6JA 2BCOA 1ILPA 2EXZA 1H9SB 1JICA 4YHHL 3V96A 1PYWD 1VF5C 1X56A 3BG3A 3KF8B 1R4PB 4YIJA 1ENAA 1IBML 3S15H 3I8ZA 4HR7B 3CRKC 4RMFA 2GN5A 3MXNA 1YNJD 4LFCQ 1SEBD 3STBC 2UUCQ 2Y0SE 2F0NA 1YIJA 5IT9L 3S14B 1UNSA 3J81i 2F4VQ 4OO1I 3R3OA 4HIOA 4OO1H 3I4OA 1YJNA 2WB1B 2F0SA 3K5LA 1SYCA 5IGDA 1YNNC 3R2IA 3PUXA 4A3GG 1B9NA 2B29A 3PIO3 2PO4A 1D7QA 2EOTA 3Q24A 1EEFD 1IW7C 1IBKL 1CM9A 5GAHC 1ET6A 4XQJA 1XPUA 3NBHA 2EXDA 4FNFA 4DAPA 1XPOA 1Q8IA 4YWKA 4K5WA 4C3IB 1OXVA 1GO3E 2D0OA 2BH2A 3NTHA 4DXFA 1KNEA 1NMFA 1Q90A 3BZDB 1MSGA 3BS1A 4IUPA 2ZM6L 1QVGA 3GQBA 2E75C 5DNFA 2K04A 3U9OA 3I90A 5I2YA 3L7ZC 1LTTD 2YU9B 4JI3Q 3BJUA 1N33Q 1GVPA 1QCBD 1KIXA 4KKUA 2PYKA 4XIGS 4J6HA 4ZK9B 1I6VC 2D62A 3CQZH 3U58A 4A3FH 2ZTEA 1PTOF 5IYBH 2TSSA 3JAML 1JWSD 4IPHA 2FMCA 4OONA 5GAEC 4ZAIA 4YY3Q 2EY6A 2B8GA 2M00A 3EBEA 3HOZG 4CKBA 4TRDA 1VQFA 3VYTA 5CV4A 4K0KL 1B2TA 1LTID 4ME5A 3VYRA 3S1NB 4ZUJA 5JAVA 1PRTB 1K83H 1CQFA 2EY1A 1SAPA 4RGMA 1O78A 3PUWA 1SYDA 4A3MH 4Y52H 5BN3A 4HIMA 4UP7A 4NP5A 3A54A 4MTNA 2UUCL 1XTDA 5IGCA 1VQ8A 1EEID 4KN7C 4NDXA 2E2HH 3OWFA 1YNJC 2F4VL 1RTNA 1N34Q 3OYYA 3M7GA 1VCIA 2PI2E 3UDFA 1RKNA 4X66Q 5AFWA 5GAGC 2Q2IA 2FMMA 1Q1EA 3TREA 4Q5VA 3HOXB 3TS2A 2B2TA 3Q23A 1AZPA 1GXDC 1Y1WG 1Q7YC 3W3AA 2GA4B 3OOCA 2JA7H 2FXQA 3ERSX 3DWQA 2UXDQ 1HTPA 3SE0A 5FLMG 3ULJA 3OTOQ 3S1QB 4C3HH 1BR9A 2IJ0A 1TWHH 1GM5A 2FFKB 3P20A 4FXKC 2JEAI 5H1SE 1VQGA 3IFDA 1H9MA 5BR8L 1JWMD 1EQTA 5C3EH 2K5DA 1ZYRC 4RA8A 2JA5G 1H95A 1XXGA 2JA8G 5LMUQ 2R92H 2RKSA 1B50A 1X3EA 4P75A 4G4KA 2YYZA 3BDCA 2QILA 2Q8TA 3ZJYC 1U5KA 3J81E 4JI3L 3LWUA 2F4IA 1N33L 1H9RA 4R4OA 1F9SA 3IRBA 2ZJQA 1GKHA 4HCSA 4K2LA 2HHHQ 1VDZA 1YNXA 1N8RC 1AZQA 2JEBI 3C2PA 3GTOB 4AQYQ 4KY5A 4PNYA 4QUFA 1S40A 4DXGA 2F03A 2VS1A 4P71A 1F2ZA 4A3DB 2KENA 1ZEQX 4CBVA 1ZXTA 5M5YB 1CKOA 2HD3A 1H9JA 2B3GA 4OWXB 1G6PA 3JAMi 1PMRA 2O4XA 5EKIA 3D4DA 2H4OA 5JJLA 3CCMA 4A3CH 1R9TH 1MI2A 2DNCA 3M4YA 2R7FA 2NVXB 4HTHA 1TS2A 2IL8A 3K0YA 2G9DA 2N8NA 3K7AB 2DGYA 4NXNQ 2CWAA 4C2MB 2WFWA 1HZ9A 2VQFL 1LV9A 3TZUA 3L3OC 3AEVA 1BCPB 1XMOL 1N34L 3PSIA 2OQKA 1YITA 3RUZA 1UE7A 4PQXA 4X66L 5FO9B 5IP9G 1L1OC 2VZAA 1D5ZC 1Q82C 4NKLA 4OL7A 2R3ZA 1OXUA 3TEHB 4MHEA 3S2DH 1JB3A 2N88A 2PZWA 2L15A 2B63G 1PTOH 5E7NA 1KDBA 1G291 3U4VA 3OTOL 4QQBX 1SXTA 2JQOA 2A6EC 1IKMA 3S2HH 1QZHA 1EOVA 2VY3A 3BVZA 3PO3G 5KYLA 3OIPA 5IT9c 4DR3L 1B7YB 3K57A 3J80L 1KABA 1ENCA 4BA2I 1E24A 4GLVB 4L5QA 1L2FA 5LMUL 4LUZA 4N8X1 1KHIA 4JBKA 3BU2A 5ELBA 4KN4C 3OSOA 1WTVA 4MTKA 2YTYA 1HFGA 2A69C 2DY8A 2E76C 3W5OA 1NAPA 3S16B 2ALYB 3UDXA 1K73C 3FKIB 5IT9E 2GVBA 3JC66 3G4SA 2Z0SA 4HSPA 4JW0A 5C4HA 4F7XA 1XX8A 2B8FA 1PHJA 4J1MA 3MHBA 5J39A 2CHBD 3HG9A 1QUQB 2QGQA 4JI7Q 1VQLA 2H1EA 4ID6A 1HZAA 3U50C 3VR5A 2K05A 4KD3A 1E1TA 1H9KA 3HKZG 4BY1G 4CJ2C 3BZCA 4DV4Q 1FR3A 3JAMc 1SFOB 1GUSA 1DCZA 3HOZH 4B9WA 4BBSH 1KLGD 1X54A 2EJFC 2K52A 2RBMA 2K5QA 2DY7A 2E8GA 3ER0A 3K6OA 3NTIA 4A93B 1D1KA 4GOPB 3HOWB 3NUCA 2CW0C 2L4NA 5J1ZA 4BA1I 3KBGA 4PZ7A 1PH1A 1O7LA 5CV9A 4UDUC 4JG2A 1Q12A 5EKLA 1F2YA 4JI6Q 4IFDI 5D14A 4DK0A 3CC7A 4QIWB 4JPBW 5CV8A 2A74C 1EFID 3GTGB 5CBAE 4DNTB 1EQQA 2EVBA 2HQEA 3SDZA 2F0DA 4QCLA 2I5HA 1VQEA 3JAME 3ITPA 3FRPB 5DAUA 4OIJA 4IZ8A 4A76A 1SSOA 4ILWA 4C3JB 2JE6I 2K1BA 1HZCA 4LF5Q 5C3XA 5C44G 3H3VC 3VR3A 1HH2P 5C0XJ 1PFBA 2O2LD 1Y1WH 1MKHA 4GNXB 1KLUD 1V1PB 1AFPA 1SLJA 3ULLA 5FLMH 1X3QA 1IXRA 4FF3A 3WOEA 2K6AA 5CYUA 3VR4A 3HS0C 1PLFA 3I4MG 2R7ZB 1BXTA 2F0VA 1NNXA 3BDOA 3T53B 1ASZA 1U0LA 3EIVA 2D5DA 1AW7A 2F0GA 3BVGA 2JA5H 4KHPQ 2LXJA 2R6GA 1PA6A 3M3YB 2JA8H 2NVQH 5D65A 1PYBA 1T5EA 3HOUB 4KY7A 3TDQA 1BUVT 1S5CD 5CV5A 4L6TB 5C5MA 1HCZA 5D3IB 3W2DA 1SJED 1O7IA 2NVTB 3AYHB 2O5JC 4CJ1B 1TWFH 3KLRA 1I4HA 1FYCA 2AMCB 3I4NB 4GKKL 3EN2A 2MO0A 5CV7A 1S3OA 1B70B 3M4OB 2XRQD 4POGA 2ZTDA 3BDLA 3MWYW 5HY6A 1HNZQ 3T51B 1I3QB 3Q8DA 4KV6A 1HNWL 5K36G 3PGZA 2HIXA 3MVVA 4I65A 4JI6L 2VUMG 5CV6A 4OELB 1TU2B 2IW3A 3A7LA 5LL6X 4EQPA 3CXCA 4A3KB 4P2CB 1RDPD 3HFZB 1Q81C 4DV0Q 4IO9A 1FL0A 2ATWA 3KYHC 4OX9Q 3H15A 1STYA 1B9MA 1EOTA 1TVXA 2IWHA 4ALPA 4LF8L 5KIXA 3DM1A 4KHZA 4RFBA 1IL2A 4DV2L 2A68D 1LACA 1E2VA 3GD7A 3Q22A 2JN4A 1X3FA 3HKZE 2PPBC 1UEBA 4QGUA 3GTMB 3DWAA 2B63H 4CDDC 3LWEA 1LTRD 1SYGA 3TMEA 1FNUA 2X6GA 1WJJA 3LX0A 1EY4A 2X69A 1WTWA 1DJRD 5ELDA 1HPCA 2Z4IA 5IY0A 3G6EA 1JJ2A 4PMCA 3I55A 4DV5Q 3CC2A 1IYJB 3S15B 4QJFA 2ID0A 4IUTA 5CC4A 2ZXPA 4X62Q 1Y69U 3PUYA 5A35A 2K14A 3J80c 1JORA 4DPGA 4LF6Q 5EKKA 1D2BA 3S1MH 1LT3D 1IYVA 1EYGA 3A7AB 1TS5A 1G91A 1XNQL 3HGBA 3PF5A 1IW7D 3DWPA 2L0CA 2NWGA 3KLWA 1DONA 1FGUA 3J7YW 1AP0A 1STGA 3TS0A 1WTHA 2B2WA 1ILQA 4IJHA 4XYQA 4BBRG 1O7YA 3J80E 4LNQA 3TQYA 1HNZL 2I5MX 2B2TC 5EJWA 1CKNB 4WRDA 4RGOS 4IJLA 1N32L 1EFWA 4H7BA 2VQEQ 2KHJA 2EJGC 4NPSA 3RR5A 4X65Q 4U673 3HOYG 2F0HA 4BY1H 2A8VA 1EWHA 4YWLA 1UE6A 3N6RA 4JI8Q 3UE0A 1HQMC 3T1YQ 1CSPA 4G7ZC 1Z7TA 5J22A 4A3JG 4KTAA 4R1JA 3FHWA 3H91A 3CQZB 3CPWA 3F2DA 4A3FB 1X6OA 2E5LQ 5KGUA 1IL8A 4ABNA 4CHTB 3H3VI 3H3VH 3NEMA 3NE5B 5E3FA 2G9HD 2KVMA 1YHQA 1A3VA 3T1HL 5HGTA 2E2DC 4L63B 3WDNA 2XGTA 4A3IG 1TWCH 2Y0SB 3T56B 2VB3X 5JPMC 1KAAA 1PXUA 4LUOA 1BNZA 4XDXA 4IUNA 1A62A 2IPKD 1LTBD 2C9OA 4IPDA 1L0XB 1BQQT 1SE8A 2K50A 1K83B 4BY7B 1O80A 5JVH3 5C44H 3S17H 2LY7A 4A3MB 1PH7A 4LF7Q 1FD7D 1RODA 4XQNA 2B2YA 4LW1A 4KK7A 4LF6L 1WTQA 2E2HB 1TQOA 3CPFA 1XJVA 5L37A 3CCQA 2X6LA 3I4MH 5T1GA 5M3MG 3F2BA 2IHEA 4BWGB 2CQOA 5FO7B 4CJ0B 3TZDA 1NTGA 3VR6A 5AJ3Q 2LXKA 2JA7B 3W1GA 1X9NA 2AQ3B 2Q8RE 2UXBL 2BA0A 3GTLH 1IZ6A 4HJ9A 4BXXG 4C3HB 1JJCB 1II3A 2XIWA 1TWHB 1G6ZA 1WD0A 4DR2L 1ZYRD 4OHJA 1CHQD 5LL6S 1TXYA 1U4PA 1Y1VG 2HUGA 2JYOA 1CFMA 2NVYH 4DR6L 1NBWA 5BN5A 1HUNA
chains in the Genus database with same CATH topology
2WB1G 1CKOA 1VQAA 2B3GA 3L0OA 2PQAA 3KF6B 4OWXB 2BA1A 1G6PA 3CP0A 1VQCA 1WCMH 3JAMi 1G51A 5C4JH 1J5EQ 3HOVG 1YVCA 1XMQQ 5JJLA 3W1BA 1M1KC 1IBMQ 2UUAQ 5C4XG 1OXXK 3CW2C 3CCMA 4MZ9A 1R9TH 4JI4Q 4A3CH 2RCNA 2R7FA 3J7ZC 4A3BG 4H02A 2XTIA 4GLAC 1K3RA 3F8TA 4R4QA 2N8NA 2WAQE 3MXNB 5FJ8H 2DGYA 4NXNQ 4A3EG 5IYDH 4LF4Q 4LFAL 5J3BA 2CWAA 4LF8Q 1LTLA 5LMNQ 4HJAA 4AH6A 2WFWA 4DV2Q 4DNIA 3DLLA 4IPCA 4JV5L 1HZ9A 2VQFL 4DV6Q 1I5FA 4QL5A 3RLNA 2ZTCA 4QIWE 3AEVA 2CKZB 3GTQH 1XMOL 1PH5A 1N34L 3PSIA 2OQKA 4R4IA 4R4CA 1VQ4A 1YITA 1YJ9A 2PMZE 2VUMH 1UE7A 1PYSB 3A5ZB 4X66L 1E1OA 3CMEA 2JA9A 5IP9G 1L1OC 2VZAA 4DV7L 3B6YA 4BBSG 2OWOA 1Q82C 4OO1G 1UE5A 1RIPA 2UUBL 1E3PA 4HIKA 1I50H 1OXUA 4LUVA 3TEHB 1N36L 3PUVA 1AE2A 3S2DH 1C0AA 1Q8KA 1VQKA 2JA6G 2L15A 4DR1L 2B63G 5E7NA 2E2JH 2YTXA 1I94Q 1G291 3S16H 2MQHA 3M9BA 1PH6A 3K8AA 3U4VA 4O0AA 3OTOL 3RZDH 3CCLA 1XNRQ 4QQBX 2JQOA 3FKIH 4DV0L 4DV1L 4IFDG 4EQ5A 5M5XH 4OX9L 3S2HH 5IYCG 1QZHA 1Z47A 1EOVA 2VY3A 3PIPA 3PO3G 4RG1A 4LF7L 2R93H 1KXLA 4LFCL 5IT9c 4OWTB 1VQJA 3J7A5 1JJGA 1X55A 4DR3L 1B7YB 2N3SA 2NN6I 1QZGA 4NXMQ 2UU9L 4BA2I 1KC8C 1E24A 2ZM6Q 1K9MC 4LFBQ 2HIVA 1QVCA 5DLQE 4GLVB 2MO1A 4L5QA 1L2FA 5LMUL 4LUZA 4DUYL 1XNQQ 4JYAL 1VQ6A 5IE8A 2OTLA 1KHIA 4JBKA 1SROA 4B3TQ 1A8VA 3BU2A 1L1OA 1PH8A 1SR3A 3PF4A 3H0GH 1C9OA 5C0XI 4L5SA 2Q2TA 4A75A 2YTYA 2JK8A 1SFOH 1X65A 3W5OA 1JE5A 1YJWA 1E7ZA 4XTCS 2ALYB 