2MGPA

Structure of plasmodium yoelii merozoite surface protein 1 - c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Plasmodium yoelii merozoite surface protein 119, antibody specificity and implications for malaria vaccine design
pubmed doi rcsb
source organism Plasmodium yoelii yoelii
molecule tags Membrane protein
molecule keywords Merozoite surface protein 1
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12946 EGF_MSP1_1 MSP1 EGF domain 1
A PF12947 EGF_3 EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2mgpA01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2mgpA02
2UWOB 1U67A 3IITB 4CSYA 2BO2A 3OLUA 4XLWA 2BZ6L 2RNLA 1HT5A 4MMZB 1YUKB 5F1AA 3SOQA 2J2UB 4RRYA 1KLJL 5CKNA 2KB9A 1IQJL 3U73A 3MQEA 1EPGA 1URKA 5EGMB 2Y7ZB 3N8YA 4YZUB 1CVUA 1MOXC 1UZPA 4E1GA 4X8SL 3HS5A 4Y7AB 1IQML 1LQDA 2P28B 4Y76B 1YUGA 2VVUL 3P5BL 1CX2A 3F6UL 3PGHA 1KIGL 3ZYJB 3FFGL 5IKQA 1FF7A 3ELAL 1DIYA 2WPLE 1JV2B 2WPJE 2FLRL 1IQIL 2BOKL 3NTBA 3N8WB 2PHBB 3KCGL 3IJEB 1HJ7A 4BXSA 1A3PA 1HCGB 1UZQA 1IOEL 1PFXL 2VWNL 1YUFA 1DX5I 2WPME 4JZFL 3TBDA 3H5CB 5IKVA 2MGRA 1EPHA 1K36A 4ZH8B 1PRHA 2FLBL 1L5GB 2P93L 2XBWL 4PH9A 1PTHA 2Y5FL 3GCWE 1FAXL 2WG4B 4ISIL 2GD4A 3C9AC 4AQTA 5KIRA 3HS6A 1O5DL 1FE2A 2XC4L 2W2OE 3BT2A 2BQ6A 3ENSA 1NFWB 3Q7DA 3ASIA 5JBBE 4M10A 1MQ5L 4ZHAB 1EPJA 1Q4GA 2Y82B 1U8CB 2VWMK 2TGFA 1NFUB 4A7IA 1WHFA 1FJSL 2MHPA 1IQGL 1TOZA 2WPHE 2B7DL 2WG3C 2J94B 2G00L 2XC0L 4G1MB 4X8UL 2BQ7A 1COUA 3CA7A 1IGXA 3K9XA 1K37A 3F1SB 4ISHL 5COXA 1B9WA 1NPEB 1Z6CA 3SOBB 4Z0LA 2EI8B 1MQ6L 5CISA 1F0RB 3V64C 1XFEA 5IKTA 3LC5B 3M37L 4LORA 1NFXB 3Q3KB 1HZ8A 3V65B 1ATAA 2WPIE 1CCFA 1HAEA 1IP0A 1ATDA 4JYVL 2YGPA 2J4IB 4COXA 3HO4A 2PUQL 4BXWA 1DDXA 1G1SA 4O02B 1G2MB 2P3FL 2P3FN 1LPZA 2P26A 4D0EA 3POYA 3MDLA 5JB9E 2W2PE 3LTFB 1F0SB 3TH3L 2OYEP 1J9CL 3LC3B 3QH0A 1OB1C 4ZXXL 1YGCL 1EQHA 4LMFA 2NPRA 4NG9L 4RRXA 2P95L 3BPSE 4Z0KB 1NT0A 2FD6A 1IQNL 2W2QE 1DVAL 2JKHL 1HRFA 1P0SL 1XDTR 2BOXA 2Y80B 2J34B 2VH0B 2W86A 4JZDL 1CEJA 2Y5HL 1L3YA 3TZIA 1I0UA 2RA0L 4MMXB 1BF9A 3CFWA 1ATBA 1QFKL 4CUFA 4RRZA 5F19A 2MGPA 3FBYA 1ADXA 4M11A 1XKAL 2W2ME 1FAKL 1APOA 3NJPC 5L30L 3R05A 2VVVL 3KK6A 1HAFA 3EGFA 3LN0A 1FFMA 1EAIC 3SW2A 4X8TL 1IQKL 4O1ZA 1HT8A 2K2TA 2FZZL 1G1QA 3GCXE 4OTYA 4RUTA 2Y5GL 1UZKA 2AYLA 4RRWA 2Y81B 3CENL 4JYUL 2ADXA 3QMOA 4BTIA 1N7DA 1G1RA 1KSNB 1EQGA 4BTTA 3HPTA 1UZJA 2BOUA 5L2ZL 1JL9A 1EMNA 1W7XL 5JBAE 4OTJA 1IOXA 2KL7A 2KV4A 3ZYGA 1CQEA 3HS7A 1SZBA 3NTGA 4CUDA 2BMGA 3QCWA 2XBXL 4FM5A 1M1XB 1IQFL 2WYGB 2Y7XB 1V3XB 2I9BA 3LN1A 6COXA 1APQA 4Y71B 5CKQA 4ZXYL 2XC5L 2YGOA 1EBVA 1LPGA 1NFYB 3LIWB 2XBVL 1EPIA 5KN5C 1AUTL 1C5MF 5JVYA 4C16A 2W26B 1XKBA 5JVZA 3HO5A 1FSBA 3FCSB 1DQBA 2VH6B 2D1JB 3N8YB 2K2SB 2H9EL 5IKRA 4Y79B 4JZEL 1TPGA 1IQEL 4NA9L 5FDQA 4Z6AL 1PXXA 4TGFA 1HREA 1CVWL 2RHPA 2UWPB 2WFXB 1LPKA 2VVCK 2VWOL 1EGFA 3N8XA 3KQBL 2W3IB 3N8VA 2F9BL 2J38B 3BT1A 5L2YL 2VJ3A 2EI6B 4YT6L 5JBCE 2BOHA 3N8ZA 