2MH8A

Ga-79-mbp cs-rosetta structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
NGDKGYNGLAEAKEKAIKDLKIYGIGEHYIKLIEKAKQVAAVEDLKDEILKAHDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subdomain interactions foster the design of two protein pairs with 80% sequence identity but different folds.
pubmed doi rcsb
source organism Streptococcus dysgalactiae
molecule tags Protein binding
molecule keywords GA-79-MBP, maltose binding protein
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2mh8A00
1GJTA 2N35A 2KDLA 1GJSA 2JWSA 1TF0B 2VDBB 2J5YA 2LHCA 2LHGA 1GABA 1PRBA 2MH8A 2FS1A
chains in the Genus database with same CATH superfamily
2JY6B 1I94M 4LJ7A 3GLHE 2CV0A 2JUJA 2DI0A 1NJGA 4WP2A 3L26A 3DZDA 5EXXA 2GNOA 4AW4A 2LWXA 4LFBM 1IN7A 1R7RA 1TH2A 5EP3A 3TWKA 3GLFA 2QBYB 4GC9A 3GRUA 3I4VA 1Q02A 1DV0A 4GKJM 1MU5A 4OU7A 3GLIE 2YR0A 2DHRA 2FH0A 4GITA 1ZV1A 4LF5M 2XZUA 4L16A 3CTWB 1IXSA 4MGIE 1WHCA 1FJGM 1N78A 4XK8F 1IBLM 2XSZA 3HHXA 2C9CA 2DWLA 4DR7M 2QENA 1L1TA 2I7PA 3U6MA 2DXIA 4MH0E 1GVNA 1Q3BA 1TH3A 4GIPA 4WURA 3FUTA 4PCZA 3CF2A 1K3XA 2DWMA 2E5LM 4B3TM 1XXHA 4NXMM 5DYGA 4M9XA 3TWLA 5KQDA 4XBOA 4LJ8A 3GLGA 1K82A 2VQEM 1HNXM 3PFIA 2Y0TA 3B89A 3IHPA 3RFWA 4YHHM 5C1BA 3GLGB 2VQFM 1K3WA 1OIPA 1HQCA 3GQ5A 4JYAM 5KPZA 3IG5A 3TE6A 3CGWA 3KOYE 3VDPA 1RU3A 3FYDA 2APLA 2KNAA 1NNUC 4NOOB 3SMPA 3L25A 1R6BX 3SAUA 1DGHB 1E94E 1S3SA 1Z5AA 4G3OA 3T38A 3U61B 4I5SA 1MJGM 3KOXE 3W0FA 1NJFA 4NSRA 3JAMS 3GRRA 2DVWB 2YFQA 1EFUB 2UUAM 4DV0M 2DZNB 2FE8A 2L6OA 3GLHA 5LMNM 2CP8A 3AOEA 3W67A 2Z7JA 3UZUA 1L8QA 2KXEA 3E4RA 4L78A 2L4EA 4M9SA 3PNVA 2G5GX 2N35A 4CGYB 1YLAA 3J2PB 1NY6A 3PNYA 2JZ0A 1ZMVA 4X66M 2V1CA 3GLIA 5LMUM 4MGKE 3B7NA 3TQSA 2KHHA 2ZANA 3GPYA 3I51A 2YQZA 3K9PA 5KPTA 2OOAA 1BVSA 3Q8XA 4NRVA 2VF7A 2XFSA 2J7OA 1GL6A 1IXZA 2P5TA 1NHWC 4FCVA 1FNNA 3AOGA 3LQQA 1R4GA 2JZ1A 3K1JA 3Q8GA 1R5LA 4WW0A 5DNYA 3GP1A 1C7YA 3FYCA 1OKSA 1EE8A 4LG2A 3U6CA 1XMQM 2XZFA 4QNMA 4NSOB 3AOEC 3KOWE 4NRWA 2QNJA 3HZJA 2LHGA 2WZJA 1PRBA 2MH8A 4I4LA 4DV4M 2WSEF 3SC3A 2UXDM 3FTCA 2XH9A 3WHLA 4DV5M 5ITQA 3ZCBB 2B3TA 2L4FA 