3UDXA 1EWIA 1HR0L 3AQQA 4DV5L 4A93H 1K73C 3PO2H 4JI5Q 5EAYA 3HOWH 1NJIC 4A3FG 5JJKA 2GVBA 2QEXA 4DR7Q 4X62L 2K4KA 2RHSB 5IYBG 2HT1A 3D31A 2F3IA 3GTJH 1Q1BA 4JBJA 3ICEA 3JC66 3G4SA 2Z0SA 1WI5A 4YWMA 4JI2L 2N49A 1N32Q 1KRTA 3CCEA 4K0KQ 3J81j 3G71A 4X6AH 3CF5A 1AE3A 4PZ8A 3CMAA 3TRZA 1PHJA 2MFIA 1XMQL 2UUAL 1HNXQ 3HOXG 4QY7A 3GTGH 2Y0SG 5FLXc 1P16A 4HJ5A 1QUQB 2QGQA 4JI4L 3I2ZA 2PNHA 4GN5A 1VQLA 4JI7Q 4JBMA 1P8LA 3U50C 1HZAA 1VQNA 4L5RC 4C3IH 1V9PA 4LF4L 4BBRH 1VQ7A 1E1TA 2VNUD 3HKZG 1SMXA 4R4TA 4BY1G 3GDEA 3BZCA 1PH4A 4DV4Q 3FP9A 4BY7G 3JAMc 4UY8C 2YV5A 4DV6L 5IP9H 3HOZH 4BBSH 2EQSA 4A3MG 1VQOA 1X54A 2K52A 4YCVA 1PV4A 2E8GA 3ER0A 3T1HQ 1NMGA 5M3FH 4JI2Q 4GOPB 4YY3L 1Z9FA 4B3MQ 4BA1I 3KDFA 1VQBA 3HOYH 4PZ7A 4P74A 1PH1A 4IOAA 2LSSA 1W2BA 1CKNA 2IX1A 4JI1Q 2F52A 4KI0A 2RHQB 1KRSA 1Q12A 4JG2A 4YHHQ 4IOCA 4JI6Q 4A3LG 4IFDI 2VQEL 3CC7A 3KJOA 1JMCA 1T9HA 4GN3B 4A3JH 4X65L 2R7ZH 2N78A 1BBUA 3PO3H 4WJ4A 3I56A 1KD1C 4JI0Q 1I94L 1KL9A 3I7FA 2WB1E 3STBD 1EQQA 1IBLQ 5ELOA 1XNRL 3E0EA 3RZOH 3A74A 2I5HA 1VQEA 2KCMA 4JCVE 4JI8L 3M3YH 2JA7G 3T1YL 1M90C 3VDYA 4TVAB 4A76A 5BR8Q 2KCTA 4JBWA 2JE6I 1A0IA 2BH8A 1HZCA 1EUJA 1CUKA 4LF5Q 2E5LL 5C44G 4NXML 3HOUH 2IX0A 4A3IH 2K75A 1QVFA 1HH2P 1YBYA 5C0XJ 5JEAJ 4A3DG 1Y1WH 1MKHA 3CCUA 4GNXB 2CCZA 1BBWA 2IT1A 4DAMA 1SLJA 2C35B 5IP7G 2NVTH 3A5UA 2A19A 2GVAA 5C3EG 2CWPA 4P72A 3ULLA 5M5WH 3G48A 5IWAQ 3UE1A 4X64Q 5FLMH 1IXRA 4B3TL 2R92G 4KLKA 2K5HA 4B3SQ 3I4NH 1IBKQ 1PVOA 4APVA 4DV3L 3I4MG 1S72A 2UXBQ 2UXDL 3PV0A 3NBHB 4DR5Q 1ASZA 1U0LA 3EIVA 3E9HA 4JOIC 4DR2Q 2CFMA 2ASBA 2JA5H 3M4OH 4KHPQ 2A1AA 2LXJA 2R6GA 4JI5L 1PA6A 2JA8H 4DR7L 1I3QH 2NVQH 4DR6Q 2KBNA 2VW9A 1PYBA 4AYBG 1W3SA 2PQAB 1YZ6A 3MEFA 3PIOA 4OXPA 4PMWA 1PH3A 5M3MH 4DUZL 2IHFA 1GD7A 1K8GA 3UDGA 4UP8A 4A3KH 3KOJA 4BY7H 1O7IA 4IPGA 4JC0A 4O2DA 3AYHB 3M85A 4HJ8A 1VQHA 4LFAQ 4LWCA 1TWFH 1XPRA 4BXXH 3D0FA 3CD6A 1JT8A 3KFUA 2AMCB 4A3CG 3K7UC 2OQ0A 2MNAA 5HGQA 2VQFQ 3EN2A 3S14H 4GKKL 4Y7NH 1MJEA 2MO0A 3RLFA 1HR0W 5AJ3L 1Y1VH 5FJ8G 1S3OA 3PCOB 5IYDG 2HHHL 1XMOQ 4GKJQ 1E22A 4IFDJ 1B70B 4A3LH 4JOIA 4AQYL 4POGA 2ZTDA 5HY6A 1KAWA 3RN5A 1HNZQ 3GTMH 4B3ML 4DV7Q 3HOVH 3RLOA 3Q8DA 2I5LX 5C4XH 1LYLA 2AHOB 2UUBQ 2H5XA 2K5VA 4GLXA 4A3BH 1HNWL 1J6QA 5K36G 2WP8J 1N36Q 4JI1L 4YHHL 3PGZA 2HIXA 3KF6A 1OXSC 2RF4A 3AFQA 3J81c 4JI6L 2VUMG 4A3EH 2D0PA 2QA4A 1J5EL 1X56A 3KF8B 1YI2A 1IBML 3CXCA 1WYDA 2EIFA 4JI0L 3S15H 3HFZB 1IBLL 1Q81C 4DV0Q 4RMFA 1FL0A 4IO9A 3KYHC 2ATWA 2GN5A 1VQDA 5GROA 3H15A 4OX9Q 4NXNL 4LF9Q 2OCEA 2ES2A 2V1CC 4LFCQ 4ALPA 3BZKA 4LF8L 5LMNL 1AH9A 4KHZA 1FJGQ 3STBC 4DR4Q 2UUCQ 2Y0SE 4DR3Q 4PG3A 1IL2A 4DV2L 1YIJA 2JA7H 3J81i 2Q2UA 3FKIG 3GD7A 2F4VQ 4OO1I 4HIOA 4PZ6A 4HJ7A 3I4OA 1YJNA 2R93G 1X3GA 1X3FA 4DUYQ 1NE3A 1PH9A 3HKZE 1HZBA 1CSQA 1UEBA 4QGUA 3KJPA 2YU9H 2NN6G 2JA6H 1C7YA 2B63H 3PUXA 1L1OB 1B8AA 4A3GG 2B29A 1RL2A 1WOCA 5IWAL 4X64L 1EQRA 1D7QA 1WJJA 1LM0A 1EIFA 1IBKL 2K5NA 5IYCH 3GTKH 1Y14B 5IY0A 2PI2A 5GAHC 3S24A 3RNUA 4DK3C 3G6EA 4DR5L 1JJ2A 3H0GG 4POFA 2EXDA 3I55A 1IYJB 4DV5Q 1HR0Q 3CC2A 4QJFA 4YCUA 2ID0A 1XPOA 5C0XG 5JEAG 4YWKA 2AWNA 1OXVA 1WFQA 4X62Q 1KQSA 1GO3E 1YEZA 2D0OA 2BH2A 3PUYA 2K14A 5GADC 3J80c 4DPGA 4LF6Q 4A93G 1NMFA 3PO2G 2WAQG 3HOWG 3S1MH 3CCVA 1K8AC 1QVGA 2ZM6L 4B3RQ 4LFBL 1YHAA 3S1NH 1EYGA 1XNQL 3HKSA 3PF5A 3U4ZA 4DAYB 3L7ZC 1V1QA 3L2PA 4JI3Q 3BJUA 1N33Q 1GVPA 1KIXA 3KLWA 3S1RH 4XIGS 3M4QA 3J80i 5ELNA 1FGUA 2UXCQ 2AWOA 1MJCA 4GN4B 2D62A 1NY4A 3CQZH 3U58A 4A3FH 3TS0A 2ZTEA 4UP9A 4P73A 5IYBH 4IJHA 4IPHA 1CKMA 1K0RA 4BBRG 1N9WA 1XPUA 4OONA 5GAEC 4GOPC 3NELA 3OW2A 4YY3Q 4GKJL 4OWWB 1PFSA 1SN8A 4DKAC 4LNQA 3KDFB 3M7NA 3TQYA 1UE1A 1DGSA 3AFPA 2I5MX 3EBEA 3WWVA 1HNZL 3HOZG 4DR4L 3HOXH 1CKNB 4A4IA 4IJLA 1N32L 3K0XA 1EFWA 1VQFA 5M3FG 4K0KL 2VQEQ 3CCJA 2KHJA 1EIYB 4NPSA 3RR5A 1LUZA 4X65Q 2ZJPA 1OTCA 4FDBA 2VL6A 3HOYG 4BY1H 3S1QH 4HIDA 2A8VA 3A0JA 1HNXL 4YWLA 5GQOA 1K83H 4AYBE 1UE6A 1QUQA 4JI7L 1SRUA 4JI8Q 1WCMG 3GO5A 3UE0A 3PUWA 3T1YQ 4A3MH 3PUZA 1CSPA 1PH2A 4A3JG 4LF9L 2R7ZG 4Y52H 4HIMA 4R1JA 4UP7A 3FHWA 2Z6KC 4J15A 3CPWA 4MTNA 3F2DA 1X6OA 4DV4L 3CCSA 2UUCL 1XTDA 3F1ZA 1VQ8A 2E5LQ 4GS3A 2E2HH 3H3VI 4A3GH 2F4VL 3UDIA 3H3VH 1N34Q 3DM3A 1TWGH 3K80C 3NEMA 3OYYA 4GNXC 1YHQA 1VCIA 2PI2E 3UDFA 3T1HL 2OTJA 4GOPA 4X66Q 4DK6C 5GAGC 2Q2IA 3ULPA 3HOUG 3F2CA 1Q1EA 2XGTA 3TREA 4A3IG 3TS2A 1TWCH 1UWVA 3K81C 2DUDA 1Y1WG 1Q7YC 1L0WA 4LUOA 2AKWB 2YTVA 2HQLA 3CAMA 4DV3Q 4DR1Q 1A62A 3M4PA 1VQMA 2FXQA 3ERSX 4AIMA 1Q86C 4NB3A 1VQ9A 3LGJA 2UXDQ 4IPDA 4JV5Q 5FLMG 3ULJA 3OTOQ 1SE8A 4C3HH 1BKBA 2K50A 4YCWA 1TWHH 3CCRA 1FJGL 4L5TA 1D8LA 2ZJRA 3NENA 4DV1Q 3GTOH 3I4NG 3E9IA 5C44H 1GM5A 5LMNW 2JEAI 3S17H 5H1SE 1PH7A 4LF7Q 2NZHA 4A3DH 1VQGA 1HJPA 3GTPH 2IY5B 5M5YH 1MIUA 4LW1A 5IP7H 5BR8L 2UU9Q 1YHBA 1VQ5A 2Z6KA 4LF6L 5C3EH 2JA5G 4MNOA 1H95A 4DUZQ 4LF5L 1I6HH 1HNWQ 4EX5A 2JA8G 5LMUQ 3CPFA 1BVSA 2KHIA 1TWAH 1XJVA 2R92H 4JYAQ 4B3RL 4WJ3M 1Q46A 4TQUS 3CCQA 1FVIA 4GNXA 1X3EA 2NVXH 4P75A 2YYZA 2I0QA 1OXTA 3I4MH 3K7AH 3ZJYC 5JJIA 1V43A 1U5KA 5M3MG 2Q2HA 4JI3L 3F2BA 2IHEA 1N33L 4R4OA 2CQOA 3IRBA 4C2MH 4A3KG 4B3SL 4GKKQ 2UXCL 1VQIA 1NTGA 4C3JH 2ZJQA 1GKHA 2LXKA 5AJ3Q 3W1GA 1X9NA 2HHHQ 2UXBL 3SGIA 2BA0A 3GTLH 1IZ6A 4HJ9A 1VQPA 4BXXG 1JJCB 1ASYA 1YNXA 1N8RC 3CC4A 2JEBI 4DR2L 4AQYQ 4KHPL 2E2IH 2NZOA 2JJQA 4ME3A 3RN2A 1VS0A 1S40A 2VS1A 1A63A 4UPAA 1TXYA 4P71A 1Y1VG 2KENA 1JB7A 2R7DA 2NVYH 4DR6L 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 G;  1CKO A;  1VQA A;  2B3G A;  3L0O A;  2PQA A;  3KF6 B;  4OWX B;  2BA1 A;  1G6P A;  3CP0 A;  1VQC A;  1WCM H;  3JAM i;  1G51 A;  5C4J H;  1J5E Q;  3HOV G;  1YVC A;  1XMQ Q;  5JJL A;  3W1B A;  1M1K C;  1IBM Q;  2UUA Q;  5C4X G;  1OXX K;  3CW2 C;  3CCM A;  4MZ9 A;  1R9T H;  4JI4 Q;  4A3C H;  2RCN A;  2R7F A;  3J7Z C;  4A3B G;  4H02 A;  2XTI A;  4GLA C;  1K3R A;  3F8T A;  4R4Q A;  2N8N A;  2WAQ E;  3MXN B;  5FJ8 H;  2DGY A;  4NXN Q;  4A3E G;  5IYD H;  4LF4 Q;  4LFA L;  5J3B A;  2CWA A;  4LF8 Q;  1LTL A;  5LMN Q;  4HJA A;  4AH6 A;  2WFW A;  4DV2 Q;  4DNI A;  3DLL A;  4IPC A;  4JV5 L;  1HZ9 A;  2VQF L;  4DV6 Q;  1I5F A;  4QL5 A;  3RLN A;  2ZTC A;  4QIW E;  3AEV A;  2CKZ B;  3GTQ H;  1XMO L;  1PH5 A;  1N34 L;  3PSI A;  2OQK A;  4R4I A;  4R4C A;  1VQ4 A;  1YIT A;  1YJ9 A;  2PMZ E;  2VUM H;  1UE7 A;  1PYS B;  3A5Z B;  4X66 L;  1E1O A;  3CME A;  2JA9 A;  5IP9 G;  1L1O C;  2VZA A;  4DV7 L;  3B6Y A;  4BBS G;  2OWO A;  1Q82 C;  4OO1 G;  1UE5 A;  1RIP A;  2UUB L;  1E3P A;  4HIK A;  1I50 H;  1OXU A;  4LUV A;  3TEH B;  1N36 L;  3PUV A;  1AE2 A;  3S2D H;  1C0A A;  1Q8K A;  1VQK A;  2JA6 G;  2L15 A;  4DR1 L;  2B63 G;  5E7N A;  2E2J H;  2YTX A;  1I94 Q;  1G29 1;  3S16 H;  2MQH A;  3M9B A;  1PH6 A;  3K8A A;  3U4V A;  4O0A A;  3OTO L;  3RZD H;  3CCL A;  1XNR Q;  4QQB X;  2JQO A;  3FKI H;  4DV0 L;  4DV1 L;  4IFD G;  4EQ5 A;  5M5X H;  4OX9 L;  3S2H H;  5IYC G;  1QZH A;  1Z47 A;  1EOV A;  2VY3 A;  3PIP A;  3PO3 G;  4RG1 A;  4LF7 L;  2R93 H;  1KXL A;  4LFC L;  5IT9 c;  4OWT B;  1VQJ A;  3J7A 5;  1JJG A;  1X55 A;  4DR3 L;  1B7Y B;  2N3S A;  2NN6 I;  1QZG A;  4NXM Q;  