2MH8A

Ga-79-mbp cs-rosetta structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
b'NGDKGYNGLAEAKEKAIKDLKIYGIGEHYIKLIEKAKQVAAVEDLKDEILKAHDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GA-79-MBP, maltose binding protein
publication title Subdomain interactions foster the design of two protein pairs with 80% sequence identity but different folds.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Protein binding
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2mh8A00
2J5YA 2N35A 1GABA 2LHGA 2MH8A 1GJSA 2FS1A 2VDBB 1GJTA 2LHCA 1PRBA 2KDLA 2JWSA 1TF0B
chains in the Genus database with same CATH superfamily
2N35A 4P16A 5DNYA 1ORYB 1V33A 1ZQ9A 3B7ZA 3GPYA 2UUAM 4M9SA 2R44A 1K82A 4L4UA 4MGHA 4CISA 2C9CA 2XGNA 4NSOB 1GJTA 1VEGA 4L16A 1XWIA 3HHYA 5DYIA 1OKSA 2BWEA 2MJ5B 2VIIA 2J5YA 2L4FA 2QENA 2D7EA 2ZTCA 3SATA 4LRTA 4WP2A 3U6MA 2KNVA 2XH9A 3UMMA 2X8AA 1GVNA 1XMOM 2DWMA 2DXIA 1NY6A 1R4GA 1NV8A 2WSFF 3WHKA 1WR1B 3HZJA 3SARA 4NXNM 4JI2M 4GKJM 1IBMM 1P3QQ 1YUBA 3TWLA 4ANRA 4M9ZA 1J7KA 2G5GX 2CUZA 4GMQA 3A45A 2APLA 4M0DA 3HU2A 2JY6B 1G41A 2DZNB 3HJSA 1OIPA 1S3SA 2CV2A 4L15A 3HKPA 3B7NA 1Z5CA 3GLGE 4AKGA 3LVWA 5DYGA 3HU1A 3R9XB 4QNRA 4XBOA 3GLIE 4AG5A 1L2BA 1IN7A 2FNAA 2ZAMA 4DBGB 2Z4SA 4MH0E 1DV0A 4X64M 2VF8A 1NJGA 1SXJE 1Z59A 3ZC7B 1VEKA 2AHMA 2OPFA 1OFIA 2DWLA 1VG5A 1SXJC 3AOEA 3I51A 2L6OA 2Z8YM 4KT0F 4LY6A 3U6CA 2LVOC 3KW6A 4LF6M 1TGUA 5EP4A 4CIZA 2KXEA 1HNXM 1HT2E 2LVQD 2K9DA 3FUWA 4DUZM 3PNYA 1IXRC 4JYAM 3H4MA 1AUAA 4HLQA 3RFWA 1QYRA 1XXHE 1YSYA 3C3EA 2CV0A 3GRYA 2F5PA 3KFUG 1N75A 2JZ0A 3CF6E 4D80A 4WW0A 3PNVA 5L8RF 3GLGB 2EKKA 3V76A 2R46A 5JI2E 1EE8A 3PXGA 4IBGA 3RE8A 3GLIB 3FD9A 4LJAA 1NY5A 3FRHA 3ZQJA 2KZUA 4UN2B 4LF8M 5KPZA 3SYLA 4JI3M 2V1UA 1SXJD 2L7IA 3J80S 2OQ4A 3IECA 1QQWA 5EQTA 1SXJB 3GPXA 2F5SA 2ZBKB 2P5TA 2OOAA 3HHZA 1Q02A 2RGOA 3AFHA 4LJ9A 4MM3B 3KXEC 1IBLM 4LFCM 2QQ8A 1N78A 4MB7A 3W0LB 5H37D 1XXHB 4IBJA 1R2YA 3L2AA 1VQ1A 1E94E 2C9OA 4AKIA 4GH9A 3E4RA 4ZPXA 2JY7A 4B7HA 4I8OA 2M60A 4II7A 1QAOA 4BB9A 1JQJC 2KZSA 3J27B 5BPVA 1N34M 3M7GA 1IXSA 1D0KA 2JP7A 4LJ8A 