1YE9A 3U6QA 4JI1M 2ZTDA 1XB2B 4FCTA 3A45A 1QAQA 3R8FA 1VG5A 3U6PA 4D80A 3K2LA 4LJ4A 4NC6A 3FTEA 1E9RA 3VLFB 4XGIA 1D0LA 3VK8A 1Q3CA 3K8ZA 1TF0B 3GQ4A 3TWMA 1D2NA 2WSCF 3GLGE 4LZZA 1QUSA 4II7A 4X62M 4G4QA 3U6SA 3AJIB 1DGGA 4NL4H 2FS1A 3KSXA 2J7NA 2UXCM 1PGYA 1DGHA 1VEKA 3IG8A 1T3TA 1C1KA 4GC5A 4HLQA 4Z8XA 2JY5A 3LVVA 3HY5A 3U6OA 2F5QA 1QZEA 1WR1B 1VDDA 4DUZM 2DENA 2Z4RA 4CISA 4M0DA 4LJ6A 5IWAM 4PD2A 1G71A 2FFJA 3B9PA 3KSJA 3RGSA 2H5XA 1XHBA 5FTKA 3WHKA 1OAIA 1OJLA 1TDHA 2R62A 2RGOA 4OX9M 1ZMWA 2F5OA 1G8PA 1E9SA 4RKUF 4D81A 3GPPA 4GHLA 3VKGA 2BWBA 2X8AA 2X49A 5EXTA 4LFAM 2CHVA 3VDUA 1QVRA 4MB7A 4RF1A 3U6LA 2QCUA 4FW9A 3VKHA 5DYIA 3QYBA 3GO8A 2UUCM 2EJSA 4GEWA 4DR4M 2R6FA 4X65M 2OPFA 5FTNA 4MM3B 4FWGA 2Y21A 4ANRA 4JI8M 1GL7A 1PJQA 4FWDA 2W82A 3K9OA 1ZMUA 2HAKA 1QAMA 4MGYE 4GKKM 3HKPA 3LW5F 2D7HA 4AI6A 4AKGA 3NBIA 4FCWA 1IN8A 1N32M 3TPZA 4DV6M 1LV7A 4B08A 1DGBA 3UGJA 2KRUA 4NXNM 3KVWA 4CHTB 4JI3M 1I4WA 3T15A 3B74A 2OOBA 2LBCA 1Q39A 4QOZC 2L2DA 3C3DA 3EIEA 5KPRA 1IN6A 5E6JA 3V76A 3JR4A 3U60B 4B3MM 1Z59A 2ERCA 3U60A 5ITXA 3M6AA 1A5TA 1LTMA 1QDTA 2DAKA 3SHFA 4DR5M 1NNJA 2KNZA 2L09A 1IN4A 1SG9A 2K0BX 1IY2A 2V6ZM 3E21A 4M9ZA 4LF9M 4GHAA 3E9SA 4AQYM 3A46A 2WSFF 3E46A 1R2ZA 3DOAA 2CE7A 2RGHA 1PJJA 4LF8M 4JI0M 4F1IA 1TR8A 2JWSA 3FKEA 2UU9M 1HNWM 1V92A 3SATA 1NV8A 1IXSB 5BPVA 2EKFA 4R71A 1H6UA 3D8LA 4PDGA 2LVNC 1D0MA 2HHHM 2QPAA 1N33M 1SXJC 3PXGA 3KS4A 4KT0F 3NBXX 1HJPA 1JQJC 1PM5A 2CV2A 1YSYA 4BBAA 2BWEA 2QQ8A 2R0IA 5ITRA 4DUYM 3HJSA 2FOIC 1NVMA 3M7GA 2DWNA 3I01M 2QHOB 3GQ3A 3J7BA 1TH4A 4KLNA 2YNMD 4LRSA 1J09A 2FNAA 5EQTA 2EUCA 3J7AS 4IBEA 3L29A 4IBCA 3HHZA 3GLFB 2F4VM 3LMMA 2GQFA 3SHGB 2CWBA 4B3RM 1XC8A 1N36M 4S12A 4G4OA 1N77A 1IFYA 1Y8GA 4P16A 2JP7A 3W0LB 1QANA 3DA1A 2CUZA 2D7EA 2JY7A 1PJSA 3LCUA 2R4EA 1R2YA 3IECA 4A3VB 1QAOA 1WJ7A 2LVAA 2Y0QA 1NO1A 4LZJA 5EP2A 5L8RF 2R65A 1WIVA 2C9OA 4Z6YA 1T43A 3GLHB 3M0EA 4QHSA 1VDLA 1DO2A 4K0KM 3SAVA 4LJ9A 3FUUA 4UN2B 4LF6M 4LFCM 2XFTA 4FVMA 3PVSA 3ZQJA 3HU1A 1SXJA 1PJIA 1UM8A 2AHMA 3ILKA 3FTFA 1IM2A 1HT1E 1MN3A 4YY3M 3OTOM 3HJQA 2HWJA 4FD2A 1YUBA 5JI2E 