2UU9 L;  4BA2 I;  1KC8 C;  1E24 A;  2ZM6 Q;  1K9M C;  4LFB Q;  2HIV A;  1QVC A;  5DLQ E;  4GLV B;  2MO1 A;  4L5Q A;  1L2F A;  5LMU L;  4LUZ A;  4DUY L;  1XNQ Q;  4JYA L;  1VQ6 A;  5IE8 A;  2OTL A;  1KHI A;  4JBK A;  1SRO A;  4B3T Q;  1A8V A;  3BU2 A;  1L1O A;  1PH8 A;  1SR3 A;  3PF4 A;  3H0G H;  1C9O A;  5C0X I;  4L5S A;  2Q2T A;  4A75 A;  2YTY A;  2JK8 A;  1SFO H;  1X65 A;  3W5O A;  1JE5 A;  1YJW A;  1E7Z A;  4XTC S;  2ALY B;  3UDX A;  1EWI A;  1HR0 L;  3AQQ A;  4DV5 L;  4A93 H;  1K73 C;  3PO2 H;  4JI5 Q;  5EAY A;  3HOW H;  1NJI C;  4A3F G;  5JJK A;  2GVB A;  2QEX A;  4DR7 Q;  4X62 L;  2K4K A;  2RHS B;  5IYB G;  2HT1 A;  3D31 A;  2F3I A;  3GTJ H;  1Q1B A;  4JBJ A;  3ICE A;  3JC6 6;  3G4S A;  2Z0S A;  1WI5 A;  4YWM A;  4JI2 L;  2N49 A;  1N32 Q;  1KRT A;  3CCE A;  4K0K Q;  3J81 j;  3G71 A;  4X6A H;  3CF5 A;  1AE3 A;  4PZ8 A;  3CMA A;  3TRZ A;  1PHJ A;  2MFI A;  1XMQ L;  2UUA L;  1HNX Q;  3HOX G;  4QY7 A;  3GTG H;  2Y0S G;  5FLX c;  1P16 A;  4HJ5 A;  1QUQ B;  2QGQ A;  4JI4 L;  3I2Z A;  2PNH A;  4GN5 A;  1VQL A;  4JI7 Q;  4JBM A;  1P8L A;  3U50 C;  1HZA A;  1VQN A;  4L5R C;  4C3I H;  1V9P A;  4LF4 L;  4BBR H;  1VQ7 A;  1E1T A;  2VNU D;  3HKZ G;  1SMX A;  4R4T A;  4BY1 G;  3GDE A;  3BZC A;  1PH4 A;  4DV4 Q;  3FP9 A;  4BY7 G;  3JAM c;  4UY8 C;  2YV5 A;  4DV6 L;  5IP9 H;  3HOZ H;  4BBS H;  2EQS A;  4A3M G;  1VQO A;  1X54 A;  2K52 A;  4YCV A;  1PV4 A;  2E8G A;  3ER0 A;  3T1H Q;  1NMG A;  5M3F H;  4JI2 Q;  4GOP B;  4YY3 L;  1Z9F A;  4B3M Q;  4BA1 I;  3KDF A;  1VQB A;  3HOY H;  4PZ7 A;  4P74 A;  1PH1 A;  4IOA A;  2LSS A;  1W2B A;  1CKN A;  2IX1 A;  4JI1 Q;  2F52 A;  4KI0 A;  2RHQ B;  1KRS A;  1Q12 A;  4JG2 A;  4YHH Q;  4IOC A;  4JI6 Q;  4A3L G;  4IFD I;  2VQE L;  3CC7 A;  3KJO A;  1JMC A;  1T9H A;  4GN3 B;  4A3J H;  4X65 L;  2R7Z H;  2N78 A;  1BBU A;  3PO3 H;  4WJ4 A;  3I56 A;  1KD1 C;  4JI0 Q;  1I94 L;  1KL9 A;  3I7F A;  2WB1 E;  3STB D;  1EQQ A;  1IBL Q;  5ELO A;  1XNR L;  3E0E A;  3RZO H;  3A74 A;  2I5H A;  1VQE A;  2KCM A;  4JCV E;  4JI8 L;  3M3Y H;  2JA7 G;  3T1Y L;  1M90 C;  3VDY A;  4TVA B;  4A76 A;  5BR8 Q;  2KCT A;  4JBW A;  2JE6 I;  1A0I A;  2BH8 A;  1HZC A;  1EUJ A;  1CUK A;  4LF5 Q;  2E5L L;  5C44 G;  4NXM L;  3HOU H;  2IX0 A;  4A3I H;  2K75 A;  1QVF A;  1HH2 P;  1YBY A;  5C0X J;  5JEA J;  4A3D G;  1Y1W H;  1MKH A;  3CCU A;  4GNX B;  2CCZ A;  1BBW A;  2IT1 A;  4DAM A;  1SLJ A;  2C35 B;  5IP7 G;  2NVT H;  3A5U A;  2A19 A;  2GVA A;  5C3E G;  2CWP A;  4P72 A;  3ULL A;  5M5W H;  3G48 A;  5IWA Q;  3UE1 A;  4X64 Q;  5FLM H;  1IXR A;  4B3T L;  2R92 G;  4KLK A;  2K5H A;  4B3S Q;  3I4N H;  1IBK Q;  1PVO A;  4APV A;  4DV3 L;  3I4M G;  1S72 A;  2UXB Q;  2UXD L;  3PV0 A;  3NBH B;  4DR5 Q;  1ASZ A;  1U0L A;  3EIV A;  3E9H A;  4JOI C;  4DR2 Q;  2CFM A;  2ASB A;  2JA5 H;  3M4O H;  4KHP Q;  2A1A A;  2LXJ A;  2R6G A;  4JI5 L;  1PA6 A;  2JA8 H;  4DR7 L;  1I3Q H;  2NVQ H;  4DR6 Q;  2KBN A;  2VW9 A;  1PYB A;  4AYB G;  1W3S A;  2PQA B;  1YZ6 A;  3MEF A;  3PIO A;  4OXP A;  4PMW A;  1PH3 A;  5M3M H;  4DUZ L;  2IHF A;  1GD7 A;  1K8G A;  3UDG A;  4UP8 A;  4A3K H;  3KOJ A;  4BY7 H;  1O7I A;  4IPG A;  4JC0 A;  4O2D A;  3AYH B;  3M85 A;  4HJ8 A;  1VQH A;  4LFA Q;  4LWC A;  1TWF H;  1XPR A;  4BXX H;  3D0F A;  3CD6 A;  1JT8 A;  3KFU A;  2AMC B;  4A3C G;  3K7U C;  2OQ0 A;  2MNA A;  5HGQ A;  2VQF Q;  3EN2 A;  3S14 H;  4GKK L;  4Y7N H;  1MJE A;  2MO0 A;  3RLF A;  1HR0 W;  5AJ3 L;  1Y1V H;  5FJ8 G;  1S3O A;  3PCO B;  5IYD G;  2HHH L;  1XMO Q;  4GKJ Q;  1E22 A;  4IFD J;  1B70 B;  4A3L H;  4JOI A;  4AQY L;  4POG A;  2ZTD A;  5HY6 A;  1KAW A;  3RN5 A;  1HNZ Q;  3GTM H;  4B3M L;  4DV7 Q;  3HOV H;  3RLO A;  3Q8D A;  2I5L X;  5C4X H;  1LYL A;  2AHO B;  2UUB Q;  2H5X A;  2K5V A;  4GLX A;  4A3B H;  1HNW L;  1J6Q A;  5K36 G;  2WP8 J;  1N36 Q;  4JI1 L;  4YHH L;  3PGZ A;  2HIX A;  3KF6 A;  1OXS C;  2RF4 A;  3AFQ A;  3J81 c;  4JI6 L;  2VUM G;  4A3E H;  2D0P A;  2QA4 A;  1J5E L;  1X56 A;  3KF8 B;  1YI2 A;  1IBM L;  3CXC A;  1WYD A;  2EIF A;  4JI0 L;  3S15 H;  3HFZ B;  1IBL L;  1Q81 C;  4DV0 Q;  4RMF A;  1FL0 A;  4IO9 A;  3KYH C;  2ATW A;  2GN5 A;  1VQD A;  5GRO A;  3H15 A;  4OX9 Q;  4NXN L;  4LF9 Q;  2OCE A;  2ES2 A;  2V1C C;  4LFC Q;  4ALP A;  3BZK A;  4LF8 L;  5LMN L;  1AH9 A;  4KHZ A;  1FJG Q;  3STB C;  4DR4 Q;  2UUC Q;  2Y0S E;  4DR3 Q;  4PG3 A;  1IL2 A;  4DV2 L;  1YIJ A;  2JA7 H;  3J81 i;  2Q2U A;  3FKI G;  3GD7 A;  2F4V Q;  4OO1 I;  4HIO A;  4PZ6 A;  4HJ7 A;  3I4O A;  1YJN A;  2R93 G;  1X3G A;  1X3F A;  4DUY Q;  1NE3 A;  1PH9 A;  3HKZ E;  1HZB A;  1CSQ A;  1UEB A;  4QGU A;  3KJP A;  2YU9 H;  2NN6 G;  2JA6 H;  1C7Y A;  2B63 H;  3PUX A;  1L1O B;  1B8A A;  4A3G G;  2B29 A;  1RL2 A;  1WOC A;  5IWA L;  4X64 L;  1EQR A;  1D7Q A;  1WJJ A;  1LM0 A;  1EIF A;  1IBK L;  2K5N A;  5IYC H;  3GTK H;  1Y14 B;  5IY0 A;  2PI2 A;  5GAH C;  3S24 A;  3RNU A;  4DK3 C;  3G6E A;  4DR5 L;  1JJ2 A;  3H0G G;  4POF A;  2EXD A;  3I55 A;  1IYJ B;  4DV5 Q;  1HR0 Q;  3CC2 A;  4QJF A;  4YCU A;  2ID0 A;  1XPO A;  5C0X G;  5JEA G;  4YWK A;  2AWN A;  1OXV A;  1WFQ A;  4X62 Q;  1KQS A;  1GO3 E;  1YEZ A;  2D0O A;  2BH2 A;  3PUY A;  2K14 A;  5GAD C;  3J80 c;  4DPG A;  4LF6 Q;  4A93 G;  1NMF A;  3PO2 G;  2WAQ G;  3HOW G;  3S1M H;  3CCV A;  1K8A C;  1QVG A;  2ZM6 L;  4B3R Q;  4LFB L;  1YHA A;  3S1N H;  1EYG A;  1XNQ L;  3HKS A;  3PF5 A;  3U4Z A;  4DAY B;  3L7Z C;  1V1Q A;  3L2P A;  4JI3 Q;  3BJU A;  1N33 Q;  1GVP A;  1KIX A;  3KLW A;  3S1R H;  4XIG S;  3M4Q A;  3J80 i;  5ELN A;  1FGU A;  2UXC Q;  2AWO A;  1MJC A;  4GN4 B;  2D62 A;  1NY4 A;  3CQZ H;  3U58 A;  4A3F H;  3TS0 A;  2ZTE A;  4UP9 A;  4P73 A;  5IYB H;  4IJH A;  4IPH A;  1CKM A;  1K0R A;  4BBR G;  1N9W A;  1XPU A;  4OON A;  5GAE C;  4GOP C;  3NEL A;  3OW2 A;  4YY3 Q;  4GKJ L;  4OWW B;  1PFS A;  1SN8 A;  4DKA C;  4LNQ A;  3KDF B;  3M7N A;  3TQY A;  1UE1 A;  1DGS A;  3AFP A;  2I5M X;  3EBE A;  3WWV A;  1HNZ L;  3HOZ G;  4DR4 L;  3HOX H;  1CKN B;  4A4I A;  4IJL A;  1N32 L;  3K0X A;  1EFW A;  1VQF A;  5M3F G;  4K0K L;  2VQE Q;  3CCJ A;  2KHJ A;  1EIY B;  4NPS A;  3RR5 A;  1LUZ A;  4X65 Q;  2ZJP A;  1OTC A;  4FDB A;  2VL6 A;  3HOY G;  4BY1 H;  3S1Q H;  4HID A;  2A8V A;  3A0J A;  1HNX L;  4YWL A;  5GQO A;  1K83 H;  4AYB E;  1UE6 A;  1QUQ A;  4JI7 L;  1SRU A;  4JI8 Q;  1WCM G;  3GO5 A;  3UE0 A;  3PUW A;  3T1Y Q;  4A3M H;  3PUZ A;  1CSP A;  1PH2 A;  4A3J G;  4LF9 L;  2R7Z G;  4Y52 H;  4HIM A;  4R1J A;  4UP7 A;  3FHW A;  2Z6K C;  4J15 A;  3CPW A;  4MTN A;  3F2D A;  1X6O A;  4DV4 L;  3CCS A;  2UUC L;  1XTD A;  3F1Z A;  1VQ8 A;  2E5L Q;  4GS3 A;  2E2H H;  3H3V I;  4A3G H;  2F4V L;  3UDI A;  3H3V H;  1N34 Q;  3DM3 A;  1TWG H;  3K80 C;  3NEM A;  3OYY A;  4GNX C;  1YHQ A;  1VCI A;  2PI2 E;  3UDF A;  3T1H L;  2OTJ A;  4GOP A;  4X66 Q;  4DK6 C;  5GAG C;  2Q2I A;  3ULP A;  3HOU G;  3F2C A;  1Q1E A;  2XGT A;  3TRE A;  4A3I G;  3TS2 A;  1TWC H;  1UWV A;  3K81 C;  2DUD A;  1Y1W G;  1Q7Y C;  1L0W A;  4LUO A;  2AKW B;  2YTV A;  2HQL A;  3CAM A;  4DV3 Q;  4DR1 Q;  