3M36L 2XBYL 1G1TA 2DDUA 4Y6DB 2P3UA 1GK5A 5I46L 2P3TA 1W8BL 1EMOA 1KLOA 5JB8E 3LAQA 3TK5B 1KLIL 1ATEA 3U7UG 3KQDL 3KQCL 3RR3A 1TLEA 5JW1A 4RS0A 2WPKE 4X8VL 3N8WA 4BTUA 4D90A 1RFNB 1EZQB 3CS7L 1F7MA 1F7EA 1IQHL 3KRKA 1HX2A 2J95B 2W2NE 3DEMA 4BDWA 4XL1A 5CKMA 4MMYB 1WHEA 2P16L 1N1IA 2M74A 2Y38A 3TK6B 1CCVA 4CUEA 3ZYIB 5E8DA 2OYUP 3OLTA 2WYJB 1P9JA 1IVOC 2UWLB 1JBUL 3KL6B 4XBMA 2FLGA 3GISX 4ZAEB 4NGAL 2VWLL 2PR3B 1X7AL 2I9AA 2WFTA 2BQWA 4Y7BB 1PGEA 1IGZA 4BDXA 1G2LB 1LMJA 2EI7B 4D0FA 2Q1JB 1ZAQA 1WU1B 2CJIB 3TGFA 1NZIA 3HO3A 3LTGD 1Z6EL 4YT7L 2W3KB 3KQEL 1NQLB 5K0HB 3NT1A 3SOVA 1IQLL 1YO8A 1IJQA 2P94L
chains in the Genus database with same CATH superfamily
2UWOB 1U67A 3IITB 4CSYA 2BO2A 3OLUA 4XLWA 2BZ6L 2RNLA 1HT5A 4MMZB 1YUKB 5F1AA 3SOQA 2J2UB 4RRYA 1KLJL 5CKNA 2KB9A 1IQJL 3U73A 1V1HA 3MQEA 1EPGA 1URKA 5EGMB 2Y7ZB 3N8YA 4YZUB 1CVUA 1MOXC 1UZPA 4E1GA 4X8SL 3HS5A 4Y7AB 1IQML 1LQDA 2P28B 4Y76B 1YUGA 2VVUL 3P5BL 1CX2A 3F6UL 3PGHA 1KIGL 3ZYJB 3FFGL 5IKQA 1FF7A 3ELAL 1DIYA 2WPLE 1JV2B 2WPJE 2BT7A 2FLRL 1IQIL 2BOKL 3NTBA 3N8WB 2PHBB 3KCGL 3IJEB 1HJ7A 4BXSA 1A3PA 1HCGB 1UZQA 1IOEL 1PFXL 2VWNL 1YUFA 1V1IA 1DX5I 2WPME 4JZFL 3TBDA 3H5CB 5IKVA 2MGRA 1EPHA 1K36A 4ZH8B 1PRHA 2FLBL 1L5GB 2P93L 2XBWL 4PH9A 1PTHA 2Y5FL 3GCWE 1FAXL 2WG4B 4ISIL 2GD4A 3C9AC 4AQTA 5KIRA 3HS6A 1O5DL 1FE2A 2XC4L 2W2OE 3BT2A 2BQ6A 3ENSA 1NFWB 3Q7DA 3ASIA 5JBBE 4M10A 1MQ5L 4ZHAB 1EPJA 1Q4GA 2Y82B 1LMMA 1U8CB 2VWMK 2TGFA 1NFUB 4A7IA 1WHFA 1FJSL 2MHPA 1IQGL 1TOZA 2WPHE 2B7DL 2WG3C 2J94B 2G00L 2XC0L 4G1MB 4X8UL 2YGQA 1LK9A 2BQ7A 1COUA 3CA7A 1IGXA 3K9XA 1K37A 3F1SB 4ISHL 5COXA 1B9WA 1NPEB 1Z6CA 3SOBB 4Z0LA 2EI8B 1MQ6L 5CISA 1F0RB 3V64C 1XFEA 5IKTA 3LC5B 3M37L 4LORA 1NFXB 3Q3KB 1HZ8A 3V65B 1ATAA 2WPIE 1CCFA 1HAEA 1IP0A 1ATDA 4JYVL 2YGPA 2J4IB 2KNIA 3HO4A 2PUQL 4COXA 4BXWA 1DDXA 1G1SA 4O02B 1G2MB 2P3FL 2P3FN 1LPZA 2P26A 4D0EA 3POYA 3MDLA 5JB9E 2W2PE 3LTFB 1F0SB 3TH3L 2OYEP 1J9CL 3LC3B 3QH0A 1OB1C 4ZXXL 1YGCL 1EQHA 4LMFA 2HOXA 2NPRA 4NG9L 4RRXA 2P95L 3BPSE 4Z0KB 1NT0A 2FD6A 1IQNL 3S6XA 2W2QE 1DVAL 2JKHL 1HRFA 1P0SL 1QIUA 1XDTR 2BOXA 2Y80B 2J34B 2VH0B 4GU4A 2W86A 4JZDL 1CEJA 2Y5HL 1L3YA 3TZIA 1I0UA 2RA0L 4MMXB 1BF9A 3CFWA 1ATBA 1QFKL 4CUFA 4RRZA 5F19A 2MGPA 3FBYA 1ADXA 4M11A 1XKAL 2W2ME 1FAKL 1APOA 3NJPC 5L30L 3R05A 2JJLA 2VVVL 3KK6A 1HAFA 3EGFA 3LN0A 1FFMA 1EAIC 3SW2A 4X8TL 1IQKL 4O1ZA 1HT8A 2K2TA 2FZZL 1G1QA 3GCXE 4OTYA 4RUTA 2Y5GL 1UZKA 2AYLA 4RRWA 2Y81B 3CENL 4JYUL 2ADXA 3QMOA 4BTIA 2VRSA 1N7DA 1G1RA 1KSNB 1EQGA 4BTTA 3HPTA 1UZJA 2BOUA 5L2ZL 1JL9A 1EMNA 1W7XL 5JBAE 4OTJA 1IOXA 2KL7A 2KV4A 3ZYGA 1CQEA 3HS7A 1SZBA 3NTGA 4CUDA 2BMGA 3QCWA 2XBXL 4FM5A 1M1XB 1IQFL 2WYGB 2Y7XB 1V3XB 2I9BA 3LN1A 6COXA 1APQA 4Y71B 5CKQA 4ZXYL 2XC5L 2YGOA 4GU3A 1EBVA 1LPGA 1NFYB 3LIWB 2XBVL 1EPIA 5KN5C 4A94C 1AUTL 1C5MF 5JVYA 4C16A 2W26B 1XKBA 5JVZA 3HO5A 1FSBA 3FCSB 1DQBA 2VH6B 2D1JB 3N8YB 2K2SB 2H9EL 5IKRA 4Y79B 4JZEL 1TPGA 1IQEL 4NA9L 5FDQA 