1PJJA 3W67A 4R3DA 3GRVA 1GL6A 2QBYB 4JI8M 4F2LA 2ZANA 2KNAA 1JB0F 1VEJA 1TR8A 1OIZA 2Z7JA 3TQSA 4A3VB 2DAEA 2R4EA 3AL0C 2EA0A 4I81A 1N33M 2DZOB 3D8LA 4FWHA 5KO3A 4BBAA 3Q8XA 3M0EA 2JUJA 3LQRA 4LJ6A 5EXPA 3U6QA 3J7AS 2LHGA 1W5TA 1LTMA 4LFAM 3BOSA 1E9SA 2JNHA 4M9XA 3SC3A 1DGFA 5IT9S 3U61B 1XNQM 1WXQA 4B3MM 4LF4M 4W5WA 3SASA 2LHCA 3MMPA 1I4WA 3JR5A 4F1IA 4IJFA 5LMUM 2CWBA 2ZTDA 2HHHM 1BVSA 1MJGM 4LJ4A 2L7HA 2DHRA 5ITXE 1QANA 1T6OA 4PCZA 3KS4A 1HJPA 1HNZM 5FSWA 1NJFA 1Z5BA 2QNJA 2R0IA 2LVAA 1GKIA 3NBIA 2RKOA 1IXZA 2BJVA 4LZZA 1XNRM 2QCUA 2V1CA 4OVZB 1F4IA 3GLHA 2D7HA 1QUTA 3C3DA 4GHAA 3TPZA 4GKKM 4FCVA 4YHHM 4HEOA 3F92A 4DR5M 3FUUA 4LF5M 3HU3A 5EXTA 4DV0M 3GLGA 3JAMS 3U6SA 3VK8A 4L8RC 4P17A 4JI6M 4OX9M 1NSFA 3GLIA 4B3TM 4AI6A 3HJQA 3K2LA 5IZ7D 2XFSA 4CGYB 1SG9A 2UXDM 1Z5AA 2UU9M 1OAOC 5JI3E 2LVPC 5IWAM 3KP0E 3NBXX 2F4VM 3LVVA 3T6PA 3THGA 4JI5M 2MR9A 4Z6YA 1TH2A 1TDZA 3HY5A 5E6JA 1MN3A 4GC5A 4NL4H 3UGJA 3SMPA 3K92A 4G6ZA 4YY3M 3PFIA 1IY2A 2FE8A 4I5SA 3U6PA 4DR2M 3FE3A 1XXHA 3DA1A 4IJEA 4RF0A 3B89A 2YFQA 4GC9A 1QVRA 3SFZA 5ITRA 5FTMA 4LF9M 1XB2B 1NNUC 1PJQA 2XFTA 2EKFA 2HCBA 3CF0A 4DR6M 4FWGA 1T3TA 3C9PA 1TDHA 1LV7A 2MH8A 2X4AA 3FTFA 2DAGA 4B7GA 4G4NA 2QBYA 1KYIA 2NQ8C 3KP1E 2XSZA 3T15A 3U6DA 1HNWM 2HKJA 2FFJA 4B3SM 2WSEF 2UUCM 3CF2A 5ITYA 4Y28F 1X37A 3U6OA 3K8ZA 3U60B 1OQYA 2D7GA 1KFVA 1PJTA 4PD2A 4ITQA 5C18A 1V34A 2XLJA 4G4RA 1L8QA 3E21A 1GJSA 2DWNA 1DGHA 1OAIA 1R7RA 2H5XA 2C5RA 3FYDA 5A2QS 3SBJA 3HGIA 2DI0A 3M6AA 3OTOM 1WGNA 2L4EA 3HWSA 2XEPA 2ERCA 3U6EA 3H4JA 1C1KA 2R45A 4LG2A 1TF0B 2DVWB 3FUVA 3IG8A 3U6LA 2JY8A 2G3QA 4KODA 3SMSA 5C1BA 2O5RA 3K9PA 2J7NA 5EXSA 3ZH9B 1L1TA 2Y0TA 4LF7M 2LWXA 1PM5A 3DOAA 2Y0QA 4RF1A 4OVZA 4RNAA 4FCTA 4D81A 4DV3M 2WSCF 3A42A 4MGYE 3A46A 1C7YA 2K47A 3AOGA 3KOZE 4G4OA 3J7BA 3LW5F 2BWBA 2GQFA 4FCWA 1G8PA 3J81S 1D2NA 1DGBA 2MGWA 5LMNM 4NXMM 4K0KM 1IN5A 1PGYA 1G4AE 2CFOA 2Y21A 3CGWA 3PVSA 3VLFB 1Q3BA 5ITXA 8CATA 2RRUA 3GRUA 1OJLA 2KHHA 5EJCA 1ZAEA 3KOXE 1IQPA 2CHVA 1NV9A 2DAKA 4FD2A 4B08A 3SAUA 3GPUA 3AOEC 3U5ZB 2KW0A 4S12A 3UJNA 3VFDA 3C58A 3HJ8A 3FTCA 3AJIB 3FKEA 5EP2A 4OU7A 1VDDA 4R71A 1UM8A 3EIEA 4MGKE 2R18A 4MGIE 2I7PA 2C96A 1IN4A 1YE9A 1NO1A 1DO0A 2FS1A 2VDBB 2ZAOA 4LRSA 2DAIA 2G8LA 4FW9A 2XZUA 1FNNA 3A98B 1GABA 3KS8A 4DV4M 2XZFA 4KO8A 4IBIA 4QNMA 5ITUA 4LFBM 1JR3E 3BXWA 2CV1A 4AZFA 4NC6A 2CE7A 4Z8XA 1K3XA 4GHLA 3VKHA 2Y20A 1XHBA 3HHXA 2EUCA 4GITA 1Y8GA 1ZMUA 1QUSA 4KLNA 1TH3A 1TH4A 1NHWC 5EXXA 3U60A 3SHFA 3BBZA 3I4YA 3GLFE 4NRVA 4Q7JA 1PJIA 2CHGA 2R6FA 1DO2A 3KOYE 4WURA 4REZA 2BJWA 3IHPA 5GKNA 4DV1M 3GPPA 1N36M 5F3WA 3L25A 1R6BX 1QZEA 1WGLA 2E5LM 1HQYE 1TTEA 4G4QA 1JR3D 3W0FA 4IBKA 3FYCA 3QYBA 5E26A 4KHPM 2J7OA 3IG5A 1WHCA 3JR4A 2GNOA 2MROB 4PT5A 1GO5A 1UFZA 2F5NA 4JV5M 3I01M 3T1YM 1GLNA 2QSFX 2LXEA 2R4JA 4GRIA 3FRIA 1SXJA 4DV6M 1AIPC 1PRBA 1K3WA 3QAUA 4NSRA 3WHLA 1E9RA 1T43A 2JZ1A 2O01F 4XK8F 3GLFB 1FJGM 5KPRA 2XF3A 5BR8M 3LCVB 3NWLA 2KNZA 2OOBA 2X49A 4IBFA 4OW0A 4QOSA 2FH0A 3GQ3A 4GEWA 3GQ5A 4DR4M 3FTDA 1Q3CA 1G59A 1IXSB 1ZMWA 3MJ5A 2OO9A 4AQYM 3DFZA 1J09A 3ZCBB 2CRUA 2LH0A 3LMMA 1G71A 1D0MA 2QZ4A 3VDPA 2B3TA 4MGZE 4D82A 2Z3XA 1L2CA 4IBEA 2VQFM 3TWKA 4RKUF 4QHSA 5EP1A 2LNHC 5FTKA 1XC8A 4LGMA 2KA6B 3DZDA 1MX0A 1HT1E 3LCUA 3KVWA 3VDUA 2KDLA 4EIWA 3HHWA 2JWSA 4X66M 3TL4X 4AG6A 2L09A 3U5ZA 3GLHE 3E9SA 3Q8GA 4M0WA 3KSXA 2YQZA 2C98A 3MK6A 1V92A 4L78A 1N77A 4PDGA 3K9OA 3L28A 2C99A 1IN6A 3I4VA 3FUXA 3J2PB 3LQQA 5KPTA 2I7NA 2JY5A 4LGYA 3U61A 3FUTA 1HQCA 3B74A 2EO2A 4B7FA 1PJSA 1WIVA 3GRRA 1GL7A 1A5TA 2HL7A 4LJ7A 3AKZA 3ILKA 1ZV1A 1QDTA 1NVMA 1D0LA 4FVMA 3W68A 2DNAA 1EFUB 3KDSE 3RGPA 4DR7M 4XGIA 1IY1A 4LCBA 4JN6A 3CTWB 2QP9X 2DHYA 3B7QA 1IFYA 3GLHB 4AKHA 2VF7A 4QHTA 1IN8A 2Z4RA 3T38A 4DV2M 2H1RA 3SAVA 1H6UA 3VK7A 5DFLA 4NOOB 4DUYM 2L2DA 3TWMA 3MHVC 1NHGC 4NRWA 1RU3A 2R62A 2WZJA 1VDLA 1QDRA 4CJ6A 3B9PA 5KQDA 2QHOB 3E46A 4PDIA 4LZJA 1R2ZA 1QAMA 2K6BA 2F5OA 4IBDA 4JI7M 4X65M 2O25A 2VQEM 1JR3A 3K1JA 5FTNA 2BNKA 3UZUA 3GO8A 5FTLA 4BLCA 1N32M 3T1HM 4L6V6 1G3IA 4JXJA 1MU5A 7CATA 2LBCA 3GLFA 3L27A 3UK6A 5FTJA 5IREB 1NNJA 4GIPA 4I4LA 2ZM6M 2UXBM 1IY0A 5EP3A 4CHTB 4DV7M 1I94M 2KRUA 4DR3M 1WJ7A 1E32A 1QZMA 3QWLA 3FTEA 1Q39A 2XSZD 2CHQA 