2MHDA

Nmr structure of the protein bacuni_03114 from bacteroides uniformis atcc 8492
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
b'GDEDDKVEIPQLVGKWIVKEPVLQDDFVTCYTFNADKTYEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQYHILKLTSKEMKWENASPKDGNSDKRLEKYND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR strucutre of the protein BACUNI_03114 from Bacteroides uniformis ATCC 8492
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13648 Lipocalin_4 Lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.370 Mainly Beta Beta Barrel Lipocalin Lipocalin 2mhdA00
2MHDA
chains in the Genus database with same CATH superfamily
1SWHA 3P6CA 3LV4A 2A8GA 4QNIA 4N7DA 1X8PA 2MWHA 3FLLA 4CV7A 1LF7A 5LKEA 2RTJA 2RTQB 4KC7A 4QAEA 4A1YA 5CSEA 4CDEA 2W2FA 2GTLM 2N93A 2WEWA 3SLTA 1A18A 3SZIA 4YFRA 1H91A 4OELA 1D3SA 1STRB 5FENA 2OVSA 1ICNA 4OKAA 4ZHCA 2IZFB 5H9NA 1LICA 1EW3A 1Y53X 3EYCA 2HMBA 2FLJA 2Y3EA 2NNDA 3I17A 4GZVA 1SWEA 4TLJA 1TXLA 3UEVA 1S7DA 4ZHGA 4CPEA 1QY1A 1SWDA 1DZJA 2RTAA 3LTWA 2EU7X 3STMX 2OF8A 4IMOA 1VWFB 3S26A 2AT8X 5LJGA 2A2UA 1SWQA 1SXYA 1BSYA 1ZNHA 2OFMX 1E2TA 3RE6A 3B2KA 5LJBA 3WJCA 1ML7A 1G85A 2FRSA 3O22A 5HAEA 3FEPA 1DFVA 1AVDA 1DV9A 4BQUA 2MO5A 1Y55X 4UU2A 3NADA 1OBUA 4WHIA 3VG3A 1EIIA 3RY2A 1LKEA 1RXJA 3FIDA 5H9KA 2BSZA 1PEEA 4CPIA 4QGXA 4RUNA 1KGLA 1SWLA 5K67A 3RY1A 3PK2A 1HN2A 4FGIB 5LKFA 3B2JA 4BVMA 2C1QA 1ZNGA 3P24A 4QQ1A 2CZTA 3BLGA 3NQ9A 1N43A 2A0AA 1MVGA 1R0UA 3P6HA 4FQBB 1HQPA 2CZUA 4QYNA 5IRUA 3ZW1A 2IZKA 3TGBA 2BHVA 1AVGI 2F73A 1I78A 1XCAA 3MX7A 3D95A 1KT7A 4ID2A 4U3QA 3LHNA 4GDAA 4IAWA 5AJBA 3NPOA 3SAOA 3NBXX 3F6ZB 4AZRA 4D6AA 2L68A 1JZUA 4TKHA 1KQWA 3CQRA 4JHQA 5F2BA 3TF6A 1N9YA 3ZW1B 5B5FA 1BBPA 1AB0A 2ZSCA 2ALLX 1JJXA 4MVKA 5JR8A 4HPDA 3O2YA 3FW4A 3PH5A 5D48A 1VWLB 2QOMA 2R74A 4O9SA 3WOVA 1OEEA 5F1EA 1HMRA 2AH7X 1FTPA 1IKJA 4O4XA 1RLBE 2HLVA 4YGGA 5K68A 4D6BA 1EALA 2O62A 5B5GA 2JW1A 1YWDA 2A3FX 2W2AA 1G74A 2QCBA 1BSOA 2R56A 4U9CA 1ZNEA 1B4MA 5HZ6A 2GTLO 2UZ2A 2G79A 1VWGB 2IFBA 4GNYA 3RDQA 5JD2A 2RTGB 1OEKA 1BRPA 2HZQA 1SXXA 3CMPA 3KQ0A 1P6PA 2HKDA 3JS1A 1QG5A 1VWOB 5EZ2A 3KFFA 5LJHA 2LA7A 3MM0A 3WZQA 4YBPA 3KVNA 1PMPA 4GU8A 5HBSA 1SWFA 2HZRA 4KT5A 4CPFA 2X4MA 3WZOA 1LUQA 3CWKA 2JOZA 3X00A 1SLDB 2MM3A 3UEWA 2X46A 2K23A 1VWHB 2DJGA 4DCBA 1HBPA 1I9HA 2RQ0A 4YGZA 1IFBA 1U18A 1N0SA 2AL0X 3OD9A 4GUZA 4ODDA 1TVQA 4OMWA 4PJ2A 5B11O 4EEJA 1G7NA 1MM9A 4M6SA 2F09A 1S2PA 4GJVA 2KTSA 3OJYC 2YMSA 4AZNA 4I3DA 5IRAA 2IZCB 4GJSA 3U03A 1AQBA 2I5ZO 2RTEB 4U8UM 5CYBA 4ZFXA 2GH7A 4IB8A 4CDFA 4ZHDA 1GX9A 1LIDA 1PBYA 1SWSA 1VWCB 4GGRA 2OFAA 1STPA 3AKMA 5D45A 5FQ8E 5L3YA 2LFOA 3FIQA 4YDAA 2AT0X 3QKGA 4IRWA 3PDFA 3VHMA 4A8ZA 5HWZA 1JQPA 3ZI8A 5FQ6E 3ZZVA 2VDFA 4LZVA 4YFQA 4YH0A 3TGCA 2RTLA 4OMXA 1W4TA 1RSTB 2L5PA 5AJCA 2KD2A 3Q34A 1RXHA 4I3BA 3CKFA 3H3IA 3FELA 1DC9A 4MVIA 5BVSA 4NNTA 3FR5A 1Y9LA 3PP6A 2PY1A 2BT9A 5HA1A 3P02A 2Q39A 3PQUA 2Q2MA 1DZMA 3VGWA 3FEKA 3CQNA 3T6FA 3ZW0A 4Y5DA 2R73A 2RN4A 1YP6A 1DZPA 1L6MA 2RTCB 4MIRA 5EDCA 3RDSA 3ZUIA 2WWPA 3WJGA 5BVTA 1GX8A 1JMXA 2RTRB 3WJBA 1GKAA 3MVFA 4AZPA 2AF5A 4Y0RA 5AEOA 2IZJA 2X8TA 4YDBA 5KIDA 3F9DA 2C1SA 2AT3X 4LQZA 3NQ3A 2KW1A 4NLIA 1SWTA 2RTIB 2RTBB 3APVA 4XMFA 1QY2A 3ZQ3A 4XMEA 3ZW0B 4Z6JA 3WBGA 3FDCA 4O49A 4TQ2A 1OBQA 4I60A 1NC9A 2OVEA 2ZAIA 4ORUA 4YKOA 1ACDA 1GKAB 1TOUA 5HCEC 3UAQA 1LIBA 1DZKA 3VG4A 1BM5A 4L1NA 1HMSA 1SA8A 2Z4IA 3BX7A 1VWNB 1LPJA 2HYSA 3D4RA 3T2WA 3VE2A 4EXZA 1IIUA 2HNXA 2RTDB 4GK9A 5KHPA 3NR3A 4NYQA 3APWA 4WFUA 2A2GA 3OE3A 