4QHTA 5IZ7D 3GLIB 4B3SM 1IY0A 4Q7JA 5EXSA 3L28A 3GPUA 5FTJA 1N75A 4BB9A 1G41A 4AG5A 3RE8A 1WXQA 4LGYA 2R44A 2EKKA 3SFZA 3QAUA 2DNAA 3KS8A 3LQRA 1IY1A 2DAGA 3B7QA 4F2LA 2F5SA 3K92A 3KFUG 2VDBB 4IBBA 1OAOC 1AIPC 2KRKA 3DFZA 4R3DA 2CHQA 1V33A 4IBJA 4EIWA 4IBKA 2RRUA 3KXEC 2K6BA 1HR0M 4DR3M 3LVWA 7CATA 2XLJA 4MGZE 2K9DA 1OTRA 4CJ6A 5E26A 3VFDA 4BLCA 3HWSA 3AFHA 1IXRC 2MROB 4KODA 2ZAOA 2HKJA 3HHWA 4R7GA 4ZPXA 2JA2A 1WGLA 5IREB 4AG6A 1QUTA 2K47A 3U6EA 2KZSA 4JI5M 4DR1M 1GKIA 3FRHA 1OQYA 2DZLA 3B7ZA 4JI7M 3UMMA 1XNQM 4ITQA 1MX0A 3T6PA 3NWLA 2LHCA 4LJ5A 3ZH9B 4OW0A 1ORYB 2LXEA 5EP1A 4LJAA 2ZM6M 4HEOA 2BJVA 2D7GA 1F4IA 1QDRA 2RKOA 1JR3A 2KNVA 3CF6E 2L7IA 4G4NA 4MGHA 5GKNA 2G3QA 4M0WA 2DHYA 3T1HM 1XNRM 1XWIA 3UK6A 1XXHB 2QSFX 4L8RC 4REZA 1W5TA 2VF8A 2UUBM 3FD9A 1VEGA 2DZOB 1NSFA 3THGA 4IBDA 2V1UA 3AKZA 3C58A 2KZUA 3I4YA 4LY6A 4KHPM 3JR5A 4GRIA 1L2BA 3R9XB 3L27A 3T1YM 3HGIA 1NV9A 1W5SA 2M5ZA 2H1RA 5ITXE 2C5RA 5ITYA 1UFZA 2MGWA 2CEAA 2DAMA 4LGMA 2OQ4A 4DV7M 2KW0A 3AV0A 2DKLA 4IBIA 4GMQA 3SASA 4CIZA 2R4JA 1X37A 2Y20A 2J5YA 3FE3A 5EJCA 2C96A 3BXWA 3J80S 4AZFA 3SBJA 2LVQD 2EO2A 3SYKA 3MMPA 2XEPA 1N34M 4LF4M 3MJ5A 4B7GA 4RNAA 4I8OA 5FLXS 3QWLA 4PDIA 4DV3M 1NHGC 3SAWA 1GABA 3EIHA 5BR8M 2KDLA 1AUAA 2CFOA 3C3EA 2Z3XA 1TGUA 2G8LA 3CF0A 3KW6A 2QP9X 1L1ZA 5FTMA 1VQ1A 1GJTA 1D0KA 4LRTA 3GRYA 4OVZA 3D8BA 4OVZB 2DAIA 1KYIA 2Z8YM 3BBZA 3QYEA 3VK7A 2ZTCA 1QYRA 3HJ8A 2JY8A 1NY5A 4IIWA 5A2QS 2O5RA 3FUVA 1VEJA 5H37D 5EP4A 3MK6A 3J27B 3FTDA 4AKIA 3GRVA 3U5ZB 3SMSA 4PT5A 2LVOC 2QZ4A 3U5ZA 3F92A 2XGNA 8CATA 1EIJA 5FSWA 3U6DA 2CV1A 2R46A 4IBGA 4G4RA 1KSFX 1TTEA 2C98A 5ITTA 5C18A 2LTUA 2O25A 1HT2E 2F5PA 4Y28F 3GLFE 4JI4M 2Q2EB 5KO3A 1DO0A 2MJ5B 1IN5A 4FWHA 2XF3A 3ZC7B 2M60A 2F5NA 4LCBA 3HHYA 1TDZA 2O01F 1JR3D 1SXJE 1IQPA 4QOSA 1QQWA 2BNKA 2ZBKB 2OO9A 3W68A 3H4JA 2QBYA 3KDSE 3KOZE 4X64M 3J81S 3FUXA 2JXNA 4DBGB 4JI6M 2MR9A 1Z5CA 2EA0A 2BJWA 1OFIA 3TL4X 5KQ8A 2UXBM 1CUKA 4JV5M 4JN6A 5JI3E 1ZQ9A 1V34A 4GH9A 4JXJA 4B7HA 3UJNA 5F3WA 4TUWA 3C9PA 4QNRA 1QZMA 4HL4A 4DR6M 1XXHE 3LCVB 3A98B 4P17A 3HU2A 2KEBA 2KA6B 1L2DA 1KFVA 1PJTA 