4Z6AL 1PXXA 4TGFA 1HREA 1CVWL 2BSFA 2RHPA 2UWPB 2WFXB 2BT8A 1LPKA 2VVCK 2VWOL 1EGFA 3N8XA 3KQBL 2W3IB 3N8VA 2F9BL 2J38B 2HORA 3BT1A 5L2YL 2WZPP 2VJ3A 2EI6B 4YT6L 5JBCE 2BOHA 3N8ZA 3M36L 2XBYL 1G1TA 2DDUA 4Y6DB 2P3UA 1GK5A 5I46L 2P3TA 1W8BL 1EMOA 1KLOA 5JB8E 3LAQA 2H9EC 3TK5B 1KLIL 1ATEA 3U7UG 3KQDL 3KQCL 3RR3A 1TLEA 5JW1A 4RS0A 2WPKE 4X8VL 3N8WA 4BTUA 4D90A 1RFNB 1EZQB 3CS7L 1F7MA 1F7EA 1IQHL 3KRKA 1HX2A 2J95B 2W2NE 3DEMA 4BDWA 4XL1A 5CKMA 4MMYB 1WHEA 2P16L 1N1IA 2M74A 2Y38A 3TK6B 1CCVA 4CUEA 3ZYIB 5E8DA 2OYUP 3OLTA 1KKEA 2WYJB 1P9JA 1IVOC 2UWLB 1JBUL 3KL6B 4XBMA 2FLGA 3GISX 4ZAEB 4NGAL 2VWLL 2PR3B 1X7AL 2I9AA 2WFTA 2BQWA 4Y7BB 1PGEA 1IGZA 4BDXA 1G2LB 1LMJA 2EI7B 4D0FA 2Q1JB 1ZAQA 1WU1B 2CJIB 3TGFA 1NZIA 3HO3A 3LTGD 1Z6EL 4YT7L 2W3KB 3KQEL 1NQLB 5K0HB 3NT1A 3SOVA 1IQLL 1YO8A 1IJQA 2P94L
chains in the Genus database with same CATH topology
2UWOB 1U67A 3IITB 4CSYA 2BO2A 3OLUA 4XLWA 2BZ6L 2RNLA 1HT5A 4MMZB 1YUKB 5F1AA 3SOQA 2J2UB 4RRYA 1KLJL 5CKNA 2KB9A 1IQJL 3U73A 3MQEA 1EPGA 1URKA 5EGMB 2Y7ZB 3N8YA 4YZUB 1CVUA 1MOXC 1UZPA 4E1GA 4X8SL 3HS5A 4Y7AB 1IQML 1LQDA 2P28B 4Y76B 1YUGA 2VVUL 3P5BL 1CX2A 3F6UL 3PGHA 1KIGL 3ZYJB 3FFGL 5IKQA 1FF7A 3ELAL 1DIYA 2WPLE 1JV2B 2WPJE 2FLRL 1IQIL 2BOKL 3NTBA 3N8WB 2PHBB 3KCGL 3IJEB 1HJ7A 4BXSA 1A3PA 1HCGB 1UZQA 1IOEL 1PFXL 2VWNL 1YUFA 1DX5I 2WPME 4JZFL 3TBDA 3H5CB 5IKVA 2MGRA 1EPHA 1K36A 4ZH8B 1PRHA 2FLBL 1L5GB 2P93L 2XBWL 4PH9A 1PTHA 2Y5FL 3GCWE 1FAXL 2WG4B 4ISIL 2GD4A 3C9AC 4AQTA 5KIRA 3HS6A 1O5DL 1FE2A 2XC4L 2W2OE 3BT2A 2BQ6A 3ENSA 1NFWB 3Q7DA 3ASIA 5JBBE 4M10A 1MQ5L 4ZHAB 1EPJA 1Q4GA 2Y82B 1LMMA 1U8CB 2VWMK 2TGFA 1NFUB 4A7IA 1WHFA 1FJSL 2MHPA 1IQGL 1TOZA 2WPHE 2B7DL 2WG3C 2J94B 2G00L 2XC0L 4G1MB 4X8UL 2YGQA 2BQ7A 1COUA 3CA7A 1IGXA 3K9XA 1K37A 3F1SB 4ISHL 5COXA 1B9WA 1NPEB 1Z6CA 3SOBB 4Z0LA 2EI8B 1MQ6L 5CISA 1F0RB 3V64C 1XFEA 5IKTA 3LC5B 3M37L 4LORA 1NFXB 3Q3KB 1HZ8A 3V65B 1ATAA 2WPIE 1CCFA 1HAEA 1IP0A 1ATDA 4JYVL 2YGPA 2J4IB 2KNIA 3HO4A 2PUQL 4COXA 4BXWA 1DDXA 1G1SA 4O02B 1G2MB 2P3FL 2P3FN 1LPZA 2P26A 4D0EA 3POYA 3MDLA 5JB9E 2W2PE 3LTFB 1F0SB 3TH3L 2OYEP 1J9CL 3LC3B 3QH0A 1OB1C 4ZXXL 1YGCL 1EQHA 4LMFA 2NPRA 4NG9L 4RRXA 2P95L 3BPSE 4Z0KB 1NT0A 2FD6A 1IQNL 3S6XA 2W2QE 1DVAL 2JKHL 1HRFA 1P0SL 1XDTR 2BOXA 2Y80B 2J34B 2VH0B 2W86A 4JZDL 1CEJA 2Y5HL 1L3YA 3TZIA 1I0UA 2RA0L 4MMXB 1BF9A 3CFWA 1ATBA 1QFKL 4CUFA 4RRZA 5F19A 2MGPA 3FBYA 1ADXA 4M11A 1XKAL 2W2ME 1FAKL 1APOA 3NJPC 5L30L 3R05A 2VVVL 3KK6A 1HAFA 3EGFA 3LN0A 1FFMA 1EAIC 3SW2A 4X8TL 1IQKL 4O1ZA 1HT8A 2K2TA 2FZZL 1G1QA 3GCXE 4OTYA 4RUTA 2Y5GL 1UZKA 2AYLA 4RRWA 2Y81B 3CENL 4JYUL 2ADXA 3QMOA 4BTIA 1N7DA 1G1RA 1KSNB 1EQGA 4BTTA 3HPTA 1UZJA 2BOUA 5L2ZL 1JL9A 1EMNA 1W7XL 5JBAE 4OTJA 1IOXA 2KL7A 2KV4A 3ZYGA 1CQEA 3HS7A 1SZBA 3NTGA 4CUDA 2BMGA 3QCWA 2XBXL 4FM5A 1M1XB 1IQFL 2WYGB 2Y7XB 1V3XB 2I9BA 3LN1A 6COXA 1APQA 4Y71B 5CKQA 4ZXYL 2XC5L 2YGOA 1EBVA 1LPGA 1NFYB 3LIWB 2XBVL 1EPIA 5KN5C 4A94C 1AUTL 1C5MF 