5B2AO 1LELA 1ZNKA 2LBVA 4Z2VA 3HK1A 4Z28A 3HOLA 4TNNA 3NQKA 4I95A 2OY8A 4NW4A 4CPHB 5DG4A 3MG5A 3O19A 1VWEB 3APXA 4HPBA 2OY5O 5IXGA 1VWRB 1ZNDA 1GT5A 1K24A 1GX3A 1AVEA 2X56A 3JQOA 4YKMA 1Y0GA 4ZCBA 2NNQA 4CK4A 4ARHA 1UYNX 3KZAA 1NBXA 2KT4B 4HPCA 3WYPA 3QQ2A 1YWCA 2JGSA 3ELXA 3FR4A 1SY1A 5HCDC 5DPQA 5B3MO 4U8UO 1YWAA 2QO6A 1RAVA 2WUTA 2X8FA 5HZ9A 1KQXA 1SLGB 1X8UA 1QFVA 3KFHA 3Q6LA 3V8UA 1SRGA 1LCZA 4I6SA 4U46A 4FBOA 4AW8A 1O8VA 4A60A 2CBRA 3CR6A 2BLGA 3K3LA 1ERBA 1ICMA 2QO5A 2BC3A 4I3CA 4MVLA 2I5VO 2RCTA 5H9AA 5D4AA 2JU7A 1VWMB 2X8SA 4K19A 1SWNA 1LIFA 1SWJA 1W5RA 1NGLA 2Y32A 3CKGA 5LJDA 1KFFA 3ZWEA 2POAA 3U0DA 1KZWA 3L4RA 4CDCA 1O1VA 2G7BA 1I4UA 2OY7A 1N7YA 1TW4A 1XKIA 3BRNA 4I9RA 2PI3O 2W2BA 5IRWA 1FEMA 1S44A 1SWBA 1A2DA 1QFTA 1GT3A 4ORSA 2AKQA 1YUPA 2F01A 4O3YA 2OFRX 2RTFB 4GRJA 1IFCA 1SWUA 2AVIA 2JU8A 4JO6A 3U9PC 3WVMA 4EDEA 4YGHA 3S5XA 4JGLA 1SLEB 1Y9TA 1LCVA 1KOIA 1WUBA 4YMYA 2G5LA 1TOWA 3TGAA 4YCEA 1KZXA 5B29A 3HWFA 4IB9A 1KT5A 2WQAE 2ACPX 1KL4A 3B2LA 4OS0A 2ASNX 1N4JA 1NDJA 1PM1X 1HXZA 4IB7A 1FE3A 4YBUA 3SZHA 3GAQA 3NP1A 1T68X 4GGZA 4KC8A 4ES7A 1FJ1E 3NX1A 4NNSA 3RDXA 3TZSA 4ZGFA 1SRJA 3FENA 2ANSA 1STSB 1VWBB 4WBKA 4PSQA 4A1HA 4LKPA 5FQ7E 4TKBA 1PTSA 2IZLB 2QMIA 4Y0PA 2WQ9A 1SWKA 3SOTA 1MUPA 1U17A 2FGSA 4JNJA 5K06A 2JU3A 5HZQA 2NP1A 3VHHA 1YIVA 2IZHB 4Y0QA 3B2IA 5HTEA 3RDMA 1E00A 1KT3A 3KFIA 2OL8O 4BX6B 1YP7A 1FENA 1T8VA 4QGVA 3MBTA 4ORWA 2FR2A 2GTLN 3F8AA 5EPQA 3T1DA 4XMDA 1SY2A 3P6DA 1I04A 3PECA 1LFOA 2NNEA 5L8IA 3RDOA 2GC9A 3EBKA 3RBYA 4ORYA 1QY0A 4WFVA 4BGFA 5FAZA 1LCWA 3RKGA 1NQMA 3IFBA 1CBSA 5D8JA 4TJZA 2LBAA 1JIWI 2LB6A 1GGLA 1A3YA 4MEEA 3C78X 1OPBA 1VYFA 3HWDA 1O1UA 1ADLA 5EEEA 2QOSC 3EBWA 2OY1O 2FT9A 3FA6A 1AELA 2OF9A 2BS6A 4B55A 2MJIA 3ZUOA 4OS3A 4CSBA 1E06A 1VWPB 1K3BA 1VYOA 1GT4A 2IZEB 3G7XA 1SWGA 1VPRA 2Q2PA 1VWAB 2OVDA 4NP1A 1X71A 2L67A 3FMZA 4IAXA 4R0BA 4XMCA 3D96A 3VG6A 1SMPI 3C77X 1SRFA 1T0VA 2AT6X 4ORXA 1JBHA 1HMTA 3WJFA 4INNA 1SLFB 3WYQA 1RBPA 1EXSA 1ALBA 4GETA 3RSWA 3GE2A 2FHLA 2RTPB 3EC5A 1NP1A 1KL3A 2X45A 1SY0A 1UYOX 3JSQA 5IO5A 2IZGB 5LJCA 4OS8A 1BSQA 1ZRYA 5B27A 2RTMA 3FA7A 3APUA 1QQSA 4AYHA 1HY2A 2IZBA 3UEUA 2WSJA 4BX5A 1CBRA 1EQDA 1GT1A 1MX7A 1E02A 1NQNA 1CRBA 1QWDA 2RD7C 2Y3FA 3BSZE 3C76X 3FR2A 4CPHA 3ELZA 3BS2A 2Z4HA 2RTNB 3NX2A 4NYRA 5H9LA 1OEJA 1ZNLA 2OZQA 4UU3A 4L3RA 4EFGA 1A57A 3SZJA 5IO6A 2JMBA 3RWXA 1NP4A 3I0AA 5HCCC 4XMHA 3D97A 1DF3A 3STNA 1VWQB 4BX5B 2MHDA 2FS7A 3KFGA 2Q9SA 2FWVA 3WZNA 1KT6A 1UZ2X 2M4LA 2LKKA 2UYWA 3T2XA 1SXWA 4ON1A 3VG2A 1MK5A 1VWKB 2XKLA 3PPTA 2MF6A 1YWBA 1JJJA 5BYPA 3DTQA 2AT5X 1BRQA 3FYFA 4MVEA 4YVBA 1VWIB 1X8OA 3CBCA 3BY0A 3D9WA 2OL6O 1FDQA 2GJ5A 3N91A 1I06A 4TKJA 1SWCA 1EPAA 1PBOA 3RZYA 2ZAGA 1FELA 4O4UA 1LNMA 3HOEA 4CDDA 2C4IA 4DNEA 4QZUA 1IW2A 4LKTA 2CAMA 2X55A 2YG2A 4ZH6A 4DQ4A 5LJEA 4O4SA 3BDRA 3CBSA 4ALOA 1U0XA 5C0NA 4Z27A 4BOEA 5F7GA 1LIEA 4ZHHA 5BVQA 2X32A 4HWMA 5HZ8A 2FKJA 3FA9A 1EUOA 1LDQA 4EKVA 4GKCA 4M7MA 3PEDA 5F6BA 1CBIA 1DF8A 1Y52X 2FS6A 2Q4NA 2RTOB 1JYDA 2A5BA 3P6FA 4GE1A 1EI5A 3VU1A 3WZPA 1G5WA 4COTA 2RTHB 1UREA 4GGTA 4BCSA 3P6GA 3VG7A 5HZ5A 2KTDA 2FKGA 4O3XB 4LZUA 1SY3A 3HWEA 1E5PA 1W6FA 2WR6A 4C5PA 5HTDA 4I9SA 4U8UN 4FBRA 1MOYA 4HFOA 1SWAA 1SWPA 1CBQA 3STKA 5KICA 2QO4A 1IKEA 1GXAA 2GTFX 2JN3A 4AZOA 4IBAA 5L8OA 4IB6A 4KCAA 4AZQA 3AUMO 3VHIA 2RCQA 1RXKA 2VFBA 3IA8A 4Z2PA 4Y0SA 5AQ6A 2A13A 2CBSA 3P6EA 4KH8A 4GDZA 2IZIA 4ZHFA 5CE4A 4QGWA 1X89A 1QABE 4KIIA 4O3WA 1I05A 5LJKA 3UEXA 1BLRA 2XSTA 3EW1A 4RUUA 1X8QA 3HPEA 4BX6A 4GH7A 