4LF7M 2CHGA 3KP1E 5FTLA 2HCBA 2R18A 3FUWA 1L2CA 5DFLA 1ZAEA 3SARA 1IBKM 3HX3A 1Z6TA 2DAEA 1G4AE 2Z4SA 2X4AA 1HQYE 2NQ8C 1Z5BA 1GLNA 3BOSA 4DV2M 1IBMM 2CRUA 2XSZD 2ZAMA 4L15A 4KO8A 3FRIA 4RF0A 4DV1M 4JI2M 4AKHA 1GO5A 3SYLA 1G59A 2R45A 1OIZA 1G3IA 1OFHA 5EXPA 1DGFA 4IBFA 2JNHA 3KP0E 1T6OA 1E32A 4DR2M 2LVPC 3U61A 3A42A 2I7NA 5IT9S 2C99A 3MHVC 5ITUA 3AL0C 1J5EM 4L6V6 3L2AA 1JB0F 2A5YB 3RGPA 3GPXA 1P3QQ 3I04M 4IJEA 4W5WA 4D82A 4I81A 2L7HA 4G6ZA 1J7KA 2LH0A 1WGNA 3H4MA 1GJSA 3HU3A 4B7FA 2VIIA 2HL7A 4IJFA 1JR3E 1SXJD 2DWZB 2LNHC 1XMOM 1SXJB 4L4UA 1HNZM
chains in the Genus database with same CATH topology
1GJTA 2N35A 2KDLA 1GJSA 2JWSA 1TF0B 2VDBB 2J5YA 2LHCA 2LHGA 1GABA 1PRBA 2MH8A 2FS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJT A;  2N35 A;  2KDL A;  1GJS A;  2JWS A;  1TF0 B;  2VDB B;  2J5Y A;  2LHC A;  2LHG A;  1GAB A;  1PRB A;  2MH8 A;  2FS1 A; 
#chains in the Genus database with same CATH topology
 2JY6 B;  1I94 M;  4LJ7 A;  3GLH E;  2CV0 A;  2JUJ A;  2DI0 A;  1NJG A;  4WP2 A;  3L26 A;  3DZD A;  5EXX A;  2GNO A;  4AW4 A;  2LWX A;  4LFB M;  1IN7 A;  1R7R A;  1TH2 A;  5EP3 A;  3TWK A;  3GLF A;  2QBY B;  4GC9 A;  3GRU A;  3I4V A;  1Q02 A;  1DV0 A;  4GKJ M;  1MU5 A;  4OU7 A;  3GLI E;  2YR0 A;  2DHR A;  2FH0 A;  4GIT A;  1ZV1 A;  4LF5 M;  2XZU A;  4L16 A;  3CTW B;  1IXS A;  4MGI E;  1WHC A;  1FJG M;  1N78 A;  4XK8 F;  1IBL M;  2XSZ A;  3HHX A;  2C9C A;  2DWL A;  4DR7 M;  2QEN A;  1L1T A;  2I7P A;  3U6M A;  2DXI A;  4MH0 E;  1GVN A;  1Q3B A;  1TH3 A;  4GIP A;  4WUR A;  3FUT A;  4PCZ A;  3CF2 A;  1K3X A;  2DWM A;  2E5L M;  4B3T M;  1XXH A;  4NXM M;  5DYG A;  4M9X A;  3TWL A;  5KQD A;  4XBO A;  4LJ8 A;  3GLG A;  1K82 A;  2VQE M;  1HNX M;  3PFI A;  2Y0T A;  3B89 A;  3IHP A;  3RFW A;  4YHH M;  5C1B A;  3GLG B;  2VQF M;  1K3W A;  1OIP A;  1HQC A;  3GQ5 A;  4JYA M;  5KPZ A;  3IG5 A;  3TE6 A;  3CGW A;  3KOY E;  3VDP A;  1RU3 A;  3FYD A;  2APL A;  2KNA A;  1NNU C;  4NOO B;  3SMP A;  3L25 A;  1R6B X;  3SAU A;  1DGH B;  1E94 E;  1S3S A;  1Z5A A;  4G3O A;  3T38 A;  3U61 B;  4I5S A;  1MJG M;  