1A62 A;  3M4P A;  1VQM A;  2FXQ A;  3ERS X;  4AIM A;  1Q86 C;  4NB3 A;  1VQ9 A;  3LGJ A;  2UXD Q;  4IPD A;  4JV5 Q;  5FLM G;  3ULJ A;  3OTO Q;  1SE8 A;  4C3H H;  1BKB A;  2K50 A;  4YCW A;  1TWH H;  3CCR A;  1FJG L;  4L5T A;  1D8L A;  2ZJR A;  3NEN A;  4DV1 Q;  3GTO H;  3I4N G;  3E9I A;  5C44 H;  1GM5 A;  5LMN W;  2JEA I;  3S17 H;  5H1S E;  1PH7 A;  4LF7 Q;  2NZH A;  4A3D H;  1VQG A;  1HJP A;  3GTP H;  2IY5 B;  5M5Y H;  1MIU A;  4LW1 A;  5IP7 H;  5BR8 L;  2UU9 Q;  1YHB A;  1VQ5 A;  2Z6K A;  4LF6 L;  5C3E H;  2JA5 G;  4MNO A;  1H95 A;  4DUZ Q;  4LF5 L;  1I6H H;  1HNW Q;  4EX5 A;  2JA8 G;  5LMU Q;  3CPF A;  1BVS A;  2KHI A;  1TWA H;  1XJV A;  2R92 H;  4JYA Q;  4B3R L;  4WJ3 M;  1Q46 A;  4TQU S;  3CCQ A;  1FVI A;  4GNX A;  1X3E A;  2NVX H;  4P75 A;  2YYZ A;  2I0Q A;  1OXT A;  3I4M H;  3K7A H;  3ZJY C;  5JJI A;  1V43 A;  1U5K A;  5M3M G;  2Q2H A;  4JI3 L;  3F2B A;  2IHE A;  1N33 L;  4R4O A;  2CQO A;  3IRB A;  4C2M H;  4A3K G;  4B3S L;  4GKK Q;  2UXC L;  1VQI A;  1NTG A;  4C3J H;  2ZJQ A;  1GKH A;  2LXK A;  5AJ3 Q;  3W1G A;  1X9N A;  2HHH Q;  2UXB L;  3SGI A;  2BA0 A;  3GTL H;  1IZ6 A;  4HJ9 A;  1VQP A;  4BXX G;  1JJC B;  1ASY A;  1YNX A;  1N8R C;  3CC4 A;  2JEB I;  4DR2 L;  4AQY Q;  4KHP L;  2E2I H;  2NZO A;  2JJQ A;  4ME3 A;  3RN2 A;  1VS0 A;  1S40 A;  2VS1 A;  1A63 A;  4UPA A;  1TXY A;  4P71 A;  1Y1V G;  2KEN A;  1JB7 A;  2R7D A;  2NVY H;  4DR6 L;  1NBW A; 
#chains in the Genus database with same CATH topology
 2PQA A;  2PCF B;  1OO9 B;  1PZI D;  3KF6 B;  5C3E B;  1WCM H;  1J5E Q;  5C4J H;  1SMY D;  3HOV G;  2DNE A;  1WD1 A;  2R92 B;  5C4X G;  1SBB B;  5CR3 A;  4JI4 Q;  4A3B G;  3UI2 A;  2XTI A;  3T4A C;  1A3U A;  1NR4 A;  4R4Q A;  4A3E G;  4LF4 Q;  4LFA L;  5J3B A;  1LTL A;  5LMN Q;  5I6Y A;  4LK1 C;  1D5X C;  4AH6 A;  3DLL A;  4DV6 Q;  1Z6H A;  2CKZ B;  5K36 H;  4F87 A;  1RF2 D;  1B4O A;  1YJ9 A;  3CU7 A;  2VUM H;  2NBF A;  1KNA A;  3NXW A;  3A5Z B;  1BOS A;  1E1O A;  1FNW A;  3FVQ A;  4BBS G;  5JJZ A;  4DV7 L;  1G2T A;  1EYC A;  1RIP A;  4F8M A;  4HIK A;  3AB9 A;  1H9S A;  4LUV A;  1C0A A;  4CDF C;  1VQK A;  2JA6 G;  4X3U A;  2TMP A;  2YTX A;  3KF8 A;  4FXG C;  5CGK A;  1I94 Q;  1T5X D;  3R2T A;  2KA7 A;  4K5X A;  3RZD H;  4IFD G;  5ELC A;  3DEP A;  1Z47 A;  3P75 A;  3PIP A;  4FF4 A;  3NWS A;  4LF7 L;  4LFC L;  2AQ1 B;  3J7A 5;  2P5Z X;  3OMG A;  3C1E A;  3PMF A;  1KC8 C;  4K2K A;  4LFB Q;  2SNM A;  5DLQ E;  4CDE C;  1CK1 A;  2SOB A;  1VQ6 A;  4DAV A;  2B39 A;  2XSC A;  1SRO A;  1A8V A;  4M1U B;  1HXY D;  1J8I A;  1B1Z A;  5K5P A;  2A6E D;  3F2U A;  1M4V A;  4DFA A;  2SDF A;  1PTO B;  1YJW A;  1EWI A;  3OHX C;  4JI5 Q;  1SNP A;  2D2C C;  1QWY A;  2QEX A;  4DR7 Q;  3S2H B;  4HSV A;  2K4K A;  2F0J A;  2F3I A;  2N49 A;  4B9X A;  4LAA A;  4X6A H;  3CF5 A;  3BVM A;  4TKO B;  1AE3 A;  4PZ8 A;  4A3G B;  4ZYS A;  2XWB B;  5IIF A;  4EVO A;  1HNX Q;  4QY7 A;  2RDF A;  3A8K E;  4JI4 L;  1WTX A;  1B3Q A;  4NMZ A;  3I2Z A;  1K3B C;  1P8L A;  2A69 D;  1SMY C;  4C3I H;  3R93 A;  4LF4 L;  4BBR H;  1VQ7 A;  2KHS A;  1PH4 A;  4M8A A;  3FP9 A;  3NQI A;  4F88 A;  4UY8 C;  4DV6 L;  1VQO A;  4YCV A;  1ICW A;  3ZYY X;  4YY3 L;  4R8N A;  4B3M Q;  3HOY H;  2FIN B;  4KMU C;  1SNM A;  4RAU C;  4JI1 Q;  2F52 A;  4QF4 A;  2RHQ B;  1KRS A;  1WTP A;  3DMU A;  4RGN A;  1WTR A;  1AEX A;  4OEM B;  1FNV A;  2DJF C;  4GN3 B;  4A3J H;  2N78 A;  1BBU A;  1I94 L;  3I7F A;  5T1I A;  3VA7 A;  4JCV E;  2RDH A;  2NB0 A;  3VDY A;  4U68 A;  4XYO A;  4JBW A;  2CW0 D;  1PZK D;  1EUJ A;  1CUK A;  3HOZ B;  4BBS B;  2IX0 A;  4A3I H;  2K75 A;  1QVF A;  2AUJ D;  5JEA J;  1E2Z A;  3SHL A;  3VR2 A;  1XYI A;  1BBW A;  3NP8 A;  3NPP A;  2C35 B;  3A5U A;  2A19 A;  4P72 A;  5M5W H;  5IWA Q;  3QR8 A;  1U4R A;  3UE1 A;  5KEE A;  4KLK A;  3I73 A;  4B3S Q;  2MPM A;  4APV A;  1PVO A;  2ICI A;  1S72 A;  3K5N A;  2UXD L;  1TY2 A;  3PV0 A;  3E6Z X;  5IGG A;  2RSN A;  2CFM A;  2ASB A;  2XVS A;  4JI5 L;  4DR7 L;  4IUV A;  3SXH A;  3ND8 A;  1HFN A;  2QF7 A;  4N8F A;  4AYB G;  1W3S A;  1V8Q A;  3PIO A;  3KBX A;  1LAB A;  2WIN B;  5M3M H;  3D4R A;  2G5D A;  2KCN A;  3I3C A;  3UDG A;  1Y1W B;  4UP8 A;  1UEA B;  3KOJ A;  3MZ5 A;  2EDG A;  3K5O A;  4HJ8 A;  1D1I A;  4K8I A;  1VQH A;  1XPR A;  2EY2 A;  4LWC A;  4BXX H;  1HTL D;  4DU9 A;  5I4D A;  3KFU A;  3I70 A;  3VYS A;  2F3W A;  3QG1 A;  1Y1V H;  5IYD G;  2E2J B;  2HHH L;  3PQI A;  4I7Z C;  1TT2 A;  4A3L H;  2JA5 B;  2M2L A;  2MUY A;  3FPP A;  4JOI A;  4AQY L;  2A6H C;  2HDM A;  3MXG A;  4RKL A;  3HOV H;  2JA8 B;  4B3M L;  1GJX A;  5C4X H;  1DM0 B;  2UUB Q;  1KDA A;  2H5X A;  4GLX A;  4A3B H;  1J6Q A;  2WP8 J;  4CDC C;  1N36 Q;  4JI1 L;  4KHV A;  2JXM B;  3DUZ A;  2RF4 A;  3AFQ A;  4A3E H;  3OWE B;  2D0P A;  1S5D D;  3ERO A;  1SND A;  1K8M A;  4FXD A;  4NXN L;  2OCE A;  1TWF B;  2NTT A;  4V0B A;  3K59 A;  2V1C C;  2ES2 A;  3BZK A;  2A5H A;  2HDL A;  1FJG Q;  4DR4 Q;  1JCK B;  1EL0 A;  2WV6 D;  2ZXO A;  4PZ6 A;  4HJ7 A;  2R93 G;  1X3G A;  4DUY Q;  1NE3 A;  1PH9 A;  3KJP A;  1CTM A;  2NN6 G;  2JA6 H;  1C7Y A;  4HCE A;  4JK1 C;  1L1O B;  4CKE A;  3DEO A;  3OW7 A;  5IWA L;  1EQR A;  1S5F D;  1D6E C;  1EZ8 A;  1EU3 A;  4IFD H;  3NTK A;  1IHZ A;  1EIF A;  2B2W C;  4S3S A;  1Y14 B;  1GUN A;  4IAL A;  3S24 A;  3IKJ A;  1HR0 Q;  3H0G G;  4POF A;  3WOF A;  2F0I A;  5C0X G;  2C5C A;  1WFQ A;  2EPB A;  3FEW X;  1YEZ A;  1LTG D;  3HP3 A;  5GAD C;  4UAI A;  3MA2 B;  2F0F A;  4K5V A;  2K01 A;  2L12 A;  3GV3 A;  2WAQ G;  5I9P A;  3PO2 G;  3CCV A;  1K8A C;  4XT1 B;  5FOB B;  5E4W C;  1TR5 A;  3K5M A;  3HKS A;  5I9O A;  4DAY B;  4ZLT F;  5FLX L;  3T13 A;  2B63 B;  1EIH A;  3S1R H;  3J80 i;  2LKV A;  2MP1 A;  4R9W A;  2UXC Q;  2AWO A;  1LT6 D;  1NY4 A;  2F0E A;  4P73 A;  3Q0A A;  3PO3 B;  3TBI B;  2J4X A;  1CKM A;  1K0R A;  2SEB D;  3NEL A;  3RZO B;  4DN4 M;  1PFS A;  1SN8 A;  1TII D;  1SE2 A;  4DKA C;  5JPN C;  3KDF B;  1UE1 A;  3KUP A;  1CHP D;  1F9Q A;  3EFX D;  3QJY A;  3K0X A;  5M3F G;  1SYE A;  3CCJ A;  3S1M B;  3QO2 A;  1EIY B;  2ZJP A;  1OTC A;  3D8G A;  4FDB A;  2VL6 A;  4IN3 A;  1ONL A;  3MFG A;  1TY0 A;  4AYB E;  1QUQ A;  4JI7 L;  1SRU A;  2EYJ A;  1WCM G;  3GO5 A;  1U4L A;  1PH2 A;  3P1H A;  2B2Y C;  1GUT A;  4JV5 Q;  4DV4 L;  1FJG L;  4DR4 L;  2WKD A;  2ZXR A;  3F1Z A;  5FO8 B;  3DM3 A;  1TWG H;  3K80 C;  4KD4 A;  5EQ0 A;  2XRS D;  2OTJ A;  4GOP A;  2DJG C;  4DK6 C;  1VF7 A;  2AQ2 B;  3F2C A;  1XTC D;  3J7A V;  3K81 C;  1HQR D;  2EYM A;  5EBC A;  2F0P A;  2YTV A;  4DV3 Q;  2Z6B A;  4KJO A;  5TSS A;  4DR1 Q;  1VQM A;  2RDG A;  1Q86 C;  4NB3 A;  1SNC A;  3LGJ A;  1UAP A;  3HKZ B;  4BY1 B;  3KLS X;  3MXU A;  3CCR A;  1D8L A;  2ZJR A;  3NEN A;  5CMD A;  3GTP H;  3H6M A;  1YHB A;  1VQ5 A;  2PZU A;  2Z6K A;  5JVG 3;  4MNO A;  4DUZ Q;  4LF5 L;  5I2X A;  1I6H H;  4IUR A;  1W6K A;  4EX5 A;  1BVS A;  1TWA H;  4JYA Q;  4TQU S;  4GNX A;  1FVI A;  1V1P A;  1STE A;  2I0Q A;  2MJ8 A;  5C4Z A;  3URY A;  1TWC B;  2UXC L;  1CA5 A;  4C3J H;  2SNS A;  4CKC A;  2QEJ C;  1ASY A;  4L8J A;  3CC4 A;  4KHP L;  4KKS A;  2E2I H;  2NZO A;  5C44 B;  4ME3 A;  1VS0 A;  3S17 B;  4NW2 A;  4UPA A;  4Y7N H;  2R7D A;  3GTK H;  2WB1 G;  1PRT D;  1B3A A;  3L0O A;  3G6J B;  4FYD A;  1G51 A;  1PZJ D;  1EYA A;  1F77 A;  1YVC A;  1XMQ Q;  1IBM Q;  1C4Q A;  1OXX K;  2RCN A;  3J7Z C;  1K8O A;  4GLA C;  2BE5 D;  3F8T A;  1SDF A;  1GUG A;  2WKC A;  3I4M B;  2WAQ E;  3MXN B;  5IYD H;  4PV1 C;  4HJA A;  1TS4 A;  4K8J A;  4IPC A;  2EJM A;  3T16 A;  4JV5 L;  1I5F A;  4QL5 A;  3RLN A;  1DXM A;  4C3I G;  4EGV A;  3GTL B;  3GTQ H;  4FF1 A;  5KYI A;  4R4I A;  1CQV A;  4R4C A;  1VQ4 A;  4GZY C;  2PW5 A;  3MEH A;  2B2U A;  2PMZ E;  3CME A;  1A3T A;  4DK1 A;  3B6Y A;  3QWN A;  2OWO A;  2NVY B;  1UE5 A;  1E3P A;  1I50 H;  2K32 A;  3Q6S A;  3PUV A;  1AE2 A;  1WCM B;  5C4J B;  1Q8K A;  4DR1 L;  4O42 A;  2L5T A;  2MQH A;  1PH6 A;  4O0A A;  2K5W A;  1K0S A;  3CCL A;  1C48 A;  4DV0 L;  5KRU A;  5M5X H;  3NHH A;  4OX9 L;  5IYC G;  1EIG A;  2V4D A;  2R93 H;  1KXL A;  4RG1 A;  5COR A;  3CKI B;  3VA5 A;  3SEB A;  5IOD A;  2NN6 I;  2NN6 H;  2ZM6 Q;  1QOH A;  2HIV A;  1QVC A;  1SYF A;  1JE4 A;  4J8Q A;  4JYA L;  2VUM B;  3QIA A;  2OTL A;  4OIK A;  2WII B;  4N9T A;  2D9U A;  1PH8 A;  3PF4 A;  3H0G H;  2QKI C;  5C0X I;  1SE3 A;  5C0X H;  1K28 A;  2DN8 A;  1X65 A;  1D5M C;  1DD2 A;  1F2M A;  1CZW A;  2FJ2 A;  4XTC S;  3RZD B;  3RMH A;  3AQQ A;  3C46 A;  1E2W A;  5IOC A;  4DV5 L;  2OXP A;  3QB3 A;  3PO2 H;  1JQY D;  1GUW A;  4QMG A;  4X62 L;  1PFN A;  2RHS B;  4KJN A;  2F0K A;  2HT1 A;  3D31 A;  3GTJ H;  1Q1B A;  4JBJ A;  3V2T A;  5A2Q L;  3ICE A;  4YWM A;  4ZKB B;  3CCE A;  4K0K Q;  1JC7 A;  2ICE C;  2PZT A;  3J81 j;  3CMA A;  3TRZ A;  5IGF A;  3J7A F;  1XMQ L;  1S5E D;  3ERQ A;  1ZKO A;  3KLS A;  3HOX G;  1PRT C;  3LNN A;  5FLX c;  1P16 A;  2PNH A;  3A8J E;  3GV6 A;  1VQN A;  3HEJ A;  4L5R C;  1BCP D;  2VNU D;  2CVR A;  4C1N K;  2BE5 C;  2K33 A;  5EPK A;  2YV5 A;  1SNQ A;  3C3L A;  1PV4 A;  1EY8 A;  1B44 D;  5M3F H;  1EZ6 A;  2EY5 A;  1VQB A;  1RTO A;  3FDT A;  4P74 A;  2LSS A;  3QOL A;  1W2B A;  1CKN A;  2IX1 A;  4OGQ C;  4A3L G;  5M9O A;  2VQE L;  3QOJ A;  3KJO A;  5FLX E;  1T9H A;  4X65 L;  1PTO C;  3I56 A;  5KND A;  1KD1 C;  1PRT F;  4JI0 Q;  4X3S A;  3IAY A;  1KL9 A;  2WB1 E;  1IBL Q;  2EYF A;  3D4W A;  5ELO A;  4IUQ A;  2N55 A;  3E0E A;  5ELF A;  4JI8 L;  2OT2 A;  4HAE A;  3T1Y L;  4BBR B;  2F0T A;  4B08 A;  1BO0 A;  3ONA B;  2MGS A;  5BR8 Q;  3U9S A;  2B2V A;  2OEO A;  4N9P A;  1A0I A;  2BH8 A;  3V05 A;  2E5L L;  5KNB A;  4A3D G;  1YBY A;  4Z9C B;  4K6D A;  4UHV A;  4DA2 A;  2CCZ A;  2RCF A;  5IP7 G;  4DAM A;  2GVA A;  3NK9 A;  3HOY B;  3G48 A;  1MHW C;  4X64 Q;  1M8A A;  4E6I A;  2K5H A;  3IFT A;  4G57 A;  2K03 A;  3SK5 A;  3HRZ C;  4A3J B;  3D6W A;  1R9T B;  4DR5 Q;  4HED A;  4QB4 A;  1ENF A;  1EY9 A;  4JOI C;  1WTO A;  4FO2 A;  1ET9 A;  2A1A A;  5CBE E;  4H0L C;  1L0Y B;  1BDO A;  3TN2 A;  2KBN A;  1DOL A;  2KOL A;  2NTS A;  3NSW A;  1A2U A;  1YZ6 A;  3MEF A;  4OXP A;  1PH3 A;  1HRJ A;  4A3I B;  2F0Q A;  1R4Q B;  2K7V A;  2OF1 A;  4WJW A;  2VXW A;  4IPG A;  4BY7 H;  4JC0 A;  1TS3 A;  4O2D A;  3M85 A;  5M5W B;  2CH4 A;  3CD6 A;  1BF4 A;  2PQE A;  3K7U C;  3S2D B;  5ELE A;  5BN4 A;  5HGQ A;  2LS0 1;  2MNA A;  2VQF Q;  3S14 H;  3S9W A;  3RLF A;  2PW7 A;  5AJ3 L;  5FJ8 G;  1BCP C;  2EYH A;  1XMO Q;  2XWJ B;  4GKJ Q;  4IFD J;  3EQL C;  2JSO A;  1KAW A;  5C6A A;  1A6X A;  3RLO A;  3HZX A;  2I5L X;  1LYL A;  2AHO B;  4BS9 A;  2K5V A;  3D3R A;  2KCC A;  1NCV A;  2K28 A;  1F2L A;  1U4M A;  1OXS C;  3KF6 A;  3J81 c;  5M3M B;  2LFN A;  2QA4 A;  1J5E L;  1YI2 A;  5G3L D;  1WYD A;  3CRL C;  5IGB A;  2EIF A;  4JI0 L;  1LTS D;  1IBL L;  1MSH A;  1VQD A;  1PFM A;  5GRO A;  1SE4 A;  4LF9 Q;  4ZKC B;  5LMN L;  1AH9 A;  4KKT A;  4DR3 Q;  4PG3 A;  2J7Z A;  2A6H D;  4WFN 3;  2BDO A;  2Q2U A;  3FKI G;  1Y1V B;  5DM7 3;  1BCP F;  1ML0 D;  1NR2 A;  3SR1 A;  2F0W A;  1HZB A;  1CSQ A;  1TKW B;  3SVM A;  3MTS A;  1EY6 A;  3HOV B;  3BYY B;  2YU9 H;  4K6L A;  1J9O A;  5C4X B;  3VYU A;  1B8A A;  1RL2 A;  1WOC A;  4A3B B;  1JR0 D;  2F0M A;  3RD4 A;  2NZ1 D;  4X64 L;  3O13 A;  1LM0 A;  2K5N A;  4A3E B;  5IYC H;  2LMC B;  2PI2 A;  1WVL A;  3RNU A;  1MBY A;  2L9H A;  3ND9 A;  4DK3 C;  4RWS C;  4DR5 L;  1MGS A;  1RCV D;  4YCU A;  4PMB A;  5JEA G;  2AWN A;  1I4P A;  4XT3 B;  1KQS A;  2QW7 A;  3CHB D;  4LJZ C;  2BOS A;  4A93 G;  3HOW G;  1EQV A;  4B3R Q;  1LTA D;  1YHA A;  4X3K A;  4LFB L;  3S1N H;  1X32 A;  3U4Z A;  1V1Q A;  3L2P A;  2JA6 B;  5EBD A;  2JP1 A;  1DZ1 A;  1EY5 A;  1LO5 D;  3M4Q A;  5ELN A;  1MJC A;  4GN4 B;  2XNA C;  4UP9 A;  3I72 A;  4FF2 A;  1STA A;  2AUK A;  1N9W A;  4GOP C;  3OW2 A;  2QDB A;  1HA5 A;  4GKJ L;  1Y8P B;  4OWW B;  1JOK A;  4C3J G;  3M7N A;  1DGS A;  3AFP A;  3FMC A;  2MHV A;  1GUO A;  3WWV A;  3HOX H;  2KEC A;  3DXJ C;  4A4I A;  3OMC A;  1F9R A;  1QNK A;  2M9V A;  3TP6 A;  2KEE A;  1LUZ A;  5C3W A;  3S1Q H;  4HID A;  2QCP X;  3A0J A;  1HNX L;  1A2T A;  5F2D A;  3MC0 B;  5GQO A;  1EYD A;  4MIU A;  1JWU D;  4DNR B;  1I4G A;  2O5I C;  3PUZ A;  1EY7 A;  4LF9 L;  2R7Z G;  3S1R B;  1QE6 A;  3E5S A;  1KDC A;  2Z6K C;  4J15 A;  3CCS A;  4HN7 A;  4HMJ A;  3BYT B;  1EU4 A;  4GS3 A;  4A3G H;  3UDI A;  5A2Q E;  4GNX C;  1QIL A;  1SJH D;  3D6C A;  3A55 A;  3ULP A;  3HOU G;  2NVQ B;  2Q8I B;  3DHQ A;  1UWV A;  2DUD A;  1UUP A;  2WAC A;  3P7J A;  2AKW B;  1L0W A;  2HQL A;  3CAM A;  1IKL A;  2KED A;  3M4P A;  5JJI A;  1VQ9 A;  1RJT A;  4AIM A;  2L1B A;  1BKB A;  4YCW A;  4L5T A;  4DV1 Q;  3GTO H;  3I4N G;  3E9I A;  4RCO A;  4RHS A;  5LMN W;  2FHT A;  2NZH A;  5G3L F;  4A3D H;  4C1N I;  3KK7 A;  1HJP A;  4WOR A;  2IY5 B;  5M5Y H;  1MIU A;  4Q0F A;  5IP7 H;  1GHK A;  2UU9 Q;  1IYU A;  4MN3 A;  1AN8 A;  1TWG B;  2KHI A;  4B3R L;  4WJ3 M;  1ICF B;  1Q46 A;  2NVX H;  3EJI A;  2VB2 X;  1V1O A;  5EGT A;  4X3T A;  1OXT A;  2ENB A;  3K7A H;  1V43 A;  2Q2H A;  3OPO A;  1EWC A;  4XQQ A;  2RA4 A;  2Z9H A;  4C2M H;  4A3K G;  4B3S L;  2RSO A;  4GKK Q;  4IQZ A;  1VQI A;  3MAQ A;  1HA6 A;  3SGI A;  1B53 A;  1VQP A;  2KQ3 A;  1VMP A;  2ZT9 C;  2B2U C;  4EQO A;  4R8I A;  5KNC A;  3RN2 A;  2JJQ A;  2F1M A;  4G7O C;  1A63 A;  1STN A;  1LT5 D;  1KTK A;  4JI2 Q;  4DNI A;  5HUR A;  1JB7 A;  3GTP B;  1HNW Q;  1STB A;  1VQA A;  1QG7 A;  4H44 C;  2BA1 A;  1DOK A;  3CP0 A;  1VQC A;  4C56 C;  4EQN A;  1S4Z A;  1I6H B;  5C5L A;  1FGB D;  5FKA C;  3W1B A;  3SK6 A;  3K58 A;  1M1K C;  2UUA Q;  1SYB A;  1TWA B;  2KUM A;  3CW2 C;  4MZ9 A;  3H94 A;  3C1F A;  4H02 A;  5NUC A;  1K3R A;  1S5B D;  3N52 A;  5FJ8 H;  1CZG A;  3X3N A;  4LF8 Q;  1CT1 D;  3R8B A;  5E1F A;  2RQX A;  4DV2 Q;  3IL8 A;  1NUC A;  2ZTC A;  2RVL A;  4TSS A;  1QJO A;  4QIW E;  1EY0 A;  4AYB B;  1PH5 A;  1Y8N B;  1STH A;  2E2I B;  1PYS B;  2JA9 A;  5EPL A;  4Y7N B;  4OO1 G;  5EPJ A;  3GTK B;  2UUB L;  2I46 A;  4ULL A;  3SK4 A;  1N36 L;  1ESR A;  1VMC A;  5DEH A;  2E2J H;  3S16 H;  3M9B A;  3MXP A;  3K8A A;  3TP8 