4DR1M 3SYKA 1QAQA 3GQ4A 3HX3A 2F5QA 5KQ8A 4IBCA 4JI0M 3I04M 1ZMVA 2UXCM 2V6ZM 1HR0M 3EIHA 2YR0A 1L2DA 3RGSA 2R65A 3L26A 1DGGA 2HAKA 2QPAA 3KOWE 3R8FA 1KSFX 1L1ZA 2M5ZA 2KEBA 1OTRA 1YLAA 2KRKA 1DGHB 4B3RM 3TE6A 3VKGA 4X62M 4AW4A 2K0BX 1IBKM 3KSJA 5ITTA 2HWJA 4HL4A 3GP1A 4LJ5A 2EJSA 4TUWA 2LTUA 2DENA 2DKLA 3SHGB 1J5EM 2W82A 2DWZB 3L29A 2DAMA 2UUBM 2JA2A 1OFHA 2CP8A 4QOZC 2A5YB 2YNMD 2CEAA 4JI4M 4G3OA 1CUKA 2RGHA 3QYEA 5ITQA 2Q2EB 4IBBA 1IM2A 3D8BA 4R7GA 4IIWA 4JI1M 2JXNA 2FOIC 5FLXS 2LVNC 4DV5M 1R5LA 4FWDA 1EIJA 1Z6TA 1W5SA 3SAWA 2DZLA 1XMQM 3AV0A
chains in the Genus database with same CATH topology
2J5YA 2N35A 1GABA 2LHGA 2MH8A 1GJSA 2FS1A 2VDBB 1GJTA 2LHCA 1PRBA 2KDLA 2JWSA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Y A;  2N35 A;  1GAB A;  2LHG A;  2MH8 A;  1GJS A;  2FS1 A;  2VDB B;  1GJT A;  2LHC A;  1PRB A;  2KDL A;  2JWS A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 2N35 A;  4P16 A;  5DNY A;  1ORY B;  1V33 A;  1ZQ9 A;  3B7Z A;  3GPY A;  2UUA M;  4M9S A;  2R44 A;  1K82 A;  4L4U A;  4MGH A;  4CIS A;  2C9C A;  2XGN A;  4NSO B;  1GJT A;  1VEG A;  4L16 A;  1XWI A;  3HHY A;  5DYI A;  1OKS A;  2BWE A;  2MJ5 B;  2VII A;  2J5Y A;  2L4F A;  2QEN A;  2D7E A;  2ZTC A;  3SAT A;  4LRT A;  4WP2 A;  3U6M A;  2KNV A;  2XH9 A;  3UMM A;  2X8A A;  1GVN A;  1XMO M;  2DWM A;  2DXI A;  1NY6 A;  1R4G A;  1NV8 A;  2WSF F;  3WHK A;  1WR1 B;  3HZJ A;  3SAR A;  4NXN M;  4JI2 M;  4GKJ M;  1IBM M;  1P3Q Q;  1YUB A;  3TWL A;  4ANR A;  4M9Z A;  1J7K A;  2G5G X;  2CUZ A;  4GMQ A;  3A45 A;  2APL A;  4M0D A;  3HU2 A;  2JY6 B;  1G41 A;  2DZN B;  3HJS A;  1OIP A;  1S3S A;  2CV2 A;  4L15 A;  3HKP A;  3B7N A;  1Z5C A;  3GLG E;  4AKG A;  3LVW A;  5DYG A;  3HU1 A;  3R9X B;  4QNR A;  4XBO A;  3GLI E;  4AG5 A;  1L2B A;  1IN7 A;  2FNA A;  2ZAM A;  4DBG B;  2Z4S A;  4MH0 E;  1DV0 A;  4X64 M;  2VF8 A;  1NJG A;  1SXJ E;  1Z59 A;  3ZC7 B;  1VEK A;  2AHM A;  2OPF A;  1OFI A;  2DWL A;  1VG5 A;  1SXJ C;  3AOE A;  3I51 A;  2L6O A;  2Z8Y M;  4KT0 F;  4LY6 A;  3U6C A;  2LVO C;  3KW6 A;  4LF6 M;  1TGU A;  5EP4 