2MH8A

Ga-79-mbp cs-rosetta structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
b'NGDKGYNGLAEAKEKAIKDLKIYGIGEHYIKLIEKAKQVAAVEDLKDEILKAHDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GA-79-MBP, maltose binding protein
publication title Subdomain interactions foster the design of two protein pairs with 80% sequence identity but different folds.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Protein binding
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2mh8A00
1TF0B 2JWSA 1GJSA 2MH8A 1PRBA 2KDLA 2VDBB 1GABA 2FS1A 2J5YA 2LHGA 1GJTA 2N35A 2LHCA
chains in the Genus database with same CATH superfamily
2Z7JA 3T15A 5C18A 1TTEA 3GPPA 3W67A 1L2BA 2KW0A 4R7GA 2P5TA 1IN4A 4RNAA 3SAUA 4L6V6 4M9XA 1IY1A 2K9DA 3K2LA 4PT5A 4GC9A 1L1ZA 4ZPXA 1WHCA 3W68A 3L28A 5EQTA 3LQRA 4LF7M 1J09A 5EXSA 1N75A 3GQ5A 2QQ8A 4Q7JA 3FTEA 4X62M 2JY6B 3K1JA 4GHAA 2QHOB 4D81A 4LJ5A 4HEOA 4IBKA 2GNOA 1OTRA 1JQJC 1TR8A 2OO9A 3KSXA 3QYBA 2XH9A 1NJGA 2BNKA 2XSZA 4FCWA 2L2DA 2C5RA 2EJSA 4FVMA 2XEPA 3DA1A 2DHYA 3C9PA 1WJ7A 1ZV1A 3C3DA 1QUSA 4FD2A 1T43A 2L7HA 3UK6A 1ZMVA 4DUZM 1OFIA 2BWBA 2CRUA 2CHQA 4FWHA 3RGPA 4OW0A 3U6MA 4X65M 4JI7M 1NY5A 2HAKA 3FD9A 2K47A 2KEBA 4D80A 4NRWA 5ITTA 4I8OA 4HLQA 2QP9X 3LVWA 3ZCBB 2UXBM 3U6SA 4XBOA 3AOGA 1MJGM 4NSOB 4NOOB 4DV1M 4DR3M 1G41A 2C98A 1P3QQ 3KOWE 4LGYA 4DBGB 4RKUF 3LMMA 1R6BX 3L27A 3PVSA 2VF8A 4CGYB 3W0FA 2L7IA 1J5EM 1DO0A 4UN2B 1OQYA 4LJ8A 3HHZA 4M0WA 4MGZE 3BXWA 3HJSA 1NNUC 2ZBKB 4I4LA 1XXHE 3LW5F 4B3TM 2KRUA 3SHGB 4HL4A 2ERCA 2G3QA 2QNJA 1MX0A 2L6OA 3L2AA 4LFAM 3U60B 2Y20A 2LH0A 3B7ZA 3VFDA 4CIZA 1Z5AA 3SMSA 2L4FA 3B7QA 2DVWB 1J7KA 2UUCM 4LG2A 1G3IA 4M9ZA 1IXSB 1LV7A 2QPAA 1C7YA 2JY8A 1V33A 3HY5A 1K3XA 1OFHA 3Q8GA 2CV0A 4JI4M 1XNRM 2A5YB 4NL4H 2VDBB 3SYKA 5KO3A 3HKPA 1EIJA 3JR5A 2XZFA 4JI5M 4CISA 1VDLA 2BJWA 3KXEC 1VG5A 2C96A 1NVMA 2YFQA 3LCUA 1L2DA 1GJSA 4AKGA 3VKGA 1GLNA 2KNVA 4IBDA 4PDIA 1XXHB 5JI2E 3SBJA 4AG5A 1QDRA 4CJ6A 2UUAM 1OJLA 2JWSA 4OX9M 2RGHA 1N77A 3M0EA 1NSFA 1IN5A 3U60A 2KNAA 3CGWA 4LZJA 1E32A 3HJ8A 2XSZD 5DYGA 2LVQD 3QYEA 2EO2A 3GQ3A 1HNWM 