5JVYA 4C16A 2W26B 1XKBA 5JVZA 3HO5A 1FSBA 3FCSB 1DQBA 2VH6B 2D1JB 3N8YB 2K2SB 2H9EL 5IKRA 4Y79B 4JZEL 1TPGA 1IQEL 4NA9L 5FDQA 4Z6AL 1PXXA 4TGFA 1HREA 1CVWL 2RHPA 2UWPB 2WFXB 1LPKA 2VVCK 2VWOL 1EGFA 3N8XA 3KQBL 2W3IB 3N8VA 2F9BL 2J38B 3BT1A 5L2YL 2WZPP 2VJ3A 2EI6B 4YT6L 5JBCE 2BOHA 3N8ZA 3M36L 2XBYL 1G1TA 2DDUA 4Y6DB 2P3UA 1GK5A 5I46L 2P3TA 1W8BL 1EMOA 1KLOA 5JB8E 3LAQA 2H9EC 3TK5B 1KLIL 1ATEA 3U7UG 3KQDL 3KQCL 3RR3A 1TLEA 5JW1A 4RS0A 2WPKE 4X8VL 3N8WA 4BTUA 4D90A 1RFNB 1EZQB 3CS7L 1F7MA 1F7EA 1IQHL 3KRKA 1HX2A 2J95B 2W2NE 3DEMA 4BDWA 4XL1A 5CKMA 4MMYB 1WHEA 2P16L 1N1IA 2M74A 2Y38A 3TK6B 1CCVA 4CUEA 3ZYIB 5E8DA 2OYUP 3OLTA 2WYJB 1P9JA 1IVOC 2UWLB 1JBUL 3KL6B 4XBMA 2FLGA 3GISX 4ZAEB 4NGAL 2VWLL 2PR3B 1X7AL 2I9AA 2WFTA 2BQWA 4Y7BB 1PGEA 1IGZA 4BDXA 1G2LB 1LMJA 2EI7B 4D0FA 2Q1JB 1ZAQA 1WU1B 2CJIB 3TGFA 1NZIA 3HO3A 3LTGD 1Z6EL 4YT7L 2W3KB 3KQEL 1NQLB 5K0HB 3NT1A 3SOVA 1IQLL 1YO8A 1IJQA 2P94L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWO B;  1U67 A;  3IIT B;  4CSY A;  2BO2 A;  3OLU A;  4XLW A;  2BZ6 L;  2RNL A;  1HT5 A;  4MMZ B;  1YUK B;  5F1A A;  3SOQ A;  2J2U B;  4RRY A;  1KLJ L;  5CKN A;  2KB9 A;  1IQJ L;  3U73 A;  3MQE A;  1EPG A;  1URK A;  5EGM B;  2Y7Z B;  3N8Y A;  4YZU B;  1CVU A;  1MOX C;  1UZP A;  4E1G A;  4X8S L;  3HS5 A;  4Y7A B;  1IQM L;  1LQD A;  2P28 B;  4Y76 B;  1YUG A;  2VVU L;  3P5B L;  1CX2 A;  3F6U L;  3PGH A;  1KIG L;  3ZYJ B;  3FFG L;  5IKQ A;  1FF7 A;  3ELA L;  1DIY A;  2WPL E;  1JV2 B;  2WPJ E;  2FLR L;  1IQI L;  2BOK L;  3NTB A;  3N8W B;  2PHB B;  3KCG L;  3IJE B;  1HJ7 A;  4BXS A;  1A3P A;  1HCG B;  1UZQ A;  1IOE L;  1PFX L;  2VWN L;  1YUF A;  1DX5 I;  2WPM E;  4JZF L;  3TBD A;  3H5C B;  5IKV A;  2MGR A;  1EPH A;  1K36 A;  4ZH8 B;  1PRH A;  2FLB L;  1L5G B;  2P93 L;  2XBW L;  4PH9 A;  1PTH A;  2Y5F L;  3GCW E;  1FAX L;  2WG4 B;  4ISI L;  2GD4 A;  3C9A C;  4AQT A;  5KIR A;  3HS6 A;  1O5D L;  1FE2 A;  2XC4 L;  2W2O E;  3BT2 A;  2BQ6 A;  3ENS A;  1NFW B;  3Q7D A;  3ASI A;  5JBB E;  4M10 A;  1MQ5 L;  4ZHA B;  1EPJ A;  1Q4G A;  2Y82 B;  1U8C B;  2VWM K;  2TGF A;  1NFU B;  4A7I A;  1WHF A;  1FJS L;  2MHP A;  1IQG L;  1TOZ A;  2WPH E;  2B7D L;  2WG3 C;  2J94 B;  2G00 L;  2XC0 L;  4G1M B;  4X8U L;  2BQ7 A;  1COU A;  3CA7 A;  1IGX A;  3K9X A;  1K37 A;  3F1S B;  4ISH L;  5COX A;  1B9W A;  1NPE B;  1Z6C A;  3SOB B;  4Z0L A;  2EI8 B;  1MQ6 L;  5CIS A;  1F0R B;  3V64 C;  1XFE A;  5IKT A;  3LC5 B;  3M37 L;  4LOR A;  1NFX B;  3Q3K B;  1HZ8 A;  3V65 B;  1ATA A;  2WPI E;  1CCF A;  1HAE A;  1IP0 A;  1ATD A;  4JYV L;  2YGP A;  2J4I B;  4COX A;  3HO4 A;  2PUQ L;  4BXW A;  1DDX A;  1G1S A;  4O02 B;  1G2M B;  2P3F L;  2P3F N;  1LPZ A;  2P26 A;  4D0E A;  3POY A;  3MDL A;  5JB9 E;  2W2P E;  3LTF B;  1F0S B;  3TH3 L;  2OYE P;  1J9C L;  3LC3 B;  3QH0 A;  1OB1 C;  4ZXX L;  1YGC L;  1EQH A;  4LMF A;  2NPR A;  4NG9 L;  4RRX A;  2P95 L;  3BPS E;  4Z0K B;  1NT0 A;  2FD6 