A;  4RCN A;  1QNU A;  2F3V A;  1XNR Q;  1U9R A;  4FP5 D;  3FKI H;  4HMI A;  4DV1 L;  4EQ5 A;  3E3X A;  3AMU A;  4OWT B;  1VQJ A;  4DF7 A;  1JJG A;  1X55 A;  2N3S A;  1Y8O B;  1QZG A;  4NXM Q;  2UU9 L;  4JVZ A;  1Q3L A;  4RGT A;  1K9M C;  2F0O A;  5IGE A;  3GTQ B;  2MO1 A;  3I91 A;  4DUY L;  3TSS A;  1XNQ Q;  1QB5 D;  5IE8 A;  1LLR D;  5DM6 3;  4B3T Q;  1PDQ A;  1L1O A;  1SR3 A;  4DGZ A;  4RHR A;  1C9O A;  3NBI A;  3NWT A;  1I50 B;  1DYQ A;  4L5S A;  5JOB A;  2Q2T A;  5JEA H;  4A75 A;  2JK8 A;  1SFO H;  3E0J A;  1JE5 A;  1GHJ A;  1E7Z A;  2L55 A;  1HR0 L;  4A93 H;  4ZUI A;  5EAY A;  3HOW H;  1NJI C;  4A3F G;  5JJK A;  3EVQ A;  5M5X B;  3A8I E;  3L9A X;  1DOM A;  3G7L A;  5IYB G;  1HUM A;  2R93 B;  1RHP A;  1A15 A;  4H13 C;  1WI5 A;  1JOO A;  4JI2 L;  1N32 Q;  1KRT A;  2Z4H A;  3G71 A;  2EYP A;  4XXE A;  2MFI A;  3EA6 A;  4QUC A;  1NSN S;  3FPU B;  2UUA L;  3GTG H;  2Z8L A;  2Y0S G;  4HJ5 A;  5COY A;  4GN5 A;  4DAY A;  2PNR C;  5FK9 C;  4JBM A;  1V9P A;  1BBX C;  2EZV A;  3H0G B;  2HCC A;  2CQA A;  1SMX A;  4R4T A;  2B2V C;  3GDE A;  4CGY B;  4BY7 G;  2HCI A;  4ZCK A;  5IP9 H;  4FVM A;  2EQS A;  1O7Z A;  4A3M G;  2NYZ D;  1F9P A;  2IX3 A;  1I4X A;  1NMG A;  4O1N A;  3T1H Q;  3PO2 B;  2WAQ B;  3PIP 3;  1Z9F A;  2F0L A;  2E74 C;  2NUC A;  3MFY A;  3KDF A;  1GOZ A;  4IOA A;  3GTJ B;  1G2S A;  4KI0 A;  3TP5 A;  4YHH Q;  4IOC A;  2EE1 A;  5I6W A;  1JMC A;  3J81 L;  2R7Z H;  4WJ4 A;  3PO3 H;  2PMZ B;  3STB D;  1I4Q A;  1XNR L;  3RZO H;  3A74 A;  2KCM A;  3M3Y H;  1CI3 M;  4KY6 A;  1M90 C;  2JA7 G;  4RKB A;  1E0B A;  1G8Z D;  4TVA B;  4C3H G;  2KCT A;  1YNN D;  2CH4 W;  1ESF A;  3HOU H;  4NXM L;  4ZQ3 A;  1LT4 D;  3CCU A;  5M3F B;  2IT1 A;  1X3P A;  4LMQ D;  2NVT H;  3H09 A;  5C3E G;  2CWP A;  1PTO D;  4B3T L;  5D3D A;  2R92 G;  3GP7 A;  2I07 B;  1IBK Q;  3I4N H;  5E4X A;  4DV3 L;  4IUU A;  1SNO A;  2UXB Q;  4G7H C;  3NBH B;  2Z1C A;  2XN9 C;  4I7A A;  3E9H A;  1XWE A;  4DR2 Q;  3M4O H;  2KJX A;  3X3M A;  1I3Q H;  4DR6 Q;  1HHV A;  2VW9 A;  2PQA B;  3I4L A;  3SK8 A;  4ODG A;  1MD2 D;  2BDN A;  4PMW A;  5ISR A;  4DUZ L;  2IHF A;  2QDL A;  1GD7 A;  1K8G A;  4ZRZ A;  1I4R A;  2J0T D;  4A3K H;  2EYL A;  3TP7 A;  1RD9 D;  3A56 A;  1CA6 A;  1JOQ A;  4LFA Q;  3D0F A;  1JT8 A;  2R61 A;  4A3C G;  2EYO A;  2F0U A;  2OQ0 A;  4V19 0;  1MJE A;  3AU7 A;  3OIQ A;  4RH6 A;  1HR0 W;  3PCO B;  2L11 A;  3NQT A;  5LHY 1;  4K14 A;  1E22 A;  1C8C A;  3GTM H;  2A68 C;  3RN5 A;  4DV7 Q;  2A73 B;  1W6J A;  2BCO A;  1ILP A;  2EXZ A;  1H9S B;  1JIC A;  4YHH L;  3V96 A;  1PYW D;  1VF5 C;  1X56 A;  3BG3 A;  3KF8 B;  1R4P B;  4YIJ A;  1ENA A;  1IBM L;  3S15 H;  3I8Z A;  4HR7 B;  3CRK C;  4RMF A;  2GN5 A;  3MXN A;  1YNJ D;  4LFC Q;  1SEB D;  3STB C;  2UUC Q;  2Y0S E;  2F0N A;  1YIJ A;  5IT9 L;  3S14 B;  1UNS A;  3J81 i;  2F4V Q;  4OO1 I;  3R3O A;  4HIO A;  4OO1 H;  3I4O A;  1YJN A;  2WB1 B;  2F0S A;  3K5L A;  1SYC A;  5IGD A;  1YNN C;  3R2I A;  3PUX A;  4A3G G;  1B9N A;  2B29 A;  3PIO 3;  2PO4 A;  1D7Q A;  2EOT A;  3Q24 A;  1EEF D;  1IW7 C;  1IBK L;  1CM9 A;  5GAH C;  1ET6 A;  4XQJ A;  1XPU A;  3NBH A;  2EXD A;  4FNF A;  4DAP A;  1XPO A;  1Q8I A;  4YWK A;  4K5W A;  4C3I B;  1OXV A;  1GO3 E;  2D0O A;  2BH2 A;  3NTH A;  4DXF A;  1KNE A;  1NMF A;  1Q90 A;  3BZD B;  1MSG A;  3BS1 A;  4IUP A;  2ZM6 L;  1QVG A;  3GQB A;  2E75 C;  5DNF A;  2K04 A;  3U9O A;  3I90 A;  5I2Y A;  3L7Z C;  1LTT D;  2YU9 B;  4JI3 Q;  3BJU A;  1N33 Q;  1GVP A;  1QCB D;  1KIX A;  4KKU A;  2PYK A;  4XIG S;  4J6H A;  4ZK9 B;  1I6V C;  2D62 A;  3CQZ H;  3U58 A;  4A3F H;  2ZTE A;  1PTO F;  5IYB H;  2TSS A;  3JAM L;  1JWS D;  4IPH A;  2FMC A;  4OON A;  5GAE C;  4ZAI A;  4YY3 Q;  2EY6 A;  2B8G A;  2M00 A;  3EBE A;  3HOZ G;  4CKB A;  4TRD A;  1VQF A;  3VYT A;  5CV4 A;  4K0K L;  1B2T A;  1LTI D;  4ME5 A;  3VYR A;  3S1N B;  4ZUJ A;  5JAV A;  1PRT B;  1K83 H;  1CQF A;  2EY1 A;  1SAP A;  4RGM A;  1O78 A;  3PUW A;  1SYD A;  4A3M H;  4Y52 H;  5BN3 A;  4HIM A;  4UP7 A;  4NP5 A;  3A54 A;  4MTN A;  2UUC L;  1XTD A;  5IGC A;  1VQ8 A;  1EEI D;  4KN7 C;  4NDX A;  2E2H H;  3OWF A;  1YNJ C;  2F4V L;  1RTN A;  1N34 Q;  3OYY A;  3M7G A;  1VCI A;  2PI2 E;  3UDF A;  1RKN A;  4X66 Q;  5AFW A;  5GAG C;  2Q2I A;  2FMM A;  1Q1E A;  3TRE A;  4Q5V A;  3HOX B;  3TS2 A;  2B2T A;  3Q23 A;  1AZP A;  1GXD C;  1Y1W G;  1Q7Y C;  3W3A A;  2GA4 B;  3OOC A;  2JA7 H;  2FXQ A;  3ERS X;  3DWQ A;  2UXD Q;  1HTP A;  3SE0 A;  5FLM G;  3ULJ A;  3OTO Q;  3S1Q B;  4C3H H;  1BR9 A;  2IJ0 A;  1TWH H;  1GM5 A;  2FFK B;  3P20 A;  4FXK C;  2JEA I;  5H1S E;  1VQG A;  3IFD A;  1H9M A;  5BR8 L;  1JWM D;  1EQT A;  5C3E H;  2K5D A;  1ZYR C;  4RA8 A;  2JA5 G;  1H95 A;  1XXG A;  2JA8 G;  5LMU Q;  2R92 H;  2RKS A;  1B50 A;  1X3E A;  4P75 A;  4G4K A;  2YYZ A;  3BDC A;  2QIL A;  2Q8T A;  3ZJY C;  1U5K A;  3J81 E;  4JI3 L;  3LWU A;  2F4I A;  1N33 L;  1H9R A;  4R4O A;  1F9S A;  3IRB A;  2ZJQ A;  1GKH A;  4HCS A;  4K2L A;  2HHH Q;  1VDZ A;  1YNX A;  1N8R C;  1AZQ A;  2JEB I;  3C2P A;  3GTO B;  4AQY Q;  4KY5 A;  4PNY A;  4QUF A;  1S40 A;  4DXG A;  2F03 A;  2VS1 A;  4P71 A;  1F2Z A;  4A3D B;  2KEN A;  1ZEQ X;  4CBV A;  1ZXT A;  5M5Y B;  1CKO A;  2HD3 A;  1H9J A;  2B3G A;  4OWX B;  1G6P A;  3JAM i;  1PMR A;  2O4X A;  5EKI A;  3D4D A;  2H4O A;  5JJL A;  3CCM A;  4A3C H;  1R9T H;  1MI2 A;  2DNC A;  3M4Y A;  2R7F A;  2NVX B;  4HTH A;  1TS2 A;  2IL8 A;  3K0Y A;  2G9D A;  2N8N A;  3K7A B;  2DGY A;  4NXN Q;  2CWA A;  4C2M B;  2WFW A;  1HZ9 A;  2VQF L;  1LV9 A;  3TZU A;  3L3O C;  3AEV A;  1BCP B;  1XMO L;  1N34 L;  3PSI A;  2OQK A;  1YIT A;  3RUZ A;  1UE7 A;  4PQX A;  4X66 L;  5FO9 B;  5IP9 G;  1L1O C;  2VZA A;  1D5Z C;  1Q82 C;  4NKL A;  4OL7 A;  2R3Z A;  1OXU A;  3TEH B;  4MHE A;  3S2D H;  1JB3 A;  2N88 A;  2PZW A;  2L15 A;  2B63 G;  1PTO H;  5E7N A;  1KDB A;  1G29 1;  3U4V A;  3OTO L;  4QQB X;  1SXT A;  2JQO A;  2A6E C;  1IKM A;  3S2H H;  1QZH A;  1EOV A;  2VY3 A;  3BVZ A;  3PO3 G;  5KYL A;  3OIP A;  5IT9 c;  4DR3 L;  1B7Y B;  3K57 A;  3J80 L;  1KAB A;  1ENC A;  4BA2 I;  1E24 A;  4GLV B;  4L5Q A;  1L2F A;  5LMU L;  4LUZ A;  4N8X 1;  1KHI A;  4JBK A;  3BU2 A;  5ELB A;  4KN4 C;  3OSO A;  1WTV A;  4MTK A;  2YTY A;  1HFG A;  2A69 C;  2DY8 A;  2E76 C;  3W5O A;  1NAP A;  3S16 B;  2ALY B;  3UDX A;  1K73 C;  3FKI B;  5IT9 E;  2GVB A;  3JC6 6;  3G4S A;  2Z0S A;  4HSP A;  4JW0 A;  5C4H A;  4F7X A;  1XX8 A;  2B8F A;  1PHJ A;  4J1M A;  3MHB A;  5J39 A;  2CHB D;  3HG9 A;  1QUQ B;  2QGQ A;  4JI7 Q;  1VQL A;  2H1E A;  4ID6 A;  1HZA A;  3U50 C;  3VR5 A;  2K05 A;  4KD3 A;  1E1T A;  1H9K A;  3HKZ G;  4BY1 G;  4CJ2 C;  3BZC A;  4DV4 Q;  1FR3 A;  3JAM c;  1SFO B;  1GUS A;  1DCZ A;  3HOZ H;  4B9W A;  4BBS H;  1KLG D;  1X54 A;  2EJF C;  2K52 A;  2RBM A;  2K5Q A;  2DY7 A;  2E8G A;  3ER0 A;  3K6O A;  3NTI A;  4A93 B;  1D1K A;  4GOP B;  3HOW B;  3NUC A;  2CW0 C;  2L4N A;  5J1Z A;  4BA1 I;  3KBG A;  4PZ7 A;  1PH1 A;  1O7L A;  5CV9 A;  4UDU C;  4JG2 A;  1Q12 A;  5EKL A;  1F2Y A;  4JI6 Q;  4IFD