1F4IA 2KA6B 1GABA 3U6OA 3KSJA 2OOBA 1R4GA 2K6BA 1OAOC 2QZ4A 4I81A 1IXSA 4IBIA 3KVWA 2C9CA 4P16A 1EE8A 1Q3BA 3R9XB 4QOZC 4L4UA 1I4WA 2WZJA 4B7HA 3KP1E 2R4EA 4JI8M 5FTMA 2H5XA 2R45A 3FRIA 4QOSA 3SAVA 2MR9A 2B3TA 1IBMM 3I51A 4L16A 1PJJA 5DYIA 5FTLA 3T38A 1NY6A 2AHMA 4LCBA 4WW0A 4R3DA 2GQFA 1R2YA 2J7NA 2M5ZA 3J7AS 2D7GA 3AFHA 1XXHA 4AW4A 3SATA 1QQWA 2W82A 4X66M 1G8PA 1ZMWA 3D8LA 3JAMS 5L8RF 3U6LA 1PJIA 2V6ZM 1NJFA 3ZH9B 5F3WA 1QVRA 2JP7A 1D0LA 2LVOC 1VEKA 5IREB 3VDUA 7CATA 3KS8A 4MGKE 2FH0A 2JY5A 1R7RA 1V34A 1JR3E 2HCBA 4OU7A 1T3TA 3TPZA 5ITXA 1N36M 2LTUA 5EXTA 3GPUA 5JI3E 2X8AA 5LMUM 2X4AA 1EFUB 4LJ4A 4GEWA 4LZZA 5GKNA 2CV1A 1QYRA 4IJFA 5A2QS 3AKZA 2ZM6M 3I04M 1XB2B 3B74A 1W5TA 5FLXS 2J7OA 3VK8A 1VQ1A 1WIVA 3V76A 2XGNA 4MH0E 3THGA 3U6QA 2VQFM 4IIWA 3I01M 4AKIA 1IM2A 1ORYB 3FUVA 2DAIA 4GC5A 4REZA 1TH4A 2MROB 4NRVA 5BPVA 3MMPA 2LXEA 3DFZA 3HWSA 4X64M 3E9SA 1QANA 5IT9S 4DR2M 1QAQA 2M60A 1BVSA 3AL0C 3CF0A 4XGIA 3GP1A 4DV6M 2CEAA 2DWLA 1UFZA 2HL7A 2DZOB 4K0KM 2Y0TA 3GRRA 2Y21A 1Q02A 5BR8M 1QAOA 3VDPA 4G4RA 3HX3A 3QWLA 4IJEA 5FSWA 2ZTDA 2CFOA 1GJTA 2F5OA 3HHWA 2R18A 2DAEA 4Y28F 3FRHA 3VK7A 1X37A 2L09A 3SFZA 3A98B 3NWLA 5DFLA 1WXQA 2DAGA 2YQZA 3K9PA 1NHGC 2VQEM 3KOYE 2FOIC 4JI1M 4GIPA 2WSEF 2DZLA 2QCUA 2DWMA 3SASA 2DWNA 2QBYB 1VEGA 4DR5M 4IBJA 3HU1A 4GHLA 2CHGA 2J5YA 4XK8F 1GO5A 1Q39A 3JR4A 1PJTA 3GLGE 1C1KA 4MGYE 1JR3A 3IG8A 3GLIB 3UJNA 1PJQA 1QUTA 4JN6A 2LHCA 3T1YM 1HR0M 2MH8A 5EP1A 1PRBA 1HNZM 1XNQM 4FW9A 4AQYM 4KT0F 4DV4M 2VIIA 1XMQM 2JXNA 2V1UA 2UXDM 1Z6TA 4NSRA 2V1CA 2G5GX 4LF5M 2D7EA 2CV2A 3VKHA 4LFCM 4WURA 3HZJA 4DR7M 2ZAMA 2QSFX 2JZ1A 2CE7A 1G4AE 2R65A 3HGIA 4RF0A 3R8FA 1DGHB 4IBCA 2DNAA 5ITXE 3AJIB 2JUJA 3J80S 1XMOM 2QBYA 4F2LA 2XZUA 1YLAA 1HNXM 1HT2E 2RRUA 5KPRA 3GLGB 4LF9M 4AZFA 4JV5M 1R5LA 3SHFA 3TE6A 1YUBA 2C99A 1VEJA 3GLIA 1OKSA 3HU2A 3K9OA 5KPTA 1XHBA 4JI2M 3FUTA 2UU9M 2R0IA 1WGLA 3FYCA 4LJ9A 5IZ7D 3PXGA 5ITUA 2XFSA 2O5RA 1NHWC 3Q8XA 2LNHC 4MB7A 4QHTA 2CWBA 2O01F 3A42A 4GH9A 1XC8A 1IBKM 1MU5A 4QNRA 3UMMA 1GKIA 3GRYA 1WGNA 4F1IA 2WSCF 4G3OA 3L29A 3HJQA 3FUWA 4JI0M 1DGHA 