2L9CA 5FFHA 1B0OA 2G8CO 2IZDB 3DSZA 4MISA 4N7CA 4ALBA 2DM5A 3WJDA 2A5CA 5IO7A 1SREA 3VE1A 1HBQA 4ZH9A 4QRLA 2IZAA 2WEXA 4IMNA 1MEPA 4EQAC 1EIOA 1VWDB 4NLJA 3WJEA 1JMZA 1JYJA 2CM9A 2OFBA 2FR3A 1HQQA 2RA6A 1GM6A 2VFCA 3FW5A 2DJFA 4YFPA 4ML7B 2P8GA 2QM9A 3B2HA 2E4JA 5EDBA 4AZMA 4ZGUA 1OPAA 3FA8A 1BWYA 4XMGA 1N9MA 3HWGA 1EPBA 1CJ5A 3EM0A 5EEDA 2OVAA 1B8EA 1SRIA 2CM4A 4O3ZA 1MX8A 5F6ZA 4BJ8A 1D2UA 5CHKA 1SWOA 4Z2OA 4ZJ0A 3E3CA 3VG5A 1IJ8A 1WBIA 2BS5A 3HTYA 3BU1A 3OBLA 4NV8A 5HA0A 1VWJB 3RE5A 1BJ7A 1X8NA 3S60A 1VYGA 5H8TA 1LDOA 3PH6A 2X34A 1BEBA 4FBVA 4GNWA 2AMMX 4ZR2A 1Z24A 2OL7A 3AEHA 2G78A 4GD9A 3EMMA 5F58A 2RTKA 3SLJA 4YCHA 4QYPA 1JV4A 4ORRA 5D47A 3RDUA 1KT4A 1SWRA 3BX8A 2ACOA 4DQ3A 3EW2A 3SLOA 5B10O 3S5VA 2FTBA 4HPAA 3WXQA 3ZW2A 4BX7A 4QZTA 4IABA 4Y59A 2OYBO 1ERXA 3T6LA 1KL5A 1OBPA 3VPJE 1HXLA 1SXUA 1MDCA 3BU9A 1RSUB 2FHNX 3AKNA 1KXOA 4BBOA 4O4OA 1SRHA 2WPUA 1B56A 1JJUA 1OSPO 4NV7A 4BX7B 5L8NA 3PQSA 2K62A 4OEMA
chains in the Genus database with same CATH topology
3P6CA 3LV4A 4QNIA 4N7DA 1X8PA 2MWHA 3FLLA 4CV7A 1LF7A 5LKEA 4KC7A 4QAEA 4A1YA 2W2FA 2GTLM 2N93A 2WEWA 1A18A 4YFRA 1H91A 1D3SA 5FENA 2OVSA 1ICNA 4ZHCA 1LICA 1EW3A 3EYCA 2HMBA 2FLJA 3I17A 2NNDA 4TLJA 4GZVA 1TXLA 3UEVA 1S7DA 4ZHGA 1QY1A 1DZJA 3STMX 2EU7X 4IMOA 3S26A 2AT8X 5LJGA 2A2UA 1SXYA 1BSYA 1ZNHA 2OFMX 3B2KA 5LJBA 3WJCA 1ML7A 1G85A 2FRSA 3O22A 5HAEA 3FEPA 1DFVA 1DV9A 4BQUA 2MO5A 4UU2A 3NADA 1OBUA 4WHIA 3VG3A 1EIIA 1LKEA 5H9KA 1PEEA 1KGLA 4QGXA 4RUNA 1HN2A 4FGIB 5LKFA 3B2JA 4BVMA 1ZNGA 3P24A 4QQ1A 2CZTA 3BLGA 3NQ9A 2A0AA 3P6HA 1MVGA 1R0UA 4FQBB 4QYNA 1HQPA 2CZUA 3ZW1A 3TGBA 2BHVA 1AVGI 2F73A 1XCAA 3MX7A 3D95A 1KT7A 4ID2A 4U3QA 3LHNA 4IAWA 5AJBA 3NPOA 3SAOA 3NBXX 3F6ZB 4AZRA 4D6AA 2L68A 1JZUA 4TKHA 1KQWA 3CQRA 3TF6A 3ZW1B 1BBPA 1AB0A 1JJXA 2ALLX 4MVKA 5JR8A 4HPDA 3O2YA 3FW4A 3PH5A 5D48A 2R74A 4O9SA 3WOVA 1OEEA 5F1EA 1HMRA 2AH7X 1FTPA 1IKJA 4O4XA 1RLBE 2HLVA 4YGGA 4D6BA 1EALA 2O62A 2JW1A 1YWDA 2A3FX 2W2AA 1G74A 1BSOA 2R56A 4U9CA 1ZNEA 1B4MA 2GTLO 2G79A 2IFBA 4GNYA 1OEKA 2HZQA 1BRPA 1SXXA 3CMPA 3KQ0A 1P6PA 3JS1A 1QG5A 5EZ2A 3KFFA 2LA7A 4YBPA 1PMPA 4GU8A 5HBSA 2HZRA 4KT5A 3CWKA 2JOZA 2MM3A 3UEWA 2X46A 2K23A 1HBPA 2RQ0A 4YGZA 1IFBA 1U18A 1N0SA 2AL0X 3OD9A 4ODDA 4OMWA 1TVQA 4PJ2A 4EEJA 1G7NA 4M6SA 2F09A 1S2PA 2KTSA 3OJYC 2YMSA 4AZNA 4I3DA 3U03A 1AQBA 4U8UM 5CYBA 4ZFXA 4IB8A 4ZHDA 1GX9A 1LIDA 3AKMA 5D45A 5FQ8E 2LFOA 3FIQA 4YDAA 2AT0X 3QKGA 5HWZA 3ZI8A 5FQ6E 3ZZVA 4LZVA 4YFQA 4YH0A 3TGCA 4OMXA 2L5PA 5AJCA 2KD2A 4I3BA 3H3IA 3FELA 1DC9A 4MVIA 5BVSA 4NNTA 3FR5A 1Y9LA 3PP6A 2PY1A 2BT9A 5HA1A 3P02A 2Q39A 3PQUA 2Q2MA 1DZMA 3FEKA 3CQNA 3ZW0A 5EDCA 2R73A 2RN4A 1YP6A 1DZPA 1L6MA 4MIRA 3ZUIA 5KHPA 2WWPA 3WJGA 5BVTA 1GX8A 3WJBA 4AZPA 5AEOA 1GKAA 3MVFA 4Y0RA 2X8TA 4YDBA 5KIDA 3F9DA 2AT3X 4LQZA 3NQ3A 2KW1A 4NLIA 4XMFA 3ZQ3A 3APVA 3ZW0B 1QY2A 4XMEA 3WBGA 4O49A 4TQ2A 1OBQA 4YKOA 2ZAIA 2OVEA 4ORUA 1ACDA 1GKAB 1TOUA 5HCEC 3UAQA 1LIBA 1DZKA 3VG4A 1BM5A 4L1NA 1HMSA 1SA8A 2Z4IA 3BX7A 4EXZA 1LPJA 2HYSA 3D4RA 3VE2A 1IIUA 2HNXA 4GK9A 3NR3A 4NYQA 3APWA 4WFUA 2A2GA 3OE3A 1ZNKA 2LBVA 3HK1A 3HOLA 4TNNA 3NQKA 4I95A 4NW4A 5DG4A 3O19A 3APXA 4HPBA 1ZNDA 1GT5A 4YKMA 3JQOA 4ZCBA 2NNQA 4CK4A 4ARHA 3KZAA 2KT4B 4HPCA 5HZ6A 5HCDC 1YWCA 3FR4A 3ELXA 1SY1A 5DPQA 4U8UO 1YWAA 2QO6A 2WUTA 2X8FA 5HZ9A 1KQXA 1X8UA 3Q6LA 1QFVA 3KFHA 3V8UA 4I6SA 4FBOA 4AW8A 1O8VA 4A60A 2CBRA 3CR6A 2BLGA 3K3LA 1ERBA 1ICMA 2QO5A 4I3CA 4MVLA 2RCTA 5H9AA 5D4AA 2JU7A 2X8SA 4K19A 5LJDA 1LIFA 1NGLA 3ZWEA 2POAA 3U0DA 