A;  1IQN L;  2W2Q E;  1DVA L;  2JKH L;  1HRF A;  1P0S L;  1XDT R;  2BOX A;  2Y80 B;  2J34 B;  2VH0 B;  2W86 A;  4JZD L;  1CEJ A;  2Y5H L;  1L3Y A;  3TZI A;  1I0U A;  2RA0 L;  4MMX B;  1BF9 A;  3CFW A;  1ATB A;  1QFK L;  4CUF A;  4RRZ A;  5F19 A;  2MGP A;  3FBY A;  1ADX A;  4M11 A;  1XKA L;  2W2M E;  1FAK L;  1APO A;  3NJP C;  5L30 L;  3R05 A;  2VVV L;  3KK6 A;  1HAF A;  3EGF A;  3LN0 A;  1FFM A;  1EAI C;  3SW2 A;  4X8T L;  1IQK L;  4O1Z A;  1HT8 A;  2K2T A;  2FZZ L;  1G1Q A;  3GCX E;  4OTY A;  4RUT A;  2Y5G L;  1UZK A;  2AYL A;  4RRW A;  2Y81 B;  3CEN L;  4JYU L;  2ADX A;  3QMO A;  4BTI A;  1N7D A;  1G1R A;  1KSN B;  1EQG A;  4BTT A;  3HPT A;  1UZJ A;  2BOU A;  5L2Z L;  1JL9 A;  1EMN A;  1W7X L;  5JBA E;  4OTJ A;  1IOX A;  2KL7 A;  2KV4 A;  3ZYG A;  1CQE A;  3HS7 A;  1SZB A;  3NTG A;  4CUD A;  2BMG A;  3QCW A;  2XBX L;  4FM5 A;  1M1X B;  1IQF L;  2WYG B;  2Y7X B;  1V3X B;  2I9B A;  3LN1 A;  6COX A;  1APQ A;  4Y71 B;  5CKQ A;  4ZXY L;  2XC5 L;  2YGO A;  1EBV A;  1LPG A;  1NFY B;  3LIW B;  2XBV L;  1EPI A;  5KN5 C;  1AUT L;  1C5M F;  5JVY A;  4C16 A;  2W26 B;  1XKB A;  5JVZ A;  3HO5 A;  1FSB A;  3FCS B;  1DQB A;  2VH6 B;  2D1J B;  3N8Y B;  2K2S B;  2H9E L;  5IKR A;  4Y79 B;  4JZE L;  1TPG A;  1IQE L;  4NA9 L;  5FDQ A;  4Z6A L;  1PXX A;  4TGF A;  1HRE A;  1CVW L;  2RHP A;  2UWP B;  2WFX B;  1LPK A;  2VVC K;  2VWO L;  1EGF A;  3N8X A;  3KQB L;  2W3I B;  3N8V A;  2F9B L;  2J38 B;  3BT1 A;  5L2Y L;  2VJ3 A;  2EI6 B;  4YT6 L;  5JBC E;  2BOH A;  3N8Z A;  3M36 L;  2XBY L;  1G1T A;  2DDU A;  4Y6D B;  2P3U A;  1GK5 A;  5I46 L;  2P3T A;  1W8B L;  1EMO A;  1KLO A;  5JB8 E;  3LAQ A;  3TK5 B;  1KLI L;  1ATE A;  3U7U G;  3KQD L;  3KQC L;  3RR3 A;  1TLE A;  5JW1 A;  4RS0 A;  2WPK E;  4X8V L;  3N8W A;  4BTU A;  4D90 A;  1RFN B;  1EZQ B;  3CS7 L;  1F7M A;  1F7E A;  1IQH L;  3KRK A;  1HX2 A;  2J95 B;  2W2N E;  3DEM A;  4BDW A;  4XL1 A;  5CKM A;  4MMY B;  1WHE A;  2P16 L;  1N1I A;  2M74 A;  2Y38 A;  3TK6 B;  1CCV A;  4CUE A;  3ZYI B;  5E8D A;  2OYU P;  3OLT A;  2WYJ B;  1P9J A;  1IVO C;  2UWL B;  1JBU L;  3KL6 B;  4XBM A;  2FLG A;  3GIS X;  4ZAE B;  4NGA L;  2VWL L;  2PR3 B;  1X7A L;  2I9A A;  2WFT A;  2BQW A;  4Y7B B;  1PGE A;  1IGZ A;  4BDX A;  1G2L B;  1LMJ A;  2EI7 B;  4D0F A;  2Q1J B;  1ZAQ A;  1WU1 B;  2CJI B;  3TGF A;  1NZI A;  3HO3 A;  3LTG D;  1Z6E L;  4YT7 L;  2W3K B;  3KQE L;  1NQL B;  5K0H B;  3NT1 A;  3SOV A;  1IQL L;  1YO8 A;  1IJQ A;  2P94 L; 
#chains in the Genus database with same CATH topology