2ZANA 3GLFA 1TF0B 2KZSA 3U5ZB 4LJAA 5FTKA 3J81S 2EA0A 3GLGA 1PM5A 1KFVA 4B7FA 4LRTA 5KQ8A 4II7A 3RGSA 1Q3CA 2XLJA 2VF7A 1V92A 3B89A 2Q2EB 2HKJA 2DI0A 2DKLA 2H1RA 4IBFA 2E5LM 3J7BA 5FTNA 3GLHE 4IBGA 1SG9A 1NO1A 3SAWA 4TUWA 4GKKM 1K82A 3AOEA 5DNYA 1Z59A 3KW6A 2Z3XA 1JR3D 2JZ0A 8CATA 3UGJA 3SMPA 4QHSA 1TDHA 4NXNM 1ZAEA 2I7NA 3DOAA 3FE3A 1AIPC 2Z4SA 3FYDA 5IWAM 3SYLA 3U5ZA 1K3WA 4JI6M 2UXCM 4YHHM 2F5QA 1KSFX 3NBIA 4NXMM 2N35A 2CUZA 3E46A 3T1HM 4FWGA 2D7HA 4DV5M 5EP4A 2F5SA 2LVPC 1DGGA 2XFTA 2G8LA 2QENA 2MJ5B 4ITQA 2Z8YM 3FUXA 1VDDA 3GLHB 1PGYA 3KS4A 3M6AA 1TDZA 1D0KA 2KHHA 4AKHA 1L1TA 2K0BX 4DV7M 1L8QA 1HT1E 1OIZA 4D82A 3AOEC 3E21A 3FTCA 4LGMA 1SXJE 1YSYA 1GL7A 5EP3A 3WHKA 1G59A 3GLFE 4LF4M 3U61B 3M7GA 1IY0A 1KYIA 2DWZB 5E26A 4PDGA 4MGIE 3GLIE 4LF8M 2YR0A 4JXJA 3BOSA 5LMNM 1N33M 4PCZA 4DV3M 3TQSA 3I4VA 1L2CA 2FE8A 4ANRA 3H4JA 2YNMD 1MN3A 1YE9A 4JYAM 3FTDA 4AG6A 1CUKA 2CHVA 1A5TA 4LY6A 3GPYA 5EXXA 1RU3A 4DR1M 4L8RC 2WSFF 2ZAOA 3HHYA 3H4MA 3GLHA 4G4QA 2LHGA 4G6ZA 3KOZE 2F5PA 4L78A 2L4EA 3PNVA 1FJGM 4DUYM 1JB0F 5ITYA 4I5SA 4LFBM 1AUAA 4AI6A 2EUCA 3C3EA 4YY3M 2O25A 1T6OA 1Y8GA 3IECA 3CF2A 1OAIA 1D2NA 1SXJB 4KODA 3AV0A 3MHVC 3GLFB 3U61A 5H37D 2LBCA 4IBEA 3F92A 2X49A 3ILKA 3C58A 2KZUA 3ZQJA 1IQPA 1D0MA 3E4RA 1R2ZA 4FCVA 1QZMA 3EIEA 3EIHA 4LJ7A 1TH2A 3PNYA 4A3VB 3TWKA 1ZQ9A 5EP2A 2JY7A 2KXEA 4M0DA 4M9SA 1IFYA 3TWLA 4GKJM 1DGFA 1HJPA 2JNHA 3ZC7B 3L26A 1IN7A 4G4NA 4S12A 3GQ4A 2JA2A 4B7GA 1NV9A 2DENA 3TWMA 4LF6M 4KHPM 3LVVA 5KQDA 4MGHA 1SXJA 2DHRA 2LVNC 3GPXA 2DAKA 1QAMA 3D8BA 3DZDA 1GL6A 4QNMA 1Z5BA 3CF6E 1WR1B 4B08A 3GRVA 1IN8A 1DGBA 3IG5A 4Z6YA 3FTFA 1N32M 1N78A 3J2PB 4DV2M 1GVNA 3QAUA 1NV8A 4GITA 4PD2A 3SARA 4RF1A 2LWXA 2Y0QA 4WP2A 3U6DA 1QZEA 3K92A 2R62A 5ITQA 4B3SM 1HQYE 3TL4X 3VLFB 2HHHM 4GRIA 3A46A 1H6UA 4DR4M 2C9OA 2FNAA 3FKEA 2R4JA 3UZUA 4KO8A 4KLNA 3NBXX 1IXRC 4JI3M 4R71A 4DR6M 2R46A 4L15A 4W5WA 5ITRA 2OQ4A 5EXPA 3MK6A 4B3MM 3OTOM 3U6PA 1ZMUA 3IHPA 4BBAA 3J27B 3HU3A 2BWEA 1SXJC 1TH3A 4Z8XA 3SC3A 1PJSA 1IN6A 3KDSE 3I4YA 4G4OA 2KRKA 3KOXE 1LTMA 5KPZA 2EKFA 2EKKA 2NQ8C 4IBBA 2RGOA 2DAMA 