1KZWA 3L4RA 1O1VA 2G7BA 1I4UA 1TW4A 1XKIA 3BRNA 4I9RA 2W2BA 1FEMA 1S44A 1A2DA 1QFTA 1GT3A 4ORSA 2AKQA 1YUPA 4O3YA 2OFRX 4GRJA 1IFCA 2JU8A 3U9PC 4EDEA 3WVMA 4YGHA 3S5XA 4JGLA 1Y9TA 1KOIA 4YMYA 1TOWA 3TGAA 4YCEA 5B29A 3HWFA 4IB9A 1KT5A 2WQAE 2ACPX 3B2LA 4OS0A 5LJHA 2ASNX 1PM1X 4YBUA 4IB7A 1FE3A 3GAQA 3NP1A 1T68X 4KC8A 4ES7A 3NX1A 4NNSA 3TZSA 4ZGFA 3FENA 2ANSA 4WBKA 4PSQA 4A1HA 4LKPA 5FQ7E 4TKBA 2QMIA 4Y0PA 2WQ9A 3SOTA 1MUPA 1U17A 5K06A 2JU3A 5HZQA 2NP1A 1YIVA 4Y0QA 3B2IA 5HTEA 1E00A 1KT3A 3KFIA 1YP7A 1FENA 1T8VA 4QGVA 3MBTA 4ORWA 2FR2A 2GTLN 3F8AA 5EPQA 3T1DA 4XMDA 1SY2A 3P6DA 1I04A 3PECA 1LFOA 2NNEA 5L8IA 2GC9A 3EBKA 3RBYA 4ORYA 1QY0A 4WFVA 5FAZA 3RKGA 5D8JA 3IFBA 1CBSA 4TJZA 2LBAA 1JIWI 2LB6A 1GGLA 1A3YA 3C78X 1OPBA 1VYFA 3HWDA 1O1UA 1ADLA 5EEEA 2QOSC 3EBWA 2FT9A 3FA6A 1AELA 2BS6A 2MJIA 3ZUOA 4OS3A 4CSBA 1E06A 1GT4A 3G7XA 1VPRA 2Q2PA 2OVDA 4NP1A 1X71A 2L67A 3FMZA 4IAXA 4R0BA 4XMCA 3D96A 3VG6A 1SMPI 3C77X 1T0VA 4ORXA 2AT6X 1HMTA 3WJFA 4INNA 1RBPA 1EXSA 1ALBA 4GETA 3RSWA 3GE2A 5IO5A 1NP1A 1JBHA 2X45A 1SY0A 3JSQA 5LJCA 4OS8A 1BSQA 1ZRYA 5B27A 3FA7A 3APUA 1QQSA 4AYHA 3UEUA 2WSJA 1CBRA 1EQDA 1GT1A 1MX7A 1E02A 1QWDA 1CRBA 2RD7C 3BSZE 3C76X 3FR2A 3ELZA 3BS2A 2Z4HA 3NX2A 4NYRA 5H9LA 1OEJA 1ZNLA 2OZQA 4L3RA 4EFGA 1A57A 5IO6A 2JMBA 3RWXA 1NP4A 3I0AA 5HCCC 4XMHA 3D97A 1DF3A 3STNA 2MHDA 2FS7A 3KFGA 2Q9SA 2FWVA 1KT6A 1UZ2X 2M4LA 2LKKA 3VG2A 1SXWA 4ON1A 2XKLA 3PPTA 1YWBA 1JJJA 5BYPA 3DTQA 2AT5X 1BRQA 3FYFA 4MVEA 1KZXA 1X8OA 3CBCA 3BY0A 1FDQA 2GJ5A 3N91A 1I06A 4TKJA 1EPAA 1PBOA 3RZYA 2ZAGA 1FELA 4O4UA 1LNMA 3HOEA 4QZUA 1IW2A 4LKTA 4ZH6A 2YG2A 4DQ4A 5LJEA 4O4SA 3BDRA 3CBSA 4ALOA 1U0XA 5C0NA 4BOEA 5F7GA 1LIEA 4ZHHA 5BVQA 4HWMA 5HZ8A 3FA9A 1EUOA 4GKCA 4M7MA 3PEDA 5F6BA 1CBIA 4QYPA 2FS6A 4GE1A 2Q4NA 3P6FA 1JYDA 3VU1A 1G5WA 1EI5A 4COTA 1UREA 3P6GA 3VG7A 5HZ5A 2KTDA 4O3XB 4LZUA 1SY3A 3HWEA 1E5PA 2WR6A 5HTDA 4I9SA 4U8UN 4FBRA 4HFOA 3STKA 5KICA 1CBQA 2QO4A 1IKEA 1GXAA 2GTFX 2JN3A 4AZOA 4IBAA 5L8OA 4IB6A 4KCAA 4AZQA 2RCQA 3IA8A 4Y0SA 5AQ6A 2A13A 2CBSA 3P6EA 4KH8A 4GDZA 4ZHFA 5CE4A 4QGWA 1X89A 1QABE 4KIIA 4O3WA 1I05A 5LJKA 3UEXA 1BLRA 2XSTA 4RUUA 1X8QA 4GH7A 2L9CA 5FFHA 1B0OA 3DSZA 4MISA 4N7CA 4ALBA 2DM5A 3WJDA 5IO7A 3VE1A 1HBQA 4ZH9A 4QRLA 2WEXA 4IMNA 4EQAC 1EIOA 4NLJA 3WJEA 1JYJA 2CM9A 4YFPA 2FR3A 2RA6A 1GM6A 5H9NA 3FW5A 4A8ZA 4AZMA 4ML7B 2P8GA 2QM9A 3B2HA 2E4JA 5EDBA 4ZGUA 1OPAA 3FA8A 1BWYA 4XMGA 3HWGA 1EPBA 1CJ5A 3EM0A 5EEDA 2OVAA 1B8EA 2CM4A 4O3ZA 1MX8A 5F6ZA 1D2UA 4ZJ0A 3E3CA 3VG5A 2BS5A 3HTYA 3BU1A 3OBLA 5HA0A 1BJ7A 1X8NA 3S60A 1VYGA 5H8TA 3PH6A 4FBVA 1BEBA 4GNWA 2AMMX 4ZR2A 1Z24A 2G78A 3EMMA 5F58A 4YCHA 1JV4A 4ORRA 5D47A 1KT4A 3BX8A 4DQ3A 2ACOA 3S5VA 2FTBA 4HPAA 3WXQA 3ZW2A 4QZTA 4IABA 3VPJE 1ERXA 1OBPA 1SXUA 1MDCA 3BU9A 3AKNA 1KXOA 4O4OA 1B56A 5L8NA 3PQSA 2K62A 4UU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHD A; 
#chains in the Genus database with same CATH topology
 1SWH A;  3P6C A;  3LV4 A;  2A8G A;  4QNI A;  4N7D A;  1X8P A;  2MWH A;  3FLL A;  4CV7 A;  1LF7 A;  5LKE A;  2RTJ A;  2RTQ B;  4KC7 A;  4QAE A;  4A1Y A;  5CSE A;  4CDE A;  2W2F A;  2GTL M;  2N93 A;  2WEW A;  3SLT A;  1A18 A;  3SZI A;  4YFR A;  1H91 A;  4OEL A;  1D3S A;  1STR B;  5FEN A;  2OVS A;  1ICN A;  4OKA A;  4ZHC A;  2IZF B;  5H9N A;  1LIC A;  1EW3 A;  1Y53 X;  3EYC A;  2HMB A;  2FLJ A;  2Y3E A;  2NND A;  3I17 A;  4GZV A;  1SWE A;  4TLJ A;  1TXL A;  3UEV A;  1S7D A;  4ZHG A;  4CPE A;  1QY1 A;  1SWD A;  1DZJ A;  2RTA A;  3LTW A;  2EU7 X;  3STM