A;  4CIZ A;  2KXE A;  1HNX M;  1HT2 E;  2LVQ D;  2K9D A;  3FUW A;  4DUZ M;  3PNY A;  1IXR C;  4JYA M;  3H4M A;  1AUA A;  4HLQ A;  3RFW A;  1QYR A;  1XXH E;  1YSY A;  3C3E A;  2CV0 A;  3GRY A;  2F5P A;  3KFU G;  1N75 A;  2JZ0 A;  3CF6 E;  4D80 A;  4WW0 A;  3PNV A;  5L8R F;  3GLG B;  2EKK A;  3V76 A;  2R46 A;  5JI2 E;  1EE8 A;  3PXG A;  4IBG A;  3RE8 A;  3GLI B;  3FD9 A;  4LJA A;  1NY5 A;  3FRH A;  3ZQJ A;  2KZU A;  4UN2 B;  4LF8 M;  5KPZ A;  3SYL A;  4JI3 M;  2V1U A;  1SXJ D;  2L7I A;  3J80 S;  2OQ4 A;  3IEC A;  1QQW A;  5EQT A;  1SXJ B;  3GPX A;  2F5S A;  2ZBK B;  2P5T A;  2OOA A;  3HHZ A;  1Q02 A;  2RGO A;  3AFH A;  4LJ9 A;  4MM3 B;  3KXE C;  1IBL M;  4LFC M;  2QQ8 A;  1N78 A;  4MB7 A;  3W0L B;  5H37 D;  1XXH B;  4IBJ A;  1R2Y A;  3L2A A;  1VQ1 A;  1E94 E;  2C9O A;  4AKI A;  4GH9 A;  3E4R A;  4ZPX A;  2JY7 A;  4B7H A;  4I8O A;  2M60 A;  4II7 A;  1QAO A;  4BB9 A;  1JQJ C;  2KZS A;  3J27 B;  5BPV A;  1N34 M;  3M7G A;  1IXS A;  1D0K A;  2JP7 A;  4LJ8 A;  1PJJ A;  3W67 A;  4R3D A;  3GRV A;  1GL6 A;  2QBY B;  4JI8 M;  4F2L A;  2ZAN A;  2KNA A;  1JB0 F;  1VEJ A;  1TR8 A;  1OIZ A;  2Z7J A;  3TQS A;  4A3V B;  2DAE A;  2R4E A;  3AL0 C;  2EA0 A;  4I81 A;  1N33 M;  2DZO B;  3D8L A;  4FWH A;  5KO3 A;  4BBA A;  3Q8X A;  3M0E A;  2JUJ A;  3LQR A;  4LJ6 A;  5EXP A;  3U6Q A;  3J7A S;  2LHG A;  1W5T A;  1LTM A;  4LFA M;  3BOS A;  1E9S A;  2JNH A;  4M9X A;  3SC3 A;  1DGF A;  5IT9 S;  3U61 B;  1XNQ M;  1WXQ A;  4B3M M;  4LF4 M;  4W5W A;  3SAS A;  2LHC A;  3MMP A;  1I4W A;  3JR5 A;  4F1I A;  4IJF A;  5LMU M;  2CWB A;  2ZTD A;  2HHH M;  1BVS A;  1MJG M;  4LJ4 A;  2L7H A;  2DHR A;  5ITX E;  1QAN A;  1T6O A;  4PCZ A;  3KS4 A;  1HJP A;  1HNZ M;  5FSW A;  1NJF A;  1Z5B A;  2QNJ A;  2R0I A;  2LVA A;  1GKI A;  3NBI A;  2RKO A;  1IXZ A;  2BJV A;  4LZZ A;  1XNR M;  2QCU A;  2V1C A;  4OVZ B;  1F4I A;  3GLH A;  2D7H A;  1QUT A;  3C3D A;  4GHA A;  3TPZ A;  4GKK M;  4FCV A;  4YHH M;  4HEO A;  3F92 A;  4DR5 M;  3FUU A;  4LF5 M;  3HU3 A;  5EXT A;  4DV0 M;  3GLG A;  3JAM S;  3U6S A;  3VK8 A;  4L8R C;  4P17 A;  4JI6 