1E9RA 1TGUA 1IY2A 2I7PA 3FUUA 3RFWA 4OVZB 1XWIA 2OOAA 3U6EA 4MM3B 5FTJA 1N34M 1DV0A 2R6FA 1HQCA 3CTWB 4LJ6A 1E94E 1FNNA 3L25A 1Z5CA 1G71A 1NNJA 2FFJA 3LQQA 4FWDA 3RE8A 2KNZA 4LRSA 2HWJA 2RKOA 4P17A 1QDTA 2APLA 2FS1A 3PFIA 3W0LB 1OIPA 5E6JA 2XF3A 2MGWA 3A45A 3GRUA 3KP0E 3T6PA 3GO8A 3LCVB 1DO2A 2ZTCA 5EJCA 1IXZA 1E9SA 4CHTB 5C1BA 4NC6A 3HHXA 2F4VM 1I94M 2BJVA 3K8ZA 3BBZA 2KDLA 3B9PA 2DZNB 1IBLM 2CP8A 1S3SA 1W5SA 3B7NA 4OVZA 4BB9A 1UM8A 2F5NA 4B3RM 4BLCA 2DXIA 4GMQA 3KFUG 2OPFA 1SXJD 2LVAA 4DV0M 3WHLA 3U6CA 2R44A 4EIWA 2Z4RA 2UUBM 4FCTA 3MJ5A
chains in the Genus database with same CATH topology
1TF0B 2JWSA 1GJSA 2MH8A 1PRBA 2KDLA 2VDBB 1GABA 2FS1A 2J5YA 2LHGA 1GJTA 2N35A 2LHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF0 B;  2JWS A;  1GJS A;  2MH8 A;  1PRB A;  2KDL A;  2VDB B;  1GAB A;  2FS1 A;  2J5Y A;  2LHG A;  1GJT A;  2N35 A;  2LHC A; 
#chains in the Genus database with same CATH topology
 2Z7J A;  3T15 A;  5C18 A;  1TTE A;  3GPP A;  3W67 A;  1L2B A;  2KW0 A;  4R7G A;  2P5T A;  1IN4 A;  4RNA A;  3SAU A;  4L6V 6;  4M9X A;  1IY1 A;  2K9D A;  3K2L A;  4PT5 A;  4GC9 A;  1L1Z A;  4ZPX A;  1WHC A;  3W68 A;  3L28 A;  5EQT A;  3LQR A;  4LF7 M;  1J09 A;  5EXS A;  1N75 A;  3GQ5 A;  2QQ8 A;  4Q7J A;  3FTE A;  4X62 M;  2JY6 B;  3K1J A;  4GHA A;  2QHO B;  4D81 A;  4LJ5 A;  4HEO A;  4IBK A;  2GNO A;  1OTR A;  1JQJ C;  1TR8 A;  2OO9 A;  3KSX A;  3QYB A;  2XH9 A;  1NJG A;  2BNK A;  2XSZ A;  4FCW A;  2L2D A;  2C5R A;  2EJS A;  4FVM A;  2XEP A;  3DA1 A;  2DHY A;  3C9P A;  1WJ7 A;  1ZV1 A;  3C3D A;  1QUS A;  4FD2 A;  1T43 A;  2L7H A;  3UK6 A;  1ZMV A;  4DUZ M;  1OFI A;  2BWB A;  2CRU A;  2CHQ A;  4FWH A;  3RGP A;  4OW0 A;  3U6M A;  4X65 M;  4JI7 M;  1NY5 A;  2HAK A;  3FD9 A;  2K47 A;  2KEB A;  4D80 A;  4NRW A;  5ITT A;  4I8O A;  4HLQ A;  2QP9 X;  3LVW A;  3ZCB B;  2UXB M;  3U6S A;  4XBO A;  3AOG A;  1MJG M;  4NSO B;  4NOO B;  4DV1 M;  4DR3 M;  1G41 A;  2C98 A;  1P3Q Q;  3KOW E;  4LGY A;  4DBG B;  4RKU F;  3LMM A;  1R6B X;  3L27 A;  3PVS A;  2VF8 A;  4CGY B;  3W0F A;  2L7I A;  1J5E M;  1DO0 