I;  5D14 A;  4DK0 A;  3CC7 A;  4QIW B;  4JPB W;  5CV8 A;  2A74 C;  1EFI D;  3GTG B;  5CBA E;  4DNT B;  1EQQ A;  2EVB A;  2HQE A;  3SDZ A;  2F0D A;  4QCL A;  2I5H A;  1VQE A;  3JAM E;  3ITP A;  3FRP B;  5DAU A;  4OIJ A;  4IZ8 A;  4A76 A;  1SSO A;  4ILW A;  4C3J B;  2JE6 I;  2K1B A;  1HZC A;  4LF5 Q;  5C3X A;  5C44 G;  3H3V C;  3VR3 A;  1HH2 P;  5C0X J;  1PFB A;  2O2L D;  1Y1W H;  1MKH A;  4GNX B;  1KLU D;  1V1P B;  1AFP A;  1SLJ A;  3ULL A;  5FLM H;  1X3Q A;  1IXR A;  4FF3 A;  3WOE A;  2K6A A;  5CYU A;  3VR4 A;  3HS0 C;  1PLF A;  3I4M G;  2R7Z B;  1BXT A;  2F0V A;  1NNX A;  3BDO A;  3T53 B;  1ASZ A;  1U0L A;  3EIV A;  2D5D A;  1AW7 A;  2F0G A;  3BVG A;  2JA5 H;  4KHP Q;  2LXJ A;  2R6G A;  1PA6 A;  3M3Y B;  2JA8 H;  2NVQ H;  5D65 A;  1PYB A;  1T5E A;  3HOU B;  4KY7 A;  3TDQ A;  1BUV T;  1S5C D;  5CV5 A;  4L6T B;  5C5M A;  1HCZ A;  5D3I B;  3W2D A;  1SJE D;  1O7I A;  2NVT B;  3AYH B;  2O5J C;  4CJ1 B;  1TWF H;  3KLR A;  1I4H A;  1FYC A;  2AMC B;  3I4N B;  4GKK L;  3EN2 A;  2MO0 A;  5CV7 A;  1S3O A;  1B70 B;  3M4O B;  2XRQ D;  4POG A;  2ZTD A;  3BDL A;  3MWY W;  5HY6 A;  1HNZ Q;  3T51 B;  1I3Q B;  3Q8D A;  4KV6 A;  1HNW L;  5K36 G;  3PGZ A;  2HIX A;  3MVV A;  4I65 A;  4JI6 L;  2VUM G;  5CV6 A;  4OEL B;  1TU2 B;  2IW3 A;  3A7L A;  5LL6 X;  4EQP A;  3CXC A;  4A3K B;  4P2C B;  1RDP D;  3HFZ B;  1Q81 C;  4DV0 Q;  4IO9 A;  1FL0 A;  2ATW A;  3KYH C;  4OX9 Q;  3H15 A;  1STY A;  1B9M A;  1EOT A;  1TVX A;  2IWH A;  4ALP A;  4LF8 L;  5KIX A;  3DM1 A;  4KHZ A;  4RFB A;  1IL2 A;  4DV2 L;  2A68 D;  1LAC A;  1E2V A;  3GD7 A;  3Q22 A;  2JN4 A;  1X3F A;  3HKZ E;  2PPB C;  1UEB A;  4QGU A;  3GTM B;  3DWA A;  2B63 H;  4CDD C;  3LWE A;  1LTR D;  1SYG A;  3TME A;  1FNU A;  2X6G A;  1WJJ A;  3LX0 A;  1EY4 A;  2X69 A;  1WTW A;  1DJR D;  5ELD A;  1HPC A;  2Z4I A;  5IY0 A;  3G6E A;  1JJ2 A;  4PMC A;  3I55 A;  4DV5 Q;  3CC2 A;  1IYJ B;  3S15 B;  4QJF A;  2ID0 A;  4IUT A;  5CC4 A;  2ZXP A;  4X62 Q;  1Y69 U;  3PUY A;  5A35 A;  2K14 A;  3J80 c;  1JOR A;  4DPG A;  4LF6 Q;  5EKK A;  1D2B A;  3S1M H;  1LT3 D;  1IYV A;  1EYG A;  3A7A B;  1TS5 A;  1G91 A;  1XNQ L;  3HGB A;  3PF5 A;  1IW7 D;  3DWP A;  2L0C A;  2NWG A;  3KLW A;  1DON A;  1FGU A;  3J7Y W;  1AP0 A;  1STG A;  3TS0 A;  1WTH A;  2B2W A;  1ILQ A;  4IJH A;  4XYQ A;  4BBR G;  1O7Y A;  3J80 E;  4LNQ A;  3TQY A;  1HNZ L;  2I5M X;  2B2T C;  5EJW A;  1CKN B;  4WRD A;  4RGO S;  4IJL A;  1N32 L;  1EFW A;  4H7B A;  2VQE Q;  2KHJ A;  2EJG C;  4NPS A;  3RR5 A;  4X65 Q;  4U67 3;  3HOY G;  2F0H A;  4BY1 H;  2A8V A;  1EWH A;  4YWL A;  1UE6 A;  3N6R A;  4JI8 Q;  3UE0 A;  1HQM C;  3T1Y Q;  1CSP A;  4G7Z C;  1Z7T A;  5J22 A;  4A3J G;  4KTA A;  4R1J A;  3FHW A;  3H91 A;  3CQZ B;  3CPW A;  3F2D A;  4A3F B;  1X6O A;  2E5L Q;  5KGU A;  1IL8 A;  4ABN A;  4CHT B;  3H3V I;  3H3V H;  3NEM A;  3NE5 B;  5E3F A;  2G9H D;  2KVM A;  1YHQ A;  1A3V A;  3T1H L;  5HGT A;  2E2D C;  4L63 B;  3WDN A;  2XGT A;  4A3I G;  1TWC H;  2Y0S B;  3T56 B;  2VB3 X;  5JPM C;  1KAA A;  1PXU A;  4LUO A;  1BNZ A;  4XDX A;  4IUN A;  1A62 A;  2IPK D;  1LTB D;  2C9O A;  4IPD A;  1L0X B;  1BQQ T;  1SE8 A;  2K50 A;  1K83 B;  4BY7 B;  1O80 A;  5JVH 3;  5C44 H;  3S17 H;  2LY7 A;  4A3M B;  1PH7 A;  4LF7 Q;  1FD7 D;  1ROD A;  4XQN A;  2B2Y A;  4LW1 A;  4KK7 A;  4LF6 L;  1WTQ A;  2E2H B;  1TQO A;  3CPF A;  1XJV A;  5L37 A;  3CCQ A;  2X6L A;  3I4M H;  5T1G A;  5M3M G;  3F2B A;  2IHE A;  4BWG B;  2CQO A;  5FO7 B;  4CJ0 B;  3TZD A;  1NTG A;  3VR6 A;  5AJ3 Q;  2LXK A;  2JA7 B;  3W1G A;  1X9N A;  2AQ3 B;  2Q8R E;  2UXB L;  2BA0 A;  3GTL H;  1IZ6 A;  4HJ9 A;  4BXX G;  4C3H B;  1JJC B;  1II3 A;  2XIW A;  1TWH B;  1G6Z A;  1WD0 A;  4DR2 L;  1ZYR D;  4OHJ A;  1CHQ D;  5LL6 S;  1TXY A;  1U4P A;  1Y1V G;  2HUG A;  2JYO A;  1CFM A;  2NVY H;  4DR6 L;  1NBW A;  5BN5 A;  1HUN A; 
#chains in the Genus database with same CATH homology
 2WB1 G;  1CKO A;  1VQA A;  2B3G A;  3L0O A;  2PQA A;  3KF6 B;  4OWX B;  2BA1 A;  1G6P A;  3CP0 A;  1VQC A;  1WCM H;  3JAM i;  1G51 A;  5C4J H;  1J5E Q;  3HOV G;  1YVC A;  1XMQ Q;  5JJL A;  3W1B A;  1M1K C;  1IBM Q;  2UUA Q;  5C4X G;  1OXX K;  3CW2 C;  3CCM A;  4MZ9 A;  1R9T H;  4JI4 Q;  4A3C H;  2RCN A;  2R7F A;  3J7Z C;  4A3B G;  4H02 A;  2XTI A;  4GLA C;  1K3R A;  3F8T A;  4R4Q A;  2N8N A;  2WAQ E;  3MXN B;  5FJ8 H;  2DGY A;  4NXN Q;  4A3E G;  5IYD H;  4LF4 Q;  4LFA L;  5J3B A;  2CWA A;  4LF8 Q;  1LTL A;  5LMN Q;  4HJA A;  4AH6 A;  2WFW A;  4DV2 Q;  4DNI A;  3DLL A;  4IPC A;  4JV5 L;  1HZ9 A;  2VQF L;  4DV6 Q;  1I5F A;  4QL5 A;  3RLN A;  2ZTC A;  4QIW E;  3AEV A;  2CKZ B;  3GTQ H;  1XMO L;  1PH5 A;  1N34 L;  3PSI A;  2OQK A;  4R4I A;  4R4C A;  1VQ4 A;  1YIT A;  1YJ9 A;  2PMZ E;  2VUM H;  1UE7 A;  1PYS B;  3A5Z B;  4X66 L;  1E1O A;  3CME A;  2JA9 A;  5IP9 G;  1L1O C;  2VZA A;  4DV7 L;  3B6Y A;  4BBS G;  2OWO A;  1Q82 C;  4OO1 G;  1UE5 A;  1RIP A;  2UUB L;  1E3P A;  4HIK A;  1I50 H;  1OXU A;  4LUV A;  3TEH B;  1N36 L;  3PUV A;  1AE2 A;  3S2D H;  1C0A A;  1Q8K A;  1VQK A;  2JA6 G;  2L15 A;  4DR1 L;  2B63 G;  5E7N A;  2E2J H;  2YTX A;  1I94 Q;  1G29 1;  3S16 H;  2MQH A;  3M9B A;  1PH6 A;  3K8A A;  3U4V A;  4O0A A;  3OTO L;  3RZD H;  3CCL A;  1XNR Q;  4QQB X;  2JQO A;  3FKI H;  4DV0 L;  4DV1 L;  4IFD G;  4EQ5 A;  5M5X H;  4OX9 L;  3S2H H;  5IYC G;  1QZH A;  1Z47 A;  1EOV A;  2VY3 A;  3PIP A;  3PO3 G;  4RG1 A;  4LF7 L;  2R93 H;  1KXL A;  4LFC L;  5IT9 c;  4OWT B;  1VQJ A;  3J7A 5;  1JJG A;  1X55 A;  4DR3 L;  1B7Y B;  2N3S A;  2NN6 I;  1QZG A;  4NXM Q;  2UU9 L;  4BA2 I;  1KC8 C;  1E24 A;  2ZM6 Q;  1K9M C;  4LFB Q;  2HIV A;  1QVC A;  5DLQ E;  4GLV B;  2MO1 A;  4L5Q A;  1L2F A;  5LMU L;  4LUZ A;  4DUY L;  1XNQ Q;  4JYA L;  1VQ6 A;  5IE8 A;  2OTL A;  1KHI A;  4JBK A;  1SRO A;  4B3T Q;  1A8V A;  3BU2 A;  1L1O A;  1PH8 A;  1SR3 A;  3PF4 A;  3H0G H;  1C9O A;  5C0X I;  4L5S A;  2Q2T A;  4A75 A;  2YTY A;  2JK8 A;  1SFO H;  1X65 A;  3W5O A;  1JE5 A;  1YJW A;  1E7Z A;  4XTC S;  2ALY B;  3UDX A;  1EWI A;  1HR0 L;  3AQQ A;  4DV5 L;  4A93 H;  1K73 C;  3PO2 H;  4JI5 Q;  5EAY A;  3HOW H;  1NJI C;  4A3F G;  5JJK A;  2GVB A;  2QEX A;  4DR7 Q;  4X62 L;  2K4K A;  2RHS B;  5IYB G;  2HT1 A;  3D31 A;  2F3I A;  3GTJ H;  1Q1B A;  4JBJ A;  3ICE A;  3JC6 6;  3G4S A;  2Z0S A;  1WI5 A;  4YWM A;  4JI2 L;  2N49 A;  1N32 Q;  1KRT A;  3CCE A;  4K0K Q;  3J81 j;  3G71 A;  4X6A H;  3CF5 A;  1AE3 A;  4PZ8 A;  3CMA A;  3TRZ A;  1PHJ A;  2MFI A;  1XMQ L;  2UUA L;  1HNX Q;  3HOX G;  4QY7 A;  3GTG H;  2Y0S G;  5FLX c;  1P16 A;  4HJ5 A;  1QUQ B;  2QGQ A;  4JI4 L;  3I2Z A;  2PNH A;  4GN5 A;  1VQL A;  4JI7 Q;  4JBM A;  1P8L A;  3U50 C;  1HZA A;  1VQN A;  4L5R C;  4C3I H;  1V9P A;  4LF4 L;  4BBR H;  1VQ7 A;  1E1T A;  2VNU D;  3HKZ G;  1SMX A;  4R4T A;  4BY1 G;  3GDE A;  3BZC A;  1PH4 A;  4DV4 Q;  3FP9 A;  4BY7 G;  3JAM c;  4UY8 C;  2YV5 A;  4DV6 L;  5IP9 H;  3HOZ H;  4BBS H;  2EQS A;  4A3M G;  1VQO A;  1X54 A;  2K52 A;  4YCV A;  1PV4 A;  2E8G A;  3ER0 A;  3T1H Q;  1NMG A;  5M3F H;  4JI2 Q;  