3KOX E;  3W0F A;  1NJF A;  4NSR A;  3JAM S;  3GRR A;  2DVW B;  2YFQ A;  1EFU B;  2UUA M;  4DV0 M;  2DZN B;  2FE8 A;  2L6O A;  3GLH A;  5LMN M;  2CP8 A;  3AOE A;  3W67 A;  2Z7J A;  3UZU A;  1L8Q A;  2KXE A;  3E4R A;  4L78 A;  2L4E A;  4M9S A;  3PNV A;  2G5G X;  2N35 A;  4CGY B;  1YLA A;  3J2P B;  1NY6 A;  3PNY A;  2JZ0 A;  1ZMV A;  4X66 M;  2V1C A;  3GLI A;  5LMU M;  4MGK E;  3B7N A;  3TQS A;  2KHH A;  2ZAN A;  3GPY A;  3I51 A;  2YQZ A;  3K9P A;  5KPT A;  2OOA A;  1BVS A;  3Q8X A;  4NRV A;  2VF7 A;  2XFS A;  2J7O A;  1GL6 A;  1IXZ A;  2P5T A;  1NHW C;  4FCV A;  1FNN A;  3AOG A;  3LQQ A;  1R4G A;  2JZ1 A;  3K1J A;  3Q8G A;  1R5L A;  4WW0 A;  5DNY A;  3GP1 A;  1C7Y A;  3FYC A;  1OKS A;  1EE8 A;  4LG2 A;  3U6C A;  1XMQ M;  2XZF A;  4QNM A;  4NSO B;  3AOE C;  3KOW E;  4NRW A;  2QNJ A;  3HZJ A;  2LHG A;  2WZJ A;  1PRB A;  2MH8 A;  4I4L A;  4DV4 M;  2WSE F;  3SC3 A;  2UXD M;  3FTC A;  2XH9 A;  3WHL A;  4DV5 M;  5ITQ A;  3ZCB B;  2B3T A;  2L4F A;  1YE9 A;  3U6Q A;  4JI1 M;  2ZTD A;  1XB2 B;  4FCT A;  3A45 A;  1QAQ A;  3R8F A;  1VG5 A;  3U6P A;  4D80 A;  3K2L A;  4LJ4 A;  4NC6 A;  3FTE A;  1E9R A;  3VLF B;  4XGI A;  1D0L A;  3VK8 A;  1Q3C A;  3K8Z A;  1TF0 B;  3GQ4 A;  3TWM A;  1D2N A;  2WSC F;  3GLG E;  4LZZ A;  1QUS A;  4II7 A;  4X62 M;  4G4Q A;  3U6S A;  3AJI B;  1DGG A;  4NL4 H;  2FS1 A;  3KSX A;  2J7N A;  2UXC M;  1PGY A;  1DGH A;  1VEK A;  3IG8 A;  1T3T A;  1C1K A;  4GC5 A;  4HLQ A;  4Z8X A;  2JY5 A;  3LVV A;  3HY5 A;  3U6O A;  2F5Q A;  1QZE A;  1WR1 B;  1VDD A;  4DUZ M;  2DEN A;  2Z4R A;  4CIS A;  4M0D A;  4LJ6 A;  5IWA M;  4PD2 A;  1G71 A;  2FFJ A;  3B9P A;  3KSJ A;  3RGS A;  2H5X A;  1XHB A;  5FTK A;  3WHK A;  1OAI A;  1OJL A;  1TDH A;  2R62 A;  2RGO A;  4OX9 M;  1ZMW A;  2F5O A;  1G8P A;  1E9S A;  4RKU F;  4D81 A;  3GPP A;  4GHL A;  3VKG A;  2BWB A;  2X8A A;  2X49 A;  5EXT A;  4LFA M;  2CHV A;  3VDU A;  1QVR A;  4MB7 A;  4RF1 A;  3U6L A;  2QCU A;  4FW9 A;  3VKH A;  5DYI A;  3QYB A;  3GO8 A;  2UUC M;  2EJS A;  4GEW A;  4DR4 M;  2R6F A;  4X65 M;  2OPF A;  5FTN A;  4MM3 B;  4FWG A;  