A;  4UN2 B;  1OQY A;  4LJ8 A;  3HHZ A;  4M0W A;  4MGZ E;  3BXW A;  3HJS A;  1NNU C;  2ZBK B;  4I4L A;  1XXH E;  3LW5 F;  4B3T M;  2KRU A;  3SHG B;  4HL4 A;  2ERC A;  2G3Q A;  2QNJ A;  1MX0 A;  2L6O A;  3L2A A;  4LFA M;  3U60 B;  2Y20 A;  2LH0 A;  3B7Z A;  3VFD A;  4CIZ A;  1Z5A A;  3SMS A;  2L4F A;  3B7Q A;  2DVW B;  1J7K A;  2UUC M;  4LG2 A;  1G3I A;  4M9Z A;  1IXS B;  1LV7 A;  2QPA A;  1C7Y A;  2JY8 A;  1V33 A;  3HY5 A;  1K3X A;  1OFH A;  3Q8G A;  2CV0 A;  4JI4 M;  1XNR M;  2A5Y B;  4NL4 H;  2VDB B;  3SYK A;  5KO3 A;  3HKP A;  1EIJ A;  3JR5 A;  2XZF A;  4JI5 M;  4CIS A;  1VDL A;  2BJW A;  3KXE C;  1VG5 A;  2C96 A;  1NVM A;  2YFQ A;  3LCU A;  1L2D A;  1GJS A;  4AKG A;  3VKG A;  1GLN A;  2KNV A;  4IBD A;  4PDI A;  1XXH B;  5JI2 E;  3SBJ A;  4AG5 A;  1QDR A;  4CJ6 A;  2UUA M;  1OJL A;  2JWS A;  4OX9 M;  2RGH A;  1N77 A;  3M0E A;  1NSF A;  1IN5 A;  3U60 A;  2KNA A;  3CGW A;  4LZJ A;  1E32 A;  3HJ8 A;  2XSZ D;  5DYG A;  2LVQ D;  3QYE A;  2EO2 A;  3GQ3 A;  1HNW M;  1F4I A;  2KA6 B;  1GAB A;  3U6O A;  3KSJ A;  2OOB A;  1R4G A;  2K6B A;  1OAO C;  2QZ4 A;  4I81 A;  1IXS A;  4IBI A;  3KVW A;  2C9C A;  4P16 A;  1EE8 A;  1Q3B A;  3R9X B;  4QOZ C;  4L4U A;  1I4W A;  2WZJ A;  4B7H A;  3KP1 E;  2R4E A;  4JI8 M;  5FTM A;  2H5X A;  2R45 A;  3FRI A;  4QOS A;  3SAV A;  2MR9 A;  2B3T A;  1IBM M;  3I51 A;  4L16 A;  1PJJ A;  5DYI A;  5FTL A;  3T38 A;  1NY6 A;  2AHM A;  4LCB A;  4WW0 A;  4R3D A;  2GQF A;  1R2Y A;  2J7N A;  2M5Z A;  3J7A S;  2D7G A;  3AFH A;  1XXH A;  4AW4 A;  3SAT A;  1QQW A;  2W82 A;  4X66 M;  1G8P A;  1ZMW A;  3D8L A;  3JAM S;  5L8R F;  3U6L A;  1PJI A;  2V6Z M;  1NJF A;  3ZH9 B;  5F3W A;  1QVR A;  2JP7 A;  1D0L A;  2LVO C;  1VEK A;  5IRE B;  3VDU A;  7CAT A;  3KS8 A;  4MGK E;  2FH0 A;  2JY5 A;  1R7R A;  1V34 A;  1JR3 E;  2HCB A;  4OU7 A;  1T3T A;  3TPZ A;  5ITX A;  1N36 M;  2LTU A;  5EXT A;  3GPU A;  5JI3 E;  2X8A A;  5LMU M;  2X4A A;  1EFU B;  4LJ4 A;  4GEW A;  4LZZ A;  5GKN A;  2CV1 A;  1QYR A;  4IJF A;  5A2Q S;  3AKZ A;  2ZM6 M;  3I04 M;  1XB2 B;  3B74 A;  1W5T A;  5FLX S;  