X;  2OF8 A;  4IMO A;  1VWF B;  3S26 A;  2AT8 X;  5LJG A;  2A2U A;  1SWQ A;  1SXY A;  1BSY A;  1ZNH A;  2OFM X;  1E2T A;  3RE6 A;  3B2K A;  5LJB A;  3WJC A;  1ML7 A;  1G85 A;  2FRS A;  3O22 A;  5HAE A;  3FEP A;  1DFV A;  1AVD A;  1DV9 A;  4BQU A;  2MO5 A;  1Y55 X;  4UU2 A;  3NAD A;  1OBU A;  4WHI A;  3VG3 A;  1EII A;  3RY2 A;  1LKE A;  1RXJ A;  3FID A;  5H9K A;  2BSZ A;  1PEE A;  4CPI A;  4QGX A;  4RUN A;  1KGL A;  1SWL A;  5K67 A;  3RY1 A;  3PK2 A;  1HN2 A;  4FGI B;  5LKF A;  3B2J A;  4BVM A;  2C1Q A;  1ZNG A;  3P24 A;  4QQ1 A;  2CZT A;  3BLG A;  3NQ9 A;  1N43 A;  2A0A A;  1MVG A;  1R0U A;  3P6H A;  4FQB B;  1HQP A;  2CZU A;  4QYN A;  5IRU A;  3ZW1 A;  2IZK A;  3TGB A;  2BHV A;  1AVG I;  2F73 A;  1I78 A;  1XCA A;  3MX7 A;  3D95 A;  1KT7 A;  4ID2 A;  4U3Q A;  3LHN A;  4GDA A;  4IAW A;  5AJB A;  3NPO A;  3SAO A;  3NBX X;  3F6Z B;  4AZR A;  4D6A A;  2L68 A;  1JZU A;  4TKH A;  1KQW A;  3CQR A;  4JHQ A;  5F2B A;  3TF6 A;  1N9Y A;  3ZW1 B;  5B5F A;  1BBP A;  1AB0 A;  2ZSC A;  2ALL X;  1JJX A;  4MVK A;  5JR8 A;  4HPD A;  3O2Y A;  3FW4 A;  3PH5 A;  5D48 A;  1VWL B;  2QOM A;  2R74 A;  4O9S A;  3WOV A;  1OEE A;  5F1E A;  1HMR A;  2AH7 X;  1FTP A;  1IKJ A;  4O4X A;  1RLB E;  2HLV A;  4YGG A;  5K68 A;  4D6B A;  1EAL A;  2O62 A;  5B5G A;  2JW1 A;  1YWD A;  2A3F X;  2W2A A;  1G74 A;  2QCB A;  1BSO A;  2R56 A;  4U9C A;  1ZNE A;  1B4M A;  5HZ6 A;  2GTL O;  2UZ2 A;  2G79 A;  1VWG B;  2IFB A;  4GNY A;  3RDQ A;  5JD2 A;  2RTG B;  1OEK A;  1BRP A;  2HZQ A;  1SXX A;  3CMP A;  3KQ0 A;  1P6P A;  2HKD A;  3JS1 A;  1QG5 A;  1VWO B;  5EZ2 A;  3KFF A;  5LJH A;  2LA7 A;  3MM0 A;  3WZQ A;  4YBP A;  3KVN A;  1PMP A;  4GU8 A;  5HBS A;  1SWF A;  2HZR A;  4KT5 A;  4CPF A;  2X4M A;  3WZO A;  1LUQ A;  3CWK A;  2JOZ A;  3X00 A;  1SLD B;  2MM3 A;  3UEW A;  2X46 A;  2K23 A;  1VWH B;  2DJG A;  4DCB A;  1HBP A;  1I9H A;  2RQ0 A;  4YGZ A;  1IFB A;  1U18 A;  1N0S A;  2AL0 X;  3OD9 A;  4GUZ A;  4ODD A;  1TVQ A;  4OMW A;  4PJ2 A;  5B11 O;  4EEJ A;  1G7N A;  1MM9 A;  4M6S A;  2F09 A;  1S2P A;  4GJV A;  2KTS A;  3OJY C;  2YMS A;  4AZN A;  4I3D A;  5IRA A;  2IZC B;  4GJS A;  3U03 A;  1AQB A;  2I5Z O;  2RTE B;  4U8U M;  5CYB A;  4ZFX A;  2GH7 A;  4IB8 A;  4CDF A;  4ZHD A;  1GX9 A;  1LID A;  1PBY A;  1SWS A;  1VWC B;  4GGR A;  2OFA A;  1STP A;  3AKM A;  5D45 A;  5FQ8 E;  5L3Y A;  2LFO A;  3FIQ A;  4YDA A;  2AT0 X;  3QKG A;  4IRW A;  3PDF A;  3VHM A;  4A8Z A;  5HWZ A;  1JQP A;  3ZI8 A;  5FQ6 E;  3ZZV A;  2VDF A;  4LZV A;  4YFQ A;  4YH0 A;  3TGC A;  2RTL A;  4OMX A;  1W4T A;  1RST B;  2L5P A;  5AJC A;  2KD2 A;  3Q34 A;  1RXH A;  4I3B A;  3CKF A;  3H3I A;  3FEL A;  1DC9 A;  4MVI A;  5BVS A;  4NNT A;  3FR5 A;  1Y9L A;  3PP6 A;  2PY1 A;  2BT9 A;  5HA1 A;  3P02 A;  2Q39 A;  3PQU A;  2Q2M A;  1DZM A;  3VGW A;  3FEK A;  3CQN A;  3T6F A;  3ZW0 A;  4Y5D A;  2R73 A;  2RN4 A;  1YP6 A;  1DZP A;  1L6M A;  2RTC B;  4MIR A;  5EDC A;  3RDS A;  3ZUI A;  2WWP A;  3WJG A;  5BVT A;  1GX8 A;  1JMX A;  2RTR B;  3WJB A;  1GKA A;  3MVF A;  4AZP A;  2AF5 A;  4Y0R A;  5AEO A;  2IZJ A;  2X8T A;  4YDB A;  5KID A;  3F9D A;  2C1S A;  2AT3 X;  4LQZ A;  3NQ3 A;  2KW1 A;  4NLI A;  1SWT A;  2RTI B;  2RTB B;  3APV A;  4XMF A;  1QY2 A;  3ZQ3 A;  4XME A;  3ZW0 B;  4Z6J A;  3WBG A;  3FDC A;  4O49 A;  4TQ2 A;  1OBQ A;  4I60 A;  1NC9 A;  2OVE A;  2ZAI A;  4ORU A;  4YKO A;  1ACD A;  1GKA B;  1TOU A;  5HCE C;  3UAQ A;  1LIB A;  1DZK A;  3VG4 A;  1BM5 A;  4L1N A;  1HMS A;  1SA8 A;  2Z4I A;  3BX7 