M;  4OX9 M;  1NSF A;  3GLI A;  4B3T M;  4AI6 A;  3HJQ A;  3K2L A;  5IZ7 D;  2XFS A;  4CGY B;  1SG9 A;  2UXD M;  1Z5A A;  2UU9 M;  1OAO C;  5JI3 E;  2LVP C;  5IWA M;  3KP0 E;  3NBX X;  2F4V M;  3LVV A;  3T6P A;  3THG A;  4JI5 M;  2MR9 A;  4Z6Y A;  1TH2 A;  1TDZ A;  3HY5 A;  5E6J A;  1MN3 A;  4GC5 A;  4NL4 H;  3UGJ A;  3SMP A;  3K92 A;  4G6Z A;  4YY3 M;  3PFI A;  1IY2 A;  2FE8 A;  4I5S A;  3U6P A;  4DR2 M;  3FE3 A;  1XXH A;  3DA1 A;  4IJE A;  4RF0 A;  3B89 A;  2YFQ A;  4GC9 A;  1QVR A;  3SFZ A;  5ITR A;  5FTM A;  4LF9 M;  1XB2 B;  1NNU C;  1PJQ A;  2XFT A;  2EKF A;  2HCB A;  3CF0 A;  4DR6 M;  4FWG A;  1T3T A;  3C9P A;  1TDH A;  1LV7 A;  2MH8 A;  2X4A A;  3FTF A;  2DAG A;  4B7G A;  4G4N A;  2QBY A;  1KYI A;  2NQ8 C;  3KP1 E;  2XSZ A;  3T15 A;  3U6D A;  1HNW M;  2HKJ A;  2FFJ A;  4B3S M;  2WSE F;  2UUC M;  3CF2 A;  5ITY A;  4Y28 F;  1X37 A;  3U6O A;  3K8Z A;  3U60 B;  1OQY A;  2D7G A;  1KFV A;  1PJT A;  4PD2 A;  4ITQ A;  5C18 A;  1V34 A;  2XLJ A;  4G4R A;  1L8Q A;  3E21 A;  1GJS A;  2DWN A;  1DGH A;  1OAI A;  1R7R A;  2H5X A;  2C5R A;  3FYD A;  5A2Q S;  3SBJ A;  3HGI A;  2DI0 A;  3M6A A;  3OTO M;  1WGN A;  2L4E A;  3HWS A;  2XEP A;  2ERC A;  3U6E A;  3H4J A;  1C1K A;  2R45 A;  4LG2 A;  1TF0 B;  2DVW B;  3FUV A;  3IG8 A;  3U6L A;  2JY8 A;  2G3Q A;  4KOD A;  3SMS A;  5C1B A;  2O5R A;  3K9P A;  2J7N A;  5EXS A;  3ZH9 B;  1L1T A;  2Y0T A;  4LF7 M;  2LWX A;  1PM5 A;  3DOA A;  2Y0Q A;  4RF1 A;  4OVZ A;  4RNA A;  4FCT A;  4D81 A;  4DV3 M;  2WSC F;  3A42 A;  4MGY E;  3A46 A;  1C7Y A;  2K47 A;  3AOG A;  3KOZ E;  4G4O A;  3J7B A;  3LW5 F;  2BWB A;  2GQF A;  4FCW A;  1G8P A;  3J81 S;  1D2N A;  1DGB A;  2MGW A;  5LMN M;  4NXM M;  4K0K M;  1IN5 A;  1PGY A;  1G4A E;  2CFO A;  2Y21 A;  3CGW A;  3PVS A;  3VLF B;  1Q3B A;  5ITX A;  8CAT A;  2RRU A;  3GRU A;  1OJL A;  2KHH A;  5EJC A;  1ZAE A;  3KOX E;  1IQP A;  2CHV A;  1NV9 A;  2DAK A;  4FD2 A;  4B08 A;  3SAU A;  3GPU A;  3AOE C;  3U5Z B;  2KW0 A;  4S12 A;  3UJN A;  3VFD A;  3C58 A;  3HJ8 A;  3FTC A;  3AJI B;  3FKE A;  5EP2 A;  4OU7 A;  1VDD A;  