2J7O A;  3VK8 A;  1VQ1 A;  1WIV A;  3V76 A;  2XGN A;  4MH0 E;  3THG A;  3U6Q A;  2VQF M;  4IIW A;  3I01 M;  4AKI A;  1IM2 A;  1ORY B;  3FUV A;  2DAI A;  4GC5 A;  4REZ A;  1TH4 A;  2MRO B;  4NRV A;  5BPV A;  3MMP A;  2LXE A;  3DFZ A;  3HWS A;  4X64 M;  3E9S A;  1QAN A;  5IT9 S;  4DR2 M;  1QAQ A;  2M60 A;  1BVS A;  3AL0 C;  3CF0 A;  4XGI A;  3GP1 A;  4DV6 M;  2CEA A;  2DWL A;  1UFZ A;  2HL7 A;  2DZO B;  4K0K M;  2Y0T A;  3GRR A;  2Y21 A;  1Q02 A;  5BR8 M;  1QAO A;  3VDP A;  4G4R A;  3HX3 A;  3QWL A;  4IJE A;  5FSW A;  2ZTD A;  2CFO A;  1GJT A;  2F5O A;  3HHW A;  2R18 A;  2DAE A;  4Y28 F;  3FRH A;  3VK7 A;  1X37 A;  2L09 A;  3SFZ A;  3A98 B;  3NWL A;  5DFL A;  1WXQ A;  2DAG A;  2YQZ A;  3K9P A;  1NHG C;  2VQE M;  3KOY E;  2FOI C;  4JI1 M;  4GIP A;  2WSE F;  2DZL A;  2QCU A;  2DWM A;  3SAS A;  2DWN A;  2QBY B;  1VEG A;  4DR5 M;  4IBJ A;  3HU1 A;  4GHL A;  2CHG A;  2J5Y A;  4XK8 F;  1GO5 A;  1Q39 A;  3JR4 A;  1PJT A;  3GLG E;  1C1K A;  4MGY E;  1JR3 A;  3IG8 A;  3GLI B;  3UJN A;  1PJQ A;  1QUT A;  4JN6 A;  2LHC A;  3T1Y M;  1HR0 M;  2MH8 A;  5EP1 A;  1PRB A;  1HNZ M;  1XNQ M;  4FW9 A;  4AQY M;  4KT0 F;  4DV4 M;  2VII A;  1XMQ M;  2JXN A;  2V1U A;  2UXD M;  1Z6T A;  4NSR A;  2V1C A;  2G5G X;  4LF5 M;  2D7E A;  2CV2 A;  3VKH A;  4LFC M;  4WUR A;  3HZJ A;  4DR7 M;  2ZAM A;  2QSF X;  2JZ1 A;  2CE7 A;  1G4A E;  2R65 A;  3HGI A;  4RF0 A;  3R8F A;  1DGH B;  4IBC A;  2DNA A;  5ITX E;  3AJI B;  2JUJ A;  3J80 S;  1XMO M;  2QBY A;  4F2L A;  2XZU A;  1YLA A;  1HNX M;  1HT2 E;  2RRU A;  5KPR A;  3GLG B;  4LF9 M;  4AZF A;  4JV5 M;  1R5L A;  3SHF A;  3TE6 A;  1YUB A;  2C99 A;  1VEJ A;  3GLI A;  1OKS A;  3HU2 A;  3K9O A;  5KPT A;  1XHB A;  4JI2 M;  3FUT A;  2UU9 M;  2R0I A;  1WGL A;  3FYC A;  4LJ9 A;  5IZ7 D;  3PXG A;  5ITU A;  2XFS A;  2O5R A;  1NHW C;  3Q8X A;  2LNH C;  4MB7 A;  4QHT A;  2CWB A;  2O01 F;  3A42 A;  4GH9 A;  1XC8 A;  1IBK M;  1MU5 A;  4QNR A;  3UMM A;  1GKI A;  3GRY A;  1WGN A;  4F1I A;  2WSC F;  4G3O A;  3L29 A;  3HJQ A;  3FUW A;  4JI0 M;  1DGH A;  2ZAN A;  3GLF A;  1TF0 B;  2KZS