A;  1VWN B;  1LPJ A;  2HYS A;  3D4R A;  3T2W A;  3VE2 A;  4EXZ A;  1IIU A;  2HNX A;  2RTD B;  4GK9 A;  5KHP A;  3NR3 A;  4NYQ A;  3APW A;  4WFU A;  2A2G A;  3OE3 A;  5B2A O;  1LEL A;  1ZNK A;  2LBV A;  4Z2V A;  3HK1 A;  4Z28 A;  3HOL A;  4TNN A;  3NQK A;  4I95 A;  2OY8 A;  4NW4 A;  4CPH B;  5DG4 A;  3MG5 A;  3O19 A;  1VWE B;  3APX A;  4HPB A;  2OY5 O;  5IXG A;  1VWR B;  1ZND A;  1GT5 A;  1K24 A;  1GX3 A;  1AVE A;  2X56 A;  3JQO A;  4YKM A;  1Y0G A;  4ZCB A;  2NNQ A;  4CK4 A;  4ARH A;  1UYN X;  3KZA A;  1NBX A;  2KT4 B;  4HPC A;  3WYP A;  3QQ2 A;  1YWC A;  2JGS A;  3ELX A;  3FR4 A;  1SY1 A;  5HCD C;  5DPQ A;  5B3M O;  4U8U O;  1YWA A;  2QO6 A;  1RAV A;  2WUT A;  2X8F A;  5HZ9 A;  1KQX A;  1SLG B;  1X8U A;  1QFV A;  3KFH A;  3Q6L A;  3V8U A;  1SRG A;  1LCZ A;  4I6S A;  4U46 A;  4FBO A;  4AW8 A;  1O8V A;  4A60 A;  2CBR A;  3CR6 A;  2BLG A;  3K3L A;  1ERB A;  1ICM A;  2QO5 A;  2BC3 A;  4I3C A;  4MVL A;  2I5V O;  2RCT A;  5H9A A;  5D4A A;  2JU7 A;  1VWM B;  2X8S A;  4K19 A;  1SWN A;  1LIF A;  1SWJ A;  1W5R A;  1NGL A;  2Y32 A;  3CKG A;  5LJD A;  1KFF A;  3ZWE A;  2POA A;  3U0D A;  1KZW A;  3L4R A;  4CDC A;  1O1V A;  2G7B A;  1I4U A;  2OY7 A;  1N7Y A;  1TW4 A;  1XKI A;  3BRN A;  4I9R A;  2PI3 O;  2W2B A;  5IRW A;  1FEM A;  1S44 A;  1SWB A;  1A2D A;  1QFT A;  1GT3 A;  4ORS A;  2AKQ A;  1YUP A;  2F01 A;  4O3Y A;  2OFR X;  2RTF B;  4GRJ A;  1IFC A;  1SWU A;  2AVI A;  2JU8 A;  4JO6 A;  3U9P C;  3WVM A;  4EDE A;  4YGH A;  3S5X A;  4JGL A;  1SLE B;  1Y9T A;  1LCV A;  1KOI A;  1WUB A;  4YMY A;  2G5L A;  1TOW A;  3TGA A;  4YCE A;  1KZX A;  5B29 A;  3HWF A;  4IB9 A;  1KT5 A;  2WQA E;  2ACP X;  1KL4 A;  3B2L A;  4OS0 A;  2ASN X;  1N4J A;  1NDJ A;  1PM1 X;  1HXZ A;  4IB7 A;  1FE3 A;  4YBU A;  3SZH A;  3GAQ A;  3NP1 A;  1T68 X;  4GGZ A;  4KC8 A;  4ES7 A;  1FJ1 E;  3NX1 A;  4NNS A;  3RDX A;  3TZS A;  4ZGF A;  1SRJ A;  3FEN A;  2ANS A;  1STS B;  1VWB B;  4WBK A;  4PSQ A;  4A1H A;  4LKP A;  5FQ7 E;  4TKB A;  1PTS A;  2IZL B;  2QMI A;  4Y0P A;  2WQ9 A;  1SWK A;  3SOT A;  1MUP A;  1U17 A;  2FGS A;  4JNJ A;  5K06 A;  2JU3 A;  5HZQ A;  2NP1 A;  3VHH A;  1YIV A;  2IZH B;  4Y0Q A;  3B2I A;  5HTE A;  3RDM A;  1E00 A;  1KT3 A;  3KFI A;  2OL8 O;  4BX6 B;  1YP7 A;  1FEN A;  1T8V A;  4QGV A;  3MBT A;  4ORW A;  2FR2 A;  2GTL N;  3F8A A;  5EPQ A;  3T1D A;  4XMD A;  1SY2 A;  3P6D A;  1I04 A;  3PEC A;  1LFO A;  2NNE A;  5L8I A;  3RDO A;  2GC9 A;  3EBK A;  3RBY A;  4ORY A;  1QY0 A;  4WFV A;  4BGF A;  5FAZ A;  1LCW A;  3RKG A;  1NQM A;  3IFB A;  1CBS A;  5D8J A;  4TJZ A;  2LBA A;  1JIW I;  2LB6 A;  1GGL A;  1A3Y A;  4MEE A;  3C78 X;  1OPB A;  1VYF A;  3HWD A;  1O1U A;  1ADL A;  5EEE A;  2QOS C;  3EBW A;  2OY1 O;  2FT9 A;  3FA6 A;  1AEL A;  2OF9 A;  2BS6 A;  4B55 A;  2MJI A;  3ZUO A;  4OS3 A;  4CSB A;  1E06 A;  1VWP B;  1K3B A;  1VYO A;  1GT4 A;  2IZE B;  3G7X A;  1SWG A;  1VPR A;  2Q2P A;  1VWA B;  2OVD A;  4NP1 A;  1X71 A;  2L67 A;  3FMZ A;  4IAX A;  4R0B A;  4XMC A;  3D96 A;  3VG6 A;  1SMP I;  3C77 X;  1SRF A;  1T0V A;  2AT6 X;  4ORX A;  1JBH A;  1HMT A;  3WJF A;  4INN A;  1SLF B;  3WYQ A;  1RBP A;  1EXS A;  1ALB A;  4GET A;  3RSW A;  3GE2 A;  2FHL A;  2RTP B;  3EC5 A;  1NP1 A;  1KL3 A;  2X45 A;  1SY0 A;  1UYO X;  3JSQ A;  5IO5 A;  2IZG B;  5LJC A;  4OS8 A;  1BSQ A;  1ZRY A;  5B27 A;  2RTM A;  3FA7 A;  3APU A;  1QQS A;  4AYH A;  1HY2 A;  2IZB A;  3UEU A;  2WSJ A;  4BX5 A;  1CBR A;  1EQD A;  1GT1 A;  1MX7 A;  1E02 A;  1NQN A;  1CRB A;  1QWD