2Y21 A;  4ANR A;  4JI8 M;  1GL7 A;  1PJQ A;  4FWD A;  2W82 A;  3K9O A;  1ZMU A;  2HAK A;  1QAM A;  4MGY E;  4GKK M;  3HKP A;  3LW5 F;  2D7H A;  4AI6 A;  4AKG A;  3NBI A;  4FCW A;  1IN8 A;  1N32 M;  3TPZ A;  4DV6 M;  1LV7 A;  4B08 A;  1DGB A;  3UGJ A;  2KRU A;  4NXN M;  3KVW A;  4CHT B;  4JI3 M;  1I4W A;  3T15 A;  3B74 A;  2OOB A;  2LBC A;  1Q39 A;  4QOZ C;  2L2D A;  3C3D A;  3EIE A;  5KPR A;  1IN6 A;  5E6J A;  3V76 A;  3JR4 A;  3U60 B;  4B3M M;  1Z59 A;  2ERC A;  3U60 A;  5ITX A;  3M6A A;  1A5T A;  1LTM A;  1QDT A;  2DAK A;  3SHF A;  4DR5 M;  1NNJ A;  2KNZ A;  2L09 A;  1IN4 A;  1SG9 A;  2K0B X;  1IY2 A;  2V6Z M;  3E21 A;  4M9Z A;  4LF9 M;  4GHA A;  3E9S A;  4AQY M;  3A46 A;  2WSF F;  3E46 A;  1R2Z A;  3DOA A;  2CE7 A;  2RGH A;  1PJJ A;  4LF8 M;  4JI0 M;  4F1I A;  1TR8 A;  2JWS A;  3FKE A;  2UU9 M;  1HNW M;  1V92 A;  3SAT A;  1NV8 A;  1IXS B;  5BPV A;  2EKF A;  4R71 A;  1H6U A;  3D8L A;  4PDG A;  2LVN C;  1D0M A;  2HHH M;  2QPA A;  1N33 M;  1SXJ C;  3PXG A;  3KS4 A;  4KT0 F;  3NBX X;  1HJP A;  1JQJ C;  1PM5 A;  2CV2 A;  1YSY A;  4BBA A;  2BWE A;  2QQ8 A;  2R0I A;  5ITR A;  4DUY M;  3HJS A;  2FOI C;  1NVM A;  3M7G A;  2DWN A;  3I01 M;  2QHO B;  3GQ3 A;  3J7B A;  1TH4 A;  4KLN A;  2YNM D;  4LRS A;  1J09 A;  2FNA A;  5EQT A;  2EUC A;  3J7A S;  4IBE A;  3L29 A;  4IBC A;  3HHZ A;  3GLF B;  2F4V M;  3LMM A;  2GQF A;  3SHG B;  2CWB A;  4B3R M;  1XC8 A;  1N36 M;  4S12 A;  4G4O A;  1N77 A;  1IFY A;  1Y8G A;  4P16 A;  2JP7 A;  3W0L B;  1QAN A;  3DA1 A;  2CUZ A;  2D7E A;  2JY7 A;  1PJS A;  3LCU A;  2R4E A;  1R2Y A;  3IEC A;  4A3V B;  1QAO A;  1WJ7 A;  2LVA A;  2Y0Q A;  1NO1 A;  4LZJ A;  5EP2 A;  5L8R F;  2R65 A;  1WIV A;  2C9O A;  4Z6Y A;  1T43 A;  3GLH B;  3M0E A;  4QHS A;  1VDL A;  1DO2 A;  4K0K M;  3SAV A;  4LJ9 A;  3FUU A;  4UN2 B;  4LF6 M;  4LFC M;  2XFT A;  4FVM A;  3PVS A;  3ZQJ A;  3HU1 A;  1SXJ A;  1PJI A;  1UM8 A;  2AHM A;  3ILK A;  3FTF A;  1IM2 A;  1HT1 E;  1MN3 A;  4YY3 M;  3OTO M;  3HJQ A;  2HWJ A;  4FD2 A;  1YUB A;  5JI2 E;  4QHT A;  5IZ7 D;  3GLI B;  4B3S M;  1IY0 A;  4Q7J A;  5EXS