A;  3U5Z B;  4LJA A;  5FTK A;  3J81 S;  2EA0 A;  3GLG A;  1PM5 A;  1KFV A;  4B7F A;  4LRT A;  5KQ8 A;  4II7 A;  3RGS A;  1Q3C A;  2XLJ A;  2VF7 A;  1V92 A;  3B89 A;  2Q2E B;  2HKJ A;  2DI0 A;  2DKL A;  2H1R A;  4IBF A;  2E5L M;  3J7B A;  5FTN A;  3GLH E;  4IBG A;  1SG9 A;  1NO1 A;  3SAW A;  4TUW A;  4GKK M;  1K82 A;  3AOE A;  5DNY A;  1Z59 A;  3KW6 A;  2Z3X A;  1JR3 D;  2JZ0 A;  8CAT A;  3UGJ A;  3SMP A;  4QHS A;  1TDH A;  4NXN M;  1ZAE A;  2I7N A;  3DOA A;  3FE3 A;  1AIP C;  2Z4S A;  3FYD A;  5IWA M;  3SYL A;  3U5Z A;  1K3W A;  4JI6 M;  2UXC M;  4YHH M;  2F5Q A;  1KSF X;  3NBI A;  4NXM M;  2N35 A;  2CUZ A;  3E46 A;  3T1H M;  4FWG A;  2D7H A;  4DV5 M;  5EP4 A;  2F5S A;  2LVP C;  1DGG A;  2XFT A;  2G8L A;  2QEN A;  2MJ5 B;  4ITQ A;  2Z8Y M;  3FUX A;  1VDD A;  3GLH B;  1PGY A;  3KS4 A;  3M6A A;  1TDZ A;  1D0K A;  2KHH A;  4AKH A;  1L1T A;  2K0B X;  4DV7 M;  1L8Q A;  1HT1 E;  1OIZ A;  4D82 A;  3AOE C;  3E21 A;  3FTC A;  4LGM A;  1SXJ E;  1YSY A;  1GL7 A;  5EP3 A;  3WHK A;  1G59 A;  3GLF E;  4LF4 M;  3U61 B;  3M7G A;  1IY0 A;  1KYI A;  2DWZ B;  5E26 A;  4PDG A;  4MGI E;  3GLI E;  4LF8 M;  2YR0 A;  4JXJ A;  3BOS A;  5LMN M;  1N33 M;  4PCZ A;  4DV3 M;  3TQS A;  3I4V A;  1L2C A;  2FE8 A;  4ANR A;  3H4J A;  2YNM D;  1MN3 A;  1YE9 A;  4JYA M;  3FTD A;  4AG6 A;  1CUK A;  2CHV A;  1A5T A;  4LY6 A;  3GPY A;  5EXX A;  1RU3 A;  4DR1 M;  4L8R C;  2WSF F;  2ZAO A;  3HHY A;  3H4M A;  3GLH A;  4G4Q A;  2LHG A;  4G6Z A;  3KOZ E;  2F5P A;  4L78 A;  2L4E A;  3PNV A;  1FJG M;  4DUY M;  1JB0 F;  5ITY A;  4I5S A;  4LFB M;  1AUA A;  4AI6 A;  2EUC A;  3C3E A;  4YY3 M;  2O25 A;  1T6O A;  1Y8G A;  3IEC A;  3CF2 A;  1OAI A;  1D2N A;  1SXJ B;  4KOD A;  3AV0 A;  3MHV C;  3GLF B;  3U61 A;  5H37 D;  2LBC A;  4IBE A;  3F92 A;  2X49 A;  3ILK A;  3C58 A;  2KZU A;  3ZQJ A;  1IQP A;  1D0M A;  3E4R A;  1R2Z A;  4FCV A;  1QZM A;  3EIE A;  3EIH A;  4LJ7 A;  1TH2 A;  3PNY A;  4A3V B;  3TWK A;  1ZQ9 A;  5EP2 A;  2JY7 A;  2KXE A;  4M0D A;  4M9S A;  1IFY A;  3TWL A;  4GKJ M;  1DGF A;  1HJP A;  2JNH A;  3ZC7 B;  3L26 A;  1IN7 