A;  2RD7 C;  2Y3F A;  3BSZ E;  3C76 X;  3FR2 A;  4CPH A;  3ELZ A;  3BS2 A;  2Z4H A;  2RTN B;  3NX2 A;  4NYR A;  5H9L A;  1OEJ A;  1ZNL A;  2OZQ A;  4UU3 A;  4L3R A;  4EFG A;  1A57 A;  3SZJ A;  5IO6 A;  2JMB A;  3RWX A;  1NP4 A;  3I0A A;  5HCC C;  4XMH A;  3D97 A;  1DF3 A;  3STN A;  1VWQ B;  4BX5 B;  2MHD A;  2FS7 A;  3KFG A;  2Q9S A;  2FWV A;  3WZN A;  1KT6 A;  1UZ2 X;  2M4L A;  2LKK A;  2UYW A;  3T2X A;  1SXW A;  4ON1 A;  3VG2 A;  1MK5 A;  1VWK B;  2XKL A;  3PPT A;  2MF6 A;  1YWB A;  1JJJ A;  5BYP A;  3DTQ A;  2AT5 X;  1BRQ A;  3FYF A;  4MVE A;  4YVB A;  1VWI B;  1X8O A;  3CBC A;  3BY0 A;  3D9W A;  2OL6 O;  1FDQ A;  2GJ5 A;  3N91 A;  1I06 A;  4TKJ A;  1SWC A;  1EPA A;  1PBO A;  3RZY A;  2ZAG A;  1FEL A;  4O4U A;  1LNM A;  3HOE A;  4CDD A;  2C4I A;  4DNE A;  4QZU A;  1IW2 A;  4LKT A;  2CAM A;  2X55 A;  2YG2 A;  4ZH6 A;  4DQ4 A;  5LJE A;  4O4S A;  3BDR A;  3CBS A;  4ALO A;  1U0X A;  5C0N A;  4Z27 A;  4BOE A;  5F7G A;  1LIE A;  4ZHH A;  5BVQ A;  2X32 A;  4HWM A;  5HZ8 A;  2FKJ A;  3FA9 A;  1EUO A;  1LDQ A;  4EKV A;  4GKC A;  4M7M A;  3PED A;  5F6B A;  1CBI A;  1DF8 A;  1Y52 X;  2FS6 A;  2Q4N A;  2RTO B;  1JYD A;  2A5B A;  3P6F A;  4GE1 A;  1EI5 A;  3VU1 A;  3WZP A;  1G5W A;  4COT A;  2RTH B;  1URE A;  4GGT A;  4BCS A;  3P6G A;  3VG7 A;  5HZ5 A;  2KTD A;  2FKG A;  4O3X B;  4LZU A;  1SY3 A;  3HWE A;  1E5P A;  1W6F A;  2WR6 A;  4C5P A;  5HTD A;  4I9S A;  4U8U N;  4FBR A;  1MOY A;  4HFO A;  1SWA A;  1SWP A;  1CBQ A;  3STK A;  5KIC A;  2QO4 A;  1IKE A;  1GXA A;  2GTF X;  2JN3 A;  4AZO A;  4IBA A;  5L8O A;  4IB6 A;  4KCA A;  4AZQ A;  3AUM O;  3VHI A;  2RCQ A;  1RXK A;  2VFB A;  3IA8 A;  4Z2P A;  4Y0S A;  5AQ6 A;  2A13 A;  2CBS A;  3P6E A;  4KH8 A;  4GDZ A;  2IZI A;  4ZHF A;  5CE4 A;  4QGW A;  1X89 A;  1QAB E;  4KII A;  4O3W A;  1I05 A;  5LJK A;  3UEX A;  1BLR A;  2XST A;  3EW1 A;  4RUU A;  1X8Q A;  3HPE A;  4BX6 A;  4GH7 A;  2L9C A;  5FFH A;  1B0O A;  2G8C O;  2IZD B;  3DSZ A;  4MIS A;  4N7C A;  4ALB A;  2DM5 A;  3WJD A;  2A5C A;  5IO7 A;  1SRE A;  3VE1 A;  1HBQ A;  4ZH9 A;  4QRL A;  2IZA A;  2WEX A;  4IMN A;  1MEP A;  4EQA C;  1EIO A;  1VWD B;  4NLJ A;  3WJE A;  1JMZ A;  1JYJ A;  2CM9 A;  2OFB A;  2FR3 A;  1HQQ A;  2RA6 A;  1GM6 A;  2VFC A;  3FW5 A;  2DJF A;  4YFP A;  4ML7 B;  2P8G A;  2QM9 A;  3B2H A;  2E4J A;  5EDB A;  4AZM A;  4ZGU A;  1OPA A;  3FA8 A;  1BWY A;  4XMG A;  1N9M A;  3HWG A;  1EPB A;  1CJ5 A;  3EM0 A;  5EED A;  2OVA A;  1B8E A;  1SRI A;  2CM4 A;  4O3Z A;  1MX8 A;  5F6Z A;  4BJ8 A;  1D2U A;  5CHK A;  1SWO A;  4Z2O A;  4ZJ0 A;  3E3C A;  3VG5 A;  1IJ8 A;  1WBI A;  2BS5 A;  3HTY A;  3BU1 A;  3OBL A;  4NV8 A;  5HA0 A;  1VWJ B;  3RE5 A;  1BJ7 A;  1X8N A;  3S60 A;  1VYG A;  5H8T A;  1LDO A;  3PH6 A;  2X34 A;  1BEB A;  4FBV A;  4GNW A;  2AMM X;  4ZR2 A;  1Z24 A;  2OL7 A;  3AEH A;  2G78 A;  4GD9 A;  3EMM A;  5F58 A;  2RTK A;  3SLJ A;  4YCH A;  4QYP A;  1JV4 A;  4ORR A;  5D47 A;  3RDU A;  1KT4 A;  1SWR A;  3BX8 A;  2ACO A;  4DQ3 A;  3EW2 A;  3SLO A;  5B10 O;  3S5V A;  2FTB A;  4HPA A;  3WXQ A;  3ZW2 A;  4BX7 A;  4QZT A;  4IAB A;  4Y59 A;  2OYB O;  1ERX A;  3T6L A;  1KL5 A;  1OBP A;  3VPJ E;  1HXL A;  1SXU A;  1MDC A;  3BU9 A;  1RSU B;  2FHN X;  3AKN A;  1KXO A;  4BBO A;  4O4O A;  1SRH A;  2WPU A;  1B56 A;  1JJU A;  1OSP O;  4NV7 A;  4BX7 B;  5L8N A;  3PQS A;  2K62 A;  4OEM A; 
#chains in the Genus database with same CATH homology