4R71 A;  1UM8 A;  3EIE A;  4MGK E;  2R18 A;  4MGI E;  2I7P A;  2C96 A;  1IN4 A;  1YE9 A;  1NO1 A;  1DO0 A;  2FS1 A;  2VDB B;  2ZAO A;  4LRS A;  2DAI A;  2G8L A;  4FW9 A;  2XZU A;  1FNN A;  3A98 B;  1GAB A;  3KS8 A;  4DV4 M;  2XZF A;  4KO8 A;  4IBI A;  4QNM A;  5ITU A;  4LFB M;  1JR3 E;  3BXW A;  2CV1 A;  4AZF A;  4NC6 A;  2CE7 A;  4Z8X A;  1K3X A;  4GHL A;  3VKH A;  2Y20 A;  1XHB A;  3HHX A;  2EUC A;  4GIT A;  1Y8G A;  1ZMU A;  1QUS A;  4KLN A;  1TH3 A;  1TH4 A;  1NHW C;  5EXX A;  3U60 A;  3SHF A;  3BBZ A;  3I4Y A;  3GLF E;  4NRV A;  4Q7J A;  1PJI A;  2CHG A;  2R6F A;  1DO2 A;  3KOY E;  4WUR A;  4REZ A;  2BJW A;  3IHP A;  5GKN A;  4DV1 M;  3GPP A;  1N36 M;  5F3W A;  3L25 A;  1R6B X;  1QZE A;  1WGL A;  2E5L M;  1HQY E;  1TTE A;  4G4Q A;  1JR3 D;  3W0F A;  4IBK A;  3FYC A;  3QYB A;  5E26 A;  4KHP M;  2J7O A;  3IG5 A;  1WHC A;  3JR4 A;  2GNO A;  2MRO B;  4PT5 A;  1GO5 A;  1UFZ A;  2F5N A;  4JV5 M;  3I01 M;  3T1Y M;  1GLN A;  2QSF X;  2LXE A;  2R4J A;  4GRI A;  3FRI A;  1SXJ A;  4DV6 M;  1AIP C;  1PRB A;  1K3W A;  3QAU A;  4NSR A;  3WHL A;  1E9R A;  1T43 A;  2JZ1 A;  2O01 F;  4XK8 F;  3GLF B;  1FJG M;  5KPR A;  2XF3 A;  5BR8 M;  3LCV B;  3NWL A;  2KNZ A;  2OOB A;  2X49 A;  4IBF A;  4OW0 A;  4QOS A;  2FH0 A;  3GQ3 A;  4GEW A;  3GQ5 A;  4DR4 M;  3FTD A;  1Q3C A;  1G59 A;  1IXS B;  1ZMW A;  3MJ5 A;  2OO9 A;  4AQY M;  3DFZ A;  1J09 A;  3ZCB B;  2CRU A;  2LH0 A;  3LMM A;  1G71 A;  1D0M A;  2QZ4 A;  3VDP A;  2B3T A;  4MGZ E;  4D82 A;  2Z3X A;  1L2C A;  4IBE A;  2VQF M;  3TWK A;  4RKU F;  4QHS A;  5EP1 A;  2LNH C;  5FTK A;  1XC8 A;  4LGM A;  2KA6 B;  3DZD A;  1MX0 A;  1HT1 E;  3LCU A;  3KVW A;  3VDU A;  2KDL A;  4EIW A;  3HHW A;  2JWS A;  4X66 M;  3TL4 X;  4AG6 A;  2L09 A;  3U5Z A;  3GLH E;  3E9S A;  3Q8G A;  4M0W A;  3KSX A;  2YQZ A;  2C98 A;  3MK6 A;  1V92 A;  4L78 A;  1N77 A;  4PDG A;  3K9O A;  3L28 A;  2C99 A;  1IN6 A;  3I4V A;  3FUX A;  3J2P B;  3LQQ A;  5KPT A;  2I7N A;  2JY5 A;  4LGY A;  3U61 A;  3FUT A;  1HQC A;  3B74 A;  2EO2 A;  4B7F A;  1PJS A;  1WIV A;  3GRR A;  1GL7 A;  1A5T