A;  4G4N A;  4S12 A;  3GQ4 A;  2JA2 A;  4B7G A;  1NV9 A;  2DEN A;  3TWM A;  4LF6 M;  4KHP M;  3LVV A;  5KQD A;  4MGH A;  1SXJ A;  2DHR A;  2LVN C;  3GPX A;  2DAK A;  1QAM A;  3D8B A;  3DZD A;  1GL6 A;  4QNM A;  1Z5B A;  3CF6 E;  1WR1 B;  4B08 A;  3GRV A;  1IN8 A;  1DGB A;  3IG5 A;  4Z6Y A;  3FTF A;  1N32 M;  1N78 A;  3J2P B;  4DV2 M;  1GVN A;  3QAU A;  1NV8 A;  4GIT A;  4PD2 A;  3SAR A;  4RF1 A;  2LWX A;  2Y0Q A;  4WP2 A;  3U6D A;  1QZE A;  3K92 A;  2R62 A;  5ITQ A;  4B3S M;  1HQY E;  3TL4 X;  3VLF B;  2HHH M;  4GRI A;  3A46 A;  1H6U A;  4DR4 M;  2C9O A;  2FNA A;  3FKE A;  2R4J A;  3UZU A;  4KO8 A;  4KLN A;  3NBX X;  1IXR C;  4JI3 M;  4R71 A;  4DR6 M;  2R46 A;  4L15 A;  4W5W A;  5ITR A;  2OQ4 A;  5EXP A;  3MK6 A;  4B3M M;  3OTO M;  3U6P A;  1ZMU A;  3IHP A;  4BBA A;  3J27 B;  3HU3 A;  2BWE A;  1SXJ C;  1TH3 A;  4Z8X A;  3SC3 A;  1PJS A;  1IN6 A;  3KDS E;  3I4Y A;  4G4O A;  2KRK A;  3KOX E;  1LTM A;  5KPZ A;  2EKF A;  2EKK A;  2NQ8 C;  4IBB A;  2RGO A;  2DAM A;  1E9R A;  1TGU A;  1IY2 A;  2I7P A;  3FUU A;  3RFW A;  4OVZ B;  1XWI A;  2OOA A;  3U6E A;  4MM3 B;  5FTJ A;  1N34 M;  1DV0 A;  2R6F A;  1HQC A;  3CTW B;  4LJ6 A;  1E94 E;  1FNN A;  3L25 A;  1Z5C A;  1G71 A;  1NNJ A;  2FFJ A;  3LQQ A;  4FWD A;  3RE8 A;  2KNZ A;  4LRS A;  2HWJ A;  2RKO A;  4P17 A;  1QDT A;  2APL A;  2FS1 A;  3PFI A;  3W0L B;  1OIP A;  5E6J A;  2XF3 A;  2MGW A;  3A45 A;  3GRU A;  3KP0 E;  3T6P A;  3GO8 A;  3LCV B;  1DO2 A;  2ZTC A;  5EJC A;  1IXZ A;  1E9S A;  4CHT B;  5C1B A;  4NC6 A;  3HHX A;  2F4V M;  1I94 M;  2BJV A;  3K8Z A;  3BBZ A;  2KDL A;  3B9P A;  2DZN B;  1IBL M;  2CP8 A;  1S3S A;  1W5S A;  3B7N A;  4OVZ A;  4BB9 A;  1UM8 A;  2F5N A;  4B3R M;  4BLC A;  2DXI A;  4GMQ A;  3KFU G;  2OPF A;  1SXJ D;  2LVA A;  4DV0 M;  3WHL A;  3U6C A;  2R44 A;  4EIW A;  2Z4R A;  2UUB M;  4FCT A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 1TF0 B;  2JWS A;  1GJS A;  2MH8 A;  1PRB A;  2KDL A;  2VDB B;  1GAB A;  2FS1 A;  2J5Y A;  2LHG A;  1GJT A;  2N35 A;  2LHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...