 2UWO B;  1U67 A;  3IIT B;  4CSY A;  2BO2 A;  3OLU A;  4XLW A;  2BZ6 L;  2RNL A;  1HT5 A;  4MMZ B;  1YUK B;  5F1A A;  3SOQ A;  2J2U B;  4RRY A;  1KLJ L;  5CKN A;  2KB9 A;  1IQJ L;  3U73 A;  1V1H A;  3MQE A;  1EPG A;  1URK A;  5EGM B;  2Y7Z B;  3N8Y A;  4YZU B;  1CVU A;  1MOX C;  1UZP A;  4E1G A;  4X8S L;  3HS5 A;  4Y7A B;  1IQM L;  1LQD A;  2P28 B;  4Y76 B;  1YUG A;  2VVU L;  3P5B L;  1CX2 A;  3F6U L;  3PGH A;  1KIG L;  3ZYJ B;  3FFG L;  5IKQ A;  1FF7 A;  3ELA L;  1DIY A;  2WPL E;  1JV2 B;  2WPJ E;  2BT7 A;  2FLR L;  1IQI L;  2BOK L;  3NTB A;  3N8W B;  2PHB B;  3KCG L;  3IJE B;  1HJ7 A;  4BXS A;  1A3P A;  1HCG B;  1UZQ A;  1IOE L;  1PFX L;  2VWN L;  1YUF A;  1V1I A;  1DX5 I;  2WPM E;  4JZF L;  3TBD A;  3H5C B;  5IKV A;  2MGR A;  1EPH A;  1K36 A;  4ZH8 B;  1PRH A;  2FLB L;  1L5G B;  2P93 L;  2XBW L;  4PH9 A;  1PTH A;  2Y5F L;  3GCW E;  1FAX L;  2WG4 B;  4ISI L;  2GD4 A;  3C9A C;  4AQT A;  5KIR A;  3HS6 A;  1O5D L;  1FE2 A;  2XC4 L;  2W2O E;  3BT2 A;  2BQ6 A;  3ENS A;  1NFW B;  3Q7D A;  3ASI A;  5JBB E;  4M10 A;  1MQ5 L;  4ZHA B;  1EPJ A;  1Q4G A;  2Y82 B;  1LMM A;  1U8C B;  2VWM K;  2TGF A;  1NFU B;  4A7I A;  1WHF A;  1FJS L;  2MHP A;  1IQG L;  1TOZ A;  2WPH E;  2B7D L;  2WG3 C;  2J94 B;  2G00 L;  2XC0 L;  4G1M B;  4X8U L;  2YGQ A;  1LK9 A;  2BQ7 A;  1COU A;  3CA7 A;  1IGX A;  3K9X A;  1K37 A;  3F1S B;  4ISH L;  5COX A;  1B9W A;  1NPE B;  1Z6C A;  3SOB B;  4Z0L A;  2EI8 B;  1MQ6 L;  5CIS A;  1F0R B;  3V64 C;  1XFE A;  5IKT A;  3LC5 B;  3M37 L;  4LOR A;  1NFX B;  3Q3K B;  1HZ8 A;  3V65 B;  1ATA A;  2WPI E;  1CCF A;  1HAE A;  1IP0 A;  1ATD A;  4JYV L;  2YGP A;  2J4I B;  2KNI A;  3HO4 A;  2PUQ L;  4COX A;  4BXW A;  1DDX A;  1G1S A;  4O02 B;  1G2M B;  2P3F L;  2P3F N;  1LPZ A;  2P26 A;  4D0E A;  3POY A;  3MDL A;  5JB9 E;  2W2P E;  3LTF B;  1F0S B;  3TH3 L;  2OYE P;  1J9C L;  3LC3 B;  3QH0 A;  1OB1 C;  4ZXX L;  1YGC L;  1EQH A;  4LMF A;  2HOX A;  2NPR A;  4NG9 L;  4RRX A;  2P95 L;  3BPS E;  4Z0K B;  1NT0 A;  2FD6 A;  1IQN L;  3S6X A;  2W2Q E;  1DVA L;  2JKH L;  1HRF A;  1P0S L;  1QIU A;  1XDT R;  2BOX A;  2Y80 B;  2J34 B;  2VH0 B;  4GU4 A;  2W86 A;  4JZD L;  1CEJ A;  2Y5H L;  1L3Y A;  3TZI A;  1I0U A;  2RA0 L;  4MMX B;  1BF9 A;  3CFW A;  1ATB A;  1QFK L;  4CUF A;  4RRZ A;  5F19 A;  2MGP A;  3FBY A;  1ADX A;  4M11 A;  1XKA L;  2W2M E;  1FAK L;  1APO A;  3NJP C;  5L30 L;  3R05 A;  2JJL A;  2VVV L;  3KK6 A;  1HAF A;  3EGF A;  3LN0 A;  1FFM A;  1EAI C;  3SW2 A;  4X8T L;  1IQK L;  4O1Z A;  1HT8 A;  2K2T A;  2FZZ L;  1G1Q A;  3GCX E;  4OTY A;  4RUT A;  2Y5G L;  1UZK A;  2AYL A;  4RRW A;  2Y81 B;  3CEN L;  4JYU L;  2ADX A;  3QMO A;  4BTI A;  2VRS A;  1N7D A;  1G1R A;  1KSN B;  1EQG A;  4BTT A;  3HPT A;  1UZJ A;  2BOU A;  5L2Z L;  1JL9 A;  1EMN A;  1W7X L;  5JBA E;  4OTJ A;  1IOX A;  2KL7 A;  2KV4 A;  3ZYG A;  1CQE A;  3HS7 A;  1SZB A;  3NTG A;  4CUD A;  2BMG A;  3QCW A;  2XBX L;  4FM5 A;  1M1X B;  1IQF L;  2WYG B;  2Y7X B;  1V3X B;  2I9B A;  3LN1 A;  6COX A;  1APQ A;  4Y71 B;  5CKQ A;  4ZXY L;  2XC5 L;  2YGO A;  4GU3 A;  1EBV A;  1LPG A;  1NFY B;  3LIW B;  2XBV L;  1EPI A;  5KN5 C;  4A94 C;  1AUT L;  1C5M F;  5JVY A;  4C16 A;  2W26 B;  1XKB A;  5JVZ A;  3HO5 A;  1FSB A;  3FCS B;  1DQB A;  2VH6 B;  2D1J B;  3N8Y B;  2K2S B;  2H9E L;  5IKR A;  4Y79 B;  4JZE L;  1TPG