4GOP B;  4YY3 L;  1Z9F A;  4B3M Q;  4BA1 I;  3KDF A;  1VQB A;  3HOY H;  4PZ7 A;  4P74 A;  1PH1 A;  4IOA A;  2LSS A;  1W2B A;  1CKN A;  2IX1 A;  4JI1 Q;  2F52 A;  4KI0 A;  2RHQ B;  1KRS A;  1Q12 A;  4JG2 A;  4YHH Q;  4IOC A;  4JI6 Q;  4A3L G;  4IFD I;  2VQE L;  3CC7 A;  3KJO A;  1JMC A;  1T9H A;  4GN3 B;  4A3J H;  4X65 L;  2R7Z H;  2N78 A;  1BBU A;  3PO3 H;  4WJ4 A;  3I56 A;  1KD1 C;  4JI0 Q;  1I94 L;  1KL9 A;  3I7F A;  2WB1 E;  3STB D;  1EQQ A;  1IBL Q;  5ELO A;  1XNR L;  3E0E A;  3RZO H;  3A74 A;  2I5H A;  1VQE A;  2KCM A;  4JCV E;  4JI8 L;  3M3Y H;  2JA7 G;  3T1Y L;  1M90 C;  3VDY A;  4TVA B;  4A76 A;  5BR8 Q;  2KCT A;  4JBW A;  2JE6 I;  1A0I A;  2BH8 A;  1HZC A;  1EUJ A;  1CUK A;  4LF5 Q;  2E5L L;  5C44 G;  4NXM L;  3HOU H;  2IX0 A;  4A3I H;  2K75 A;  1QVF A;  1HH2 P;  1YBY A;  5C0X J;  5JEA J;  4A3D G;  1Y1W H;  1MKH A;  3CCU A;  4GNX B;  2CCZ A;  1BBW A;  2IT1 A;  4DAM A;  1SLJ A;  2C35 B;  5IP7 G;  2NVT H;  3A5U A;  2A19 A;  2GVA A;  5C3E G;  2CWP A;  4P72 A;  3ULL A;  5M5W H;  3G48 A;  5IWA Q;  3UE1 A;  4X64 Q;  5FLM H;  1IXR A;  4B3T L;  2R92 G;  4KLK A;  2K5H A;  4B3S Q;  3I4N H;  1IBK Q;  1PVO A;  4APV A;  4DV3 L;  3I4M G;  1S72 A;  2UXB Q;  2UXD L;  3PV0 A;  3NBH B;  4DR5 Q;  1ASZ A;  1U0L A;  3EIV A;  3E9H A;  4JOI C;  4DR2 Q;  2CFM A;  2ASB A;  2JA5 H;  3M4O H;  4KHP Q;  2A1A A;  2LXJ A;  2R6G A;  4JI5 L;  1PA6 A;  2JA8 H;  4DR7 L;  1I3Q H;  2NVQ H;  4DR6 Q;  2KBN A;  2VW9 A;  1PYB A;  4AYB G;  1W3S A;  2PQA B;  1YZ6 A;  3MEF A;  3PIO A;  4OXP A;  4PMW A;  1PH3 A;  5M3M H;  4DUZ L;  2IHF A;  1GD7 A;  1K8G A;  3UDG A;  4UP8 A;  4A3K H;  3KOJ A;  4BY7 H;  1O7I A;  4IPG A;  4JC0 A;  4O2D A;  3AYH B;  3M85 A;  4HJ8 A;  1VQH A;  4LFA Q;  4LWC A;  1TWF H;  1XPR A;  4BXX H;  3D0F A;  3CD6 A;  1JT8 A;  3KFU A;  2AMC B;  4A3C G;  3K7U C;  2OQ0 A;  2MNA A;  5HGQ A;  2VQF Q;  3EN2 A;  3S14 H;  4GKK L;  4Y7N H;  1MJE A;  2MO0 A;  3RLF A;  1HR0 W;  5AJ3 L;  1Y1V H;  5FJ8 G;  1S3O A;  3PCO B;  5IYD G;  2HHH L;  1XMO Q;  4GKJ Q;  1E22 A;  4IFD J;  1B70 B;  4A3L H;  4JOI A;  4AQY L;  4POG A;  2ZTD A;  5HY6 A;  1KAW A;  3RN5 A;  1HNZ Q;  3GTM H;  4B3M L;  4DV7 Q;  3HOV H;  3RLO A;  3Q8D A;  2I5L X;  5C4X H;  1LYL A;  2AHO B;  2UUB Q;  2H5X A;  2K5V A;  4GLX A;  4A3B H;  1HNW L;  1J6Q A;  5K36 G;  2WP8 J;  1N36 Q;  4JI1 L;  4YHH L;  3PGZ A;  2HIX A;  3KF6 A;  1OXS C;  2RF4 A;  3AFQ A;  3J81 c;  4JI6 L;  2VUM G;  4A3E H;  2D0P A;  2QA4 A;  1J5E L;  1X56 A;  3KF8 B;  1YI2 A;  1IBM L;  3CXC A;  1WYD A;  2EIF A;  4JI0 L;  3S15 H;  3HFZ B;  1IBL L;  1Q81 C;  4DV0 Q;  4RMF A;  1FL0 A;  4IO9 A;  3KYH C;  2ATW A;  2GN5 A;  1VQD A;  5GRO A;  3H15 A;  4OX9 Q;  4NXN L;  4LF9 Q;  2OCE A;  2ES2 A;  2V1C C;  4LFC Q;  4ALP A;  3BZK A;  4LF8 L;  5LMN L;  1AH9 A;  4KHZ A;  1FJG Q;  3STB C;  4DR4 Q;  2UUC Q;  2Y0S E;  4DR3 Q;  4PG3 A;  1IL2 A;  4DV2 L;  1YIJ A;  2JA7 H;  3J81 i;  2Q2U A;  3FKI G;  3GD7 A;  2F4V Q;  4OO1 I;  4HIO A;  4PZ6 A;  4HJ7 A;  3I4O A;  1YJN A;  2R93 G;  1X3G A;  1X3F A;  4DUY Q;  1NE3 A;  1PH9 A;  3HKZ E;  1HZB A;  1CSQ A;  1UEB A;  4QGU A;  3KJP A;  2YU9 H;  2NN6 G;  2JA6 H;  1C7Y A;  2B63 H;  3PUX A;  1L1O B;  1B8A A;  4A3G G;  2B29 A;  1RL2 A;  1WOC A;  5IWA L;  4X64 L;  1EQR A;  1D7Q A;  1WJJ A;  1LM0 A;  1EIF A;  1IBK L;  2K5N A;  5IYC H;  3GTK H;  1Y14 B;  5IY0 A;  2PI2 A;  5GAH C;  3S24 A;  3RNU A;  4DK3 C;  3G6E A;  4DR5 L;  1JJ2 A;  3H0G G;  4POF A;  2EXD A;  3I55 A;  1IYJ B;  4DV5 Q;  1HR0 Q;  3CC2 A;  4QJF A;  4YCU A;  2ID0 A;  1XPO A;  5C0X G;  5JEA G;  4YWK A;  2AWN A;  1OXV A;  1WFQ A;  4X62 Q;  1KQS A;  1GO3 E;  1YEZ A;  2D0O A;  2BH2 A;  3PUY A;  2K14 A;  5GAD C;  3J80 c;  4DPG A;  4LF6 Q;  4A93 G;  1NMF A;  3PO2 G;  2WAQ G;  3HOW G;  3S1M H;  3CCV A;  1K8A C;  1QVG A;  2ZM6 L;  4B3R Q;  4LFB L;  1YHA A;  3S1N H;  1EYG A;  1XNQ L;  3HKS A;  3PF5 A;  3U4Z A;  4DAY B;  3L7Z C;  1V1Q A;  3L2P A;  4JI3 Q;  3BJU A;  1N33 Q;  1GVP A;  1KIX A;  3KLW A;  3S1R H;  4XIG S;  3M4Q A;  3J80 i;  5ELN A;  1FGU A;  2UXC Q;  2AWO A;  1MJC A;  4GN4 B;  2D62 A;  1NY4 A;  3CQZ H;  3U58 A;  4A3F H;  3TS0 A;  2ZTE A;  4UP9 A;  4P73 A;  5IYB H;  4IJH A;  4IPH A;  1CKM A;  1K0R A;  4BBR G;  1N9W A;  1XPU A;  4OON A;  5GAE C;  4GOP C;  3NEL A;  3OW2 A;  4YY3 Q;  4GKJ L;  4OWW B;  1PFS A;  1SN8 A;  4DKA C;  4LNQ A;  3KDF B;  3M7N A;  3TQY A;  1UE1 A;  1DGS A;  3AFP A;  2I5M X;  3EBE A;  3WWV A;  1HNZ L;  3HOZ G;  4DR4 L;  3HOX H;  1CKN B;  4A4I A;  4IJL A;  1N32 L;  3K0X A;  1EFW A;  1VQF A;  5M3F G;  4K0K L;  2VQE Q;  3CCJ A;  2KHJ A;  1EIY B;  4NPS A;  3RR5 A;  1LUZ A;  4X65 Q;  2ZJP A;  1OTC A;  4FDB A;  2VL6 A;  3HOY G;  4BY1 H;  3S1Q H;  4HID A;  2A8V A;  3A0J A;  1HNX L;  4YWL A;  5GQO A;  1K83 H;  4AYB E;  1UE6 A;  1QUQ A;  4JI7 L;  1SRU A;  4JI8 Q;  1WCM G;  3GO5 A;  3UE0 A;  3PUW A;  3T1Y Q;  4A3M H;  3PUZ A;  1CSP A;  1PH2 A;  4A3J G;  4LF9 L;  2R7Z G;  4Y52 H;  4HIM A;  4R1J A;  4UP7 A;  3FHW A;  2Z6K C;  4J15 A;  3CPW A;  4MTN A;  3F2D A;  1X6O A;  4DV4 L;  3CCS A;  2UUC L;  1XTD A;  3F1Z A;  1VQ8 A;  2E5L Q;  4GS3 A;  2E2H H;  3H3V I;  4A3G H;  2F4V L;  3UDI A;  3H3V H;  1N34 Q;  3DM3 A;  1TWG H;  3K80 C;  3NEM A;  3OYY A;  4GNX C;  1YHQ A;  1VCI A;  2PI2 E;  3UDF A;  3T1H L;  2OTJ A;  4GOP A;  4X66 Q;  4DK6 C;  5GAG C;  2Q2I A;  3ULP A;  3HOU G;  3F2C A;  1Q1E A;  2XGT A;  3TRE A;  4A3I G;  3TS2 A;  1TWC H;  1UWV A;  3K81 C;  2DUD A;  1Y1W G;  1Q7Y C;  1L0W A;  4LUO A;  2AKW B;  2YTV A;  2HQL A;  3CAM A;  4DV3 Q;  4DR1 Q;  1A62 A;  3M4P A;  1VQM A;  2FXQ A;  3ERS X;  4AIM A;  1Q86 C;  4NB3 A;  1VQ9 A;  3LGJ A;  2UXD Q;  4IPD A;  4JV5 Q;  5FLM G;  3ULJ A;  3OTO Q;  1SE8 A;  4C3H H;  1BKB A;  2K50 A;  4YCW A;  1TWH H;  3CCR A;  1FJG L;  4L5T A;  1D8L A;  2ZJR A;  3NEN A;  4DV1 Q;  3GTO H;  3I4N G;  3E9I A;  5C44 H;  1GM5 A;  5LMN W;  2JEA I;  3S17 H;  5H1S E;  1PH7 A;  4LF7 Q;  2NZH A;  4A3D H;  1VQG A;  1HJP A;  3GTP H;  2IY5 B;  5M5Y H;  1MIU A;  4LW1 A;  5IP7 H;  5BR8 L;  2UU9 Q;  1YHB A;  1VQ5 A;  2Z6K A;  4LF6 L;  5C3E H;  2JA5 G;  4MNO A;  1H95 A;  4DUZ Q;  4LF5 L;  1I6H H;  1HNW Q;  4EX5 A;  2JA8 G;  5LMU Q;  3CPF A;  1BVS A;  2KHI A;  1TWA H;  1XJV A;  2R92 H;  4JYA Q;  4B3R L;  4WJ3 M;  1Q46 A;  4TQU S;  3CCQ A;  1FVI A;  4GNX A;  1X3E A;  2NVX H;  4P75 A;  2YYZ A;  2I0Q A;  1OXT A;  3I4M H;  3K7A H;  3ZJY C;  5JJI A;  1V43 A;  1U5K A;  5M3M G;  2Q2H A;  4JI3 L;  3F2B A;  2IHE A;  1N33 L;  4R4O A;  2CQO A;  3IRB A;  4C2M H;  4A3K G;  4B3S L;  4GKK Q;  2UXC L;  1VQI A;  1NTG A;  4C3J H;  2ZJQ A;  1GKH A;  2LXK A;  5AJ3 Q;  3W1G A;  1X9N A;  2HHH Q;  2UXB L;  3SGI A;  2BA0 A;  3GTL H;  1IZ6 A;  4HJ9 A;  1VQP A;  4BXX G;  1JJC B;  1ASY A;  1YNX A;  1N8R C;  3CC4 A;  2JEB I;  4DR2 L;  4AQY Q;  4KHP L;  2E2I H;  2NZO A;  2JJQ A;  4ME3 A;  3RN2 A;  1VS0 A;  1S40 A;  2VS1 A;  1A63 A;  4UPA A;  1TXY A;  4P71 A;  1Y1V G;  2KEN A;  1JB7 A;  2R7D A;  2NVY H;  4DR6 L;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...