A;  3L28 A;  3GPU A;  5FTJ A;  1N75 A;  4BB9 A;  1G41 A;  4AG5 A;  3RE8 A;  1WXQ A;  4LGY A;  2R44 A;  2EKK A;  3SFZ A;  3QAU A;  2DNA A;  3KS8 A;  3LQR A;  1IY1 A;  2DAG A;  3B7Q A;  4F2L A;  2F5S A;  3K92 A;  3KFU G;  2VDB B;  4IBB A;  1OAO C;  1AIP C;  2KRK A;  3DFZ A;  4R3D A;  2CHQ A;  1V33 A;  4IBJ A;  4EIW A;  4IBK A;  2RRU A;  3KXE C;  2K6B A;  1HR0 M;  4DR3 M;  3LVW A;  7CAT A;  2XLJ A;  4MGZ E;  2K9D A;  1OTR A;  4CJ6 A;  5E26 A;  3VFD A;  4BLC A;  3HWS A;  3AFH A;  1IXR C;  2MRO B;  4KOD A;  2ZAO A;  2HKJ A;  3HHW A;  4R7G A;  4ZPX A;  2JA2 A;  1WGL A;  5IRE B;  4AG6 A;  1QUT A;  2K47 A;  3U6E A;  2KZS A;  4JI5 M;  4DR1 M;  1GKI A;  3FRH A;  1OQY A;  2DZL A;  3B7Z A;  4JI7 M;  3UMM A;  1XNQ M;  4ITQ A;  1MX0 A;  3T6P A;  3NWL A;  2LHC A;  4LJ5 A;  3ZH9 B;  4OW0 A;  1ORY B;  2LXE A;  5EP1 A;  4LJA A;  2ZM6 M;  4HEO A;  2BJV A;  2D7G A;  1F4I A;  1QDR A;  2RKO A;  1JR3 A;  2KNV A;  3CF6 E;  2L7I A;  4G4N A;  4MGH A;  5GKN A;  2G3Q A;  4M0W A;  2DHY A;  3T1H M;  1XNR M;  1XWI A;  3UK6 A;  1XXH B;  2QSF X;  4L8R C;  4REZ A;  1W5T A;  2VF8 A;  2UUB M;  3FD9 A;  1VEG A;  2DZO B;  1NSF A;  3THG A;  4IBD A;  2V1U A;  3AKZ A;  3C58 A;  2KZU A;  3I4Y A;  4LY6 A;  4KHP M;  3JR5 A;  4GRI A;  1L2B A;  3R9X B;  3L27 A;  3T1Y M;  3HGI A;  1NV9 A;  1W5S A;  2M5Z A;  2H1R A;  5ITX E;  2C5R A;  5ITY A;  1UFZ A;  2MGW A;  2CEA A;  2DAM A;  4LGM A;  2OQ4 A;  4DV7 M;  2KW0 A;  3AV0 A;  2DKL A;  4IBI A;  4GMQ A;  3SAS A;  4CIZ A;  2R4J A;  1X37 A;  2Y20 A;  2J5Y A;  3FE3 A;  5EJC A;  2C96 A;  3BXW A;  3J80 S;  4AZF A;  3SBJ A;  2LVQ D;  2EO2 A;  3SYK A;  3MMP A;  2XEP A;  1N34 M;  4LF4 M;  3MJ5 A;  4B7G A;  4RNA A;  4I8O A;  5FLX S;  3QWL A;  4PDI A;  4DV3 M;  1NHG C;  3SAW A;  1GAB A;  3EIH A;  5BR8 M;  2KDL A;  1AUA A;  2CFO A;  3C3E A;  2Z3X A;  1TGU A;  2G8L A;  3CF0 A;  3KW6 A;  2QP9 X;  1L1Z A;  5FTM A;  1VQ1 A;  1GJT A;  1D0K A;  4LRT A;  3GRY A;  4OVZ A;  3D8B A;  4OVZ B;  2DAI A;  1KYI A;  2Z8Y M;  3BBZ A;  3QYE A;  3VK7 A;  2ZTC A;  1QYR A;  3HJ8 A;  2JY8 A;  1NY5 A;  4IIW A;  5A2Q