A;  1IQE L;  4NA9 L;  5FDQ A;  4Z6A L;  1PXX A;  4TGF A;  1HRE A;  1CVW L;  2BSF A;  2RHP A;  2UWP B;  2WFX B;  2BT8 A;  1LPK A;  2VVC K;  2VWO L;  1EGF A;  3N8X A;  3KQB L;  2W3I B;  3N8V A;  2F9B L;  2J38 B;  2HOR A;  3BT1 A;  5L2Y L;  2WZP P;  2VJ3 A;  2EI6 B;  4YT6 L;  5JBC E;  2BOH A;  3N8Z A;  3M36 L;  2XBY L;  1G1T A;  2DDU A;  4Y6D B;  2P3U A;  1GK5 A;  5I46 L;  2P3T A;  1W8B L;  1EMO A;  1KLO A;  5JB8 E;  3LAQ A;  2H9E C;  3TK5 B;  1KLI L;  1ATE A;  3U7U G;  3KQD L;  3KQC L;  3RR3 A;  1TLE A;  5JW1 A;  4RS0 A;  2WPK E;  4X8V L;  3N8W A;  4BTU A;  4D90 A;  1RFN B;  1EZQ B;  3CS7 L;  1F7M A;  1F7E A;  1IQH L;  3KRK A;  1HX2 A;  2J95 B;  2W2N E;  3DEM A;  4BDW A;  4XL1 A;  5CKM A;  4MMY B;  1WHE A;  2P16 L;  1N1I A;  2M74 A;  2Y38 A;  3TK6 B;  1CCV A;  4CUE A;  3ZYI B;  5E8D A;  2OYU P;  3OLT A;  1KKE A;  2WYJ B;  1P9J A;  1IVO C;  2UWL B;  1JBU L;  3KL6 B;  4XBM A;  2FLG A;  3GIS X;  4ZAE B;  4NGA L;  2VWL L;  2PR3 B;  1X7A L;  2I9A A;  2WFT A;  2BQW A;  4Y7B B;  1PGE A;  1IGZ A;  4BDX A;  1G2L B;  1LMJ A;  2EI7 B;  4D0F A;  2Q1J B;  1ZAQ A;  1WU1 B;  2CJI B;  3TGF A;  1NZI A;  3HO3 A;  3LTG D;  1Z6E L;  4YT7 L;  2W3K B;  3KQE L;  1NQL B;  5K0H B;  3NT1 A;  3SOV A;  1IQL L;  1YO8 A;  1IJQ A;  2P94 L; 
#chains in the Genus database with same CATH homology
 2UWO B;  1U67 A;  3IIT B;  4CSY A;  2BO2 A;  3OLU A;  4XLW A;  2BZ6 L;  2RNL A;  1HT5 A;  4MMZ B;  1YUK B;  5F1A A;  3SOQ A;  2J2U B;  4RRY A;  1KLJ L;  5CKN A;  2KB9 A;  1IQJ L;  3U73 A;  3MQE A;  1EPG A;  1URK A;  5EGM B;  2Y7Z B;  3N8Y A;  4YZU B;  1CVU A;  1MOX C;  1UZP A;  4E1G A;  4X8S L;  3HS5 A;  4Y7A B;  1IQM L;  1LQD A;  2P28 B;  4Y76 B;  1YUG A;  2VVU L;  3P5B L;  1CX2 A;  3F6U L;  3PGH A;  1KIG L;  3ZYJ B;  3FFG L;  5IKQ A;  1FF7 A;  3ELA L;  1DIY A;  2WPL E;  1JV2 B;  2WPJ E;  2FLR L;  1IQI L;  2BOK L;  3NTB A;  3N8W B;  2PHB B;  3KCG L;  3IJE B;  1HJ7 A;  4BXS A;  1A3P A;  1HCG B;  1UZQ A;  1IOE L;  1PFX L;  2VWN L;  1YUF A;  1DX5 I;  2WPM E;  4JZF L;  3TBD A;  3H5C B;  5IKV A;  2MGR A;  1EPH A;  1K36 A;  4ZH8 B;  1PRH A;  2FLB L;  1L5G B;  2P93 L;  2XBW L;  4PH9 A;  1PTH A;  2Y5F L;  3GCW E;  1FAX L;  2WG4 B;  4ISI L;  2GD4 A;  3C9A C;  4AQT A;  5KIR A;  3HS6 A;  1O5D L;  1FE2 A;  2XC4 L;  2W2O E;  3BT2 A;  2BQ6 A;  3ENS A;  1NFW B;  3Q7D A;  3ASI A;  5JBB E;  4M10 A;  1MQ5 L;  4ZHA B;  1EPJ A;  1Q4G A;  2Y82 B;  1LMM A;  1U8C B;  2VWM K;  2TGF A;  1NFU B;  4A7I A;  1WHF A;  1FJS L;  2MHP A;  1IQG L;  1TOZ A;  2WPH E;  2B7D L;  2WG3 C;  2J94 B;  2G00 L;  2XC0 L;  4G1M B;  4X8U L;  2YGQ A;  2BQ7 A;  1COU A;  3CA7 A;  1IGX A;  3K9X A;  1K37 A;  3F1S B;  4ISH L;  5COX A;  1B9W A;  1NPE B;  1Z6C A;  3SOB B;  4Z0L A;  2EI8 B;  1MQ6 L;  5CIS A;  1F0R B;  3V64 C;  1XFE A;  5IKT A;  3LC5 B;  3M37 L;  4LOR A;  1NFX B;  3Q3K B;  1HZ8 A;  3V65 B;  1ATA A;  2WPI E;  1CCF A;  1HAE A;  1IP0 A;  1ATD A;  4JYV L;  