A;  2HL7 A;  4LJ7 A;  3AKZ A;  3ILK A;  1ZV1 A;  1QDT A;  1NVM A;  1D0L A;  4FVM A;  3W68 A;  2DNA A;  1EFU B;  3KDS E;  3RGP A;  4DR7 M;  4XGI A;  1IY1 A;  4LCB A;  4JN6 A;  3CTW B;  2QP9 X;  2DHY A;  3B7Q A;  1IFY A;  3GLH B;  4AKH A;  2VF7 A;  4QHT A;  1IN8 A;  2Z4R A;  3T38 A;  4DV2 M;  2H1R A;  3SAV A;  1H6U A;  3VK7 A;  5DFL A;  4NOO B;  4DUY M;  2L2D A;  3TWM A;  3MHV C;  1NHG C;  4NRW A;  1RU3 A;  2R62 A;  2WZJ A;  1VDL A;  1QDR A;  4CJ6 A;  3B9P A;  5KQD A;  2QHO B;  3E46 A;  4PDI A;  4LZJ A;  1R2Z A;  1QAM A;  2K6B A;  2F5O A;  4IBD A;  4JI7 M;  4X65 M;  2O25 A;  2VQE M;  1JR3 A;  3K1J A;  5FTN A;  2BNK A;  3UZU A;  3GO8 A;  5FTL A;  4BLC A;  1N32 M;  3T1H M;  4L6V 6;  1G3I A;  4JXJ A;  1MU5 A;  7CAT A;  2LBC A;  3GLF A;  3L27 A;  3UK6 A;  5FTJ A;  5IRE B;  1NNJ A;  4GIP A;  4I4L A;  2ZM6 M;  2UXB M;  1IY0 A;  5EP3 A;  4CHT B;  4DV7 M;  1I94 M;  2KRU A;  4DR3 M;  1WJ7 A;  1E32 A;  1QZM A;  3QWL A;  3FTE A;  1Q39 A;  2XSZ D;  2CHQ A;  4DR1 M;  3SYK A;  1QAQ A;  3GQ4 A;  3HX3 A;  2F5Q A;  5KQ8 A;  4IBC A;  4JI0 M;  3I04 M;  1ZMV A;  2UXC M;  2V6Z M;  1HR0 M;  3EIH A;  2YR0 A;  1L2D A;  3RGS A;  2R65 A;  3L26 A;  1DGG A;  2HAK A;  2QPA A;  3KOW E;  3R8F A;  1KSF X;  1L1Z A;  2M5Z A;  2KEB A;  1OTR A;  1YLA A;  2KRK A;  1DGH B;  4B3R M;  3TE6 A;  3VKG A;  4X62 M;  4AW4 A;  2K0B X;  1IBK M;  3KSJ A;  5ITT A;  2HWJ A;  4HL4 A;  3GP1 A;  4LJ5 A;  2EJS A;  4TUW A;  2LTU A;  2DEN A;  2DKL A;  3SHG B;  1J5E M;  2W82 A;  2DWZ B;  3L29 A;  2DAM A;  2UUB M;  2JA2 A;  1OFH A;  2CP8 A;  4QOZ C;  2A5Y B;  2YNM D;  2CEA A;  4JI4 M;  4G3O A;  1CUK A;  2RGH A;  3QYE A;  5ITQ A;  2Q2E B;  4IBB A;  1IM2 A;  3D8B A;  4R7G A;  4IIW A;  4JI1 M;  2JXN A;  2FOI C;  5FLX S;  2LVN C;  4DV5 M;  1R5L A;  4FWD A;  1EIJ A;  1Z6T A;  1W5S A;  3SAW A;  2DZL A;  1XMQ M;  3AV0 A; 
#chains in the Genus database with same CATH homology
 2J5Y A;  2N35 A;  1GAB A;  2LHG A;  2MH8 A;  1GJS A;  2FS1 A;  2VDB B;  1GJT A;  2LHC A;  1PRB A;  2KDL A;  2JWS A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...