S;  2O5R A;  3FUV A;  1VEJ A;  5H37 D;  5EP4 A;  3MK6 A;  3J27 B;  3FTD A;  4AKI A;  3GRV A;  3U5Z B;  3SMS A;  4PT5 A;  2LVO C;  2QZ4 A;  3U5Z A;  3F92 A;  2XGN A;  8CAT A;  1EIJ A;  5FSW A;  3U6D A;  2CV1 A;  2R46 A;  4IBG A;  4G4R A;  1KSF X;  1TTE A;  2C98 A;  5ITT A;  5C18 A;  2LTU A;  2O25 A;  1HT2 E;  2F5P A;  4Y28 F;  3GLF E;  4JI4 M;  2Q2E B;  5KO3 A;  1DO0 A;  2MJ5 B;  1IN5 A;  4FWH A;  2XF3 A;  3ZC7 B;  2M60 A;  2F5N A;  4LCB A;  3HHY A;  1TDZ A;  2O01 F;  1JR3 D;  1SXJ E;  1IQP A;  4QOS A;  1QQW A;  2BNK A;  2ZBK B;  2OO9 A;  3W68 A;  3H4J A;  2QBY A;  3KDS E;  3KOZ E;  4X64 M;  3J81 S;  3FUX A;  2JXN A;  4DBG B;  4JI6 M;  2MR9 A;  1Z5C A;  2EA0 A;  2BJW A;  1OFI A;  3TL4 X;  5KQ8 A;  2UXB M;  1CUK A;  4JV5 M;  4JN6 A;  5JI3 E;  1ZQ9 A;  1V34 A;  4GH9 A;  4JXJ A;  4B7H A;  3UJN A;  5F3W A;  4TUW A;  3C9P A;  4QNR A;  1QZM A;  4HL4 A;  4DR6 M;  1XXH E;  3LCV B;  3A98 B;  4P17 A;  3HU2 A;  2KEB A;  2KA6 B;  1L2D A;  1KFV A;  1PJT A;  4LF7 M;  2CHG A;  3KP1 E;  5FTL A;  2HCB A;  2R18 A;  3FUW A;  1L2C A;  5DFL A;  1ZAE A;  3SAR A;  1IBK M;  3HX3 A;  1Z6T A;  2DAE A;  1G4A E;  2Z4S A;  2X4A A;  1HQY E;  2NQ8 C;  1Z5B A;  1GLN A;  3BOS A;  4DV2 M;  1IBM M;  2CRU A;  2XSZ D;  2ZAM A;  4L15 A;  4KO8 A;  3FRI A;  4RF0 A;  4DV1 M;  4JI2 M;  4AKH A;  1GO5 A;  3SYL A;  1G59 A;  2R45 A;  1OIZ A;  1G3I A;  1OFH A;  5EXP A;  1DGF A;  4IBF A;  2JNH A;  3KP0 E;  1T6O A;  1E32 A;  4DR2 M;  2LVP C;  3U61 A;  3A42 A;  2I7N A;  5IT9 S;  2C99 A;  3MHV C;  5ITU A;  3AL0 C;  1J5E M;  4L6V 6;  3L2A A;  1JB0 F;  2A5Y B;  3RGP A;  3GPX A;  1P3Q Q;  3I04 M;  4IJE A;  4W5W A;  4D82 A;  4I81 A;  2L7H A;  4G6Z A;  1J7K A;  2LH0 A;  1WGN A;  3H4M A;  1GJS A;  3HU3 A;  4B7F A;  2VII A;  2HL7 A;  4IJF A;  1JR3 E;  1SXJ D;  2DWZ B;  2LNH C;  1XMO M;  1SXJ B;  4L4U A;  1HNZ M; 
#chains in the Genus database with same CATH homology
 1GJT A;  2N35 A;  2KDL A;  1GJS A;  2JWS A;  1TF0 B;  2VDB B;  2J5Y A;  2LHC A;  2LHG A;  1GAB A;  1PRB A;  2MH8 A;  2FS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...