2YGP A;  2J4I B;  2KNI A;  3HO4 A;  2PUQ L;  4COX A;  4BXW A;  1DDX A;  1G1S A;  4O02 B;  1G2M B;  2P3F L;  2P3F N;  1LPZ A;  2P26 A;  4D0E A;  3POY A;  3MDL A;  5JB9 E;  2W2P E;  3LTF B;  1F0S B;  3TH3 L;  2OYE P;  1J9C L;  3LC3 B;  3QH0 A;  1OB1 C;  4ZXX L;  1YGC L;  1EQH A;  4LMF A;  2NPR A;  4NG9 L;  4RRX A;  2P95 L;  3BPS E;  4Z0K B;  1NT0 A;  2FD6 A;  1IQN L;  3S6X A;  2W2Q E;  1DVA L;  2JKH L;  1HRF A;  1P0S L;  1XDT R;  2BOX A;  2Y80 B;  2J34 B;  2VH0 B;  2W86 A;  4JZD L;  1CEJ A;  2Y5H L;  1L3Y A;  3TZI A;  1I0U A;  2RA0 L;  4MMX B;  1BF9 A;  3CFW A;  1ATB A;  1QFK L;  4CUF A;  4RRZ A;  5F19 A;  2MGP A;  3FBY A;  1ADX A;  4M11 A;  1XKA L;  2W2M E;  1FAK L;  1APO A;  3NJP C;  5L30 L;  3R05 A;  2VVV L;  3KK6 A;  1HAF A;  3EGF A;  3LN0 A;  1FFM A;  1EAI C;  3SW2 A;  4X8T L;  1IQK L;  4O1Z A;  1HT8 A;  2K2T A;  2FZZ L;  1G1Q A;  3GCX E;  4OTY A;  4RUT A;  2Y5G L;  1UZK A;  2AYL A;  4RRW A;  2Y81 B;  3CEN L;  4JYU L;  2ADX A;  3QMO A;  4BTI A;  1N7D A;  1G1R A;  1KSN B;  1EQG A;  4BTT A;  3HPT A;  1UZJ A;  2BOU A;  5L2Z L;  1JL9 A;  1EMN A;  1W7X L;  5JBA E;  4OTJ A;  1IOX A;  2KL7 A;  2KV4 A;  3ZYG A;  1CQE A;  3HS7 A;  1SZB A;  3NTG A;  4CUD A;  2BMG A;  3QCW A;  2XBX L;  4FM5 A;  1M1X B;  1IQF L;  2WYG B;  2Y7X B;  1V3X B;  2I9B A;  3LN1 A;  6COX A;  1APQ A;  4Y71 B;  5CKQ A;  4ZXY L;  2XC5 L;  2YGO A;  1EBV A;  1LPG A;  1NFY B;  3LIW B;  2XBV L;  1EPI A;  5KN5 C;  4A94 C;  1AUT L;  1C5M F;  5JVY A;  4C16 A;  2W26 B;  1XKB A;  5JVZ A;  3HO5 A;  1FSB A;  3FCS B;  1DQB A;  2VH6 B;  2D1J B;  3N8Y B;  2K2S B;  2H9E L;  5IKR A;  4Y79 B;  4JZE L;  1TPG A;  1IQE L;  4NA9 L;  5FDQ A;  4Z6A L;  1PXX A;  4TGF A;  1HRE A;  1CVW L;  2RHP A;  2UWP B;  2WFX B;  1LPK A;  2VVC K;  2VWO L;  1EGF A;  3N8X A;  3KQB L;  2W3I B;  3N8V A;  2F9B L;  2J38 B;  3BT1 A;  5L2Y L;  2WZP P;  2VJ3 A;  2EI6 B;  4YT6 L;  5JBC E;  2BOH A;  3N8Z A;  3M36 L;  2XBY L;  1G1T A;  2DDU A;  4Y6D B;  2P3U A;  1GK5 A;  5I46 L;  2P3T A;  1W8B L;  1EMO A;  1KLO A;  5JB8 E;  3LAQ A;  2H9E C;  3TK5 B;  1KLI L;  1ATE A;  3U7U G;  3KQD L;  3KQC L;  3RR3 A;  1TLE A;  5JW1 A;  4RS0 A;  2WPK E;  4X8V L;  3N8W A;  4BTU A;  4D90 A;  1RFN B;  1EZQ B;  3CS7 L;  1F7M A;  1F7E A;  1IQH L;  3KRK A;  1HX2 A;  2J95 B;  2W2N E;  3DEM A;  4BDW A;  4XL1 A;  5CKM A;  4MMY B;  1WHE A;  2P16 L;  1N1I A;  2M74 A;  2Y38 A;  3TK6 B;  1CCV A;  4CUE A;  3ZYI B;  5E8D A;  2OYU P;  3OLT A;  2WYJ B;  1P9J A;  1IVO C;  2UWL B;  1JBU L;  3KL6 B;  4XBM A;  2FLG A;  3GIS X;  4ZAE B;  4NGA L;  2VWL L;  2PR3 B;  1X7A L;  2I9A A;  2WFT A;  2BQW A;  4Y7B B;  1PGE A;  1IGZ A;  4BDX A;  1G2L B;  1LMJ A;  2EI7 B;  4D0F A;  2Q1J B;  1ZAQ A;  1WU1 B;  2CJI B;  3TGF A;  1NZI A;  3HO3 A;  3LTG D;  1Z6E L;  4YT7 L;  2W3K B;  3KQE L;  1NQL B;  5K0H B;  3NT1 A;  3SOV A;  1IQL L;  1YO8 A;  1IJQ A;  2P94 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...