 3P6C A;  3LV4 A;  4QNI A;  4N7D A;  1X8P A;  2MWH A;  3FLL A;  4CV7 A;  1LF7 A;  5LKE A;  4KC7 A;  4QAE A;  4A1Y A;  2W2F A;  2GTL M;  2N93 A;  2WEW A;  1A18 A;  4YFR A;  1H91 A;  1D3S A;  5FEN A;  2OVS A;  1ICN A;  4ZHC A;  1LIC A;  1EW3 A;  3EYC A;  2HMB A;  2FLJ A;  3I17 A;  2NND A;  4TLJ A;  4GZV A;  1TXL A;  3UEV A;  1S7D A;  4ZHG A;  1QY1 A;  1DZJ A;  3STM X;  2EU7 X;  4IMO A;  3S26 A;  2AT8 X;  5LJG A;  2A2U A;  1SXY A;  1BSY A;  1ZNH A;  2OFM X;  3B2K A;  5LJB A;  3WJC A;  1ML7 A;  1G85 A;  2FRS A;  3O22 A;  5HAE A;  3FEP A;  1DFV A;  1DV9 A;  4BQU A;  2MO5 A;  4UU2 A;  3NAD A;  1OBU A;  4WHI A;  3VG3 A;  1EII A;  1LKE A;  5H9K A;  1PEE A;  1KGL A;  4QGX A;  4RUN A;  1HN2 A;  4FGI B;  5LKF A;  3B2J A;  4BVM A;  1ZNG A;  3P24 A;  4QQ1 A;  2CZT A;  3BLG A;  3NQ9 A;  2A0A A;  3P6H A;  1MVG A;  1R0U A;  4FQB B;  4QYN A;  1HQP A;  2CZU A;  3ZW1 A;  3TGB A;  2BHV A;  1AVG I;  2F73 A;  1XCA A;  3MX7 A;  3D95 A;  1KT7 A;  4ID2 A;  4U3Q A;  3LHN A;  4IAW A;  5AJB A;  3NPO A;  3SAO A;  3NBX X;  3F6Z B;  4AZR A;  4D6A A;  2L68 A;  1JZU A;  4TKH A;  1KQW A;  3CQR A;  3TF6 A;  3ZW1 B;  1BBP A;  1AB0 A;  1JJX A;  2ALL X;  4MVK A;  5JR8 A;  4HPD A;  3O2Y A;  3FW4 A;  3PH5 A;  5D48 A;  2R74 A;  4O9S A;  3WOV A;  1OEE A;  5F1E A;  1HMR A;  2AH7 X;  1FTP A;  1IKJ A;  4O4X A;  1RLB E;  2HLV A;  4YGG A;  4D6B A;  1EAL A;  2O62 A;  2JW1 A;  1YWD A;  2A3F X;  2W2A A;  1G74 A;  1BSO A;  2R56 A;  4U9C A;  1ZNE A;  1B4M A;  2GTL O;  2G79 A;  2IFB A;  4GNY A;  1OEK A;  2HZQ A;  1BRP A;  1SXX A;  3CMP A;  3KQ0 A;  1P6P A;  3JS1 A;  1QG5 A;  5EZ2 A;  3KFF A;  2LA7 A;  4YBP A;  1PMP A;  4GU8 A;  5HBS A;  2HZR A;  4KT5 A;  3CWK A;  2JOZ A;  2MM3 A;  3UEW A;  2X46 A;  2K23 A;  1HBP A;  2RQ0 A;  4YGZ A;  1IFB A;  1U18 A;  1N0S A;  2AL0 X;  3OD9 A;  4ODD A;  4OMW A;  1TVQ A;  4PJ2 A;  4EEJ A;  1G7N A;  4M6S A;  2F09 A;  1S2P A;  2KTS A;  3OJY C;  2YMS A;  4AZN A;  4I3D A;  3U03 A;  1AQB A;  4U8U M;  5CYB A;  4ZFX A;  4IB8 A;  4ZHD A;  1GX9 A;  1LID A;  3AKM A;  5D45 A;  5FQ8 E;  2LFO A;  3FIQ A;  4YDA A;  2AT0 X;  3QKG A;  5HWZ A;  3ZI8 A;  5FQ6 E;  3ZZV A;  4LZV A;  4YFQ A;  4YH0 A;  3TGC A;  4OMX A;  2L5P A;  5AJC A;  2KD2 A;  4I3B A;  3H3I A;  3FEL A;  1DC9 A;  4MVI A;  5BVS A;  4NNT A;  3FR5 A;  1Y9L A;  3PP6 A;  2PY1 A;  2BT9 A;  5HA1 A;  3P02 A;  2Q39 A;  3PQU A;  2Q2M A;  1DZM A;  3FEK A;  3CQN A;  3ZW0 A;  5EDC A;  2R73 A;  2RN4 A;  1YP6 A;  1DZP A;  1L6M A;  4MIR A;  3ZUI A;  5KHP A;  2WWP A;  3WJG A;  5BVT A;  1GX8 A;  3WJB A;  4AZP A;  5AEO A;  1GKA A;  3MVF A;  4Y0R A;  2X8T A;  4YDB A;  5KID A;  3F9D A;  2AT3 X;  4LQZ A;  3NQ3 A;  2KW1 A;  4NLI A;  4XMF A;  3ZQ3 A;  3APV A;  3ZW0 B;  1QY2 A;  4XME A;  3WBG A;  4O49 A;  4TQ2 A;  1OBQ A;  4YKO A;  2ZAI A;  2OVE A;  4ORU A;  1ACD A;  1GKA B;  1TOU A;  5HCE C;  3UAQ A;  1LIB A;  1DZK A;  3VG4 A;  1BM5 A;  4L1N A;  1HMS A;  1SA8 A;  2Z4I A;  3BX7 A;  4EXZ A;  1LPJ A;  2HYS A;  3D4R A;  3VE2 A;  1IIU A;  2HNX A;  4GK9 A;  3NR3 A;  4NYQ A;  3APW A;  4WFU A;  2A2G A;  3OE3 A;  1ZNK A;  2LBV A;  3HK1 A;  3HOL A;  4TNN A;  3NQK A;  4I95 A;  4NW4 A;  5DG4 A;  3O19 A;  3APX A;  4HPB A;  1ZND A;  1GT5 A;  4YKM A;  3JQO A;  4ZCB A;  2NNQ A;  4CK4 A;  4ARH A;  3KZA A;  2KT4 B;  4HPC A;  5HZ6 A;  5HCD C;  1YWC A;  3FR4 A;  3ELX A;  1SY1 A;  5DPQ A;  4U8U O;  1YWA A;  2QO6 A;  2WUT A;  2X8F A;  5HZ9 A;  1KQX A;  1X8U A;  3Q6L A;  1QFV A;  3KFH A;  3V8U A;  4I6S A;  4FBO A;  4AW8 A;  1O8V A;  4A60 A;  2CBR A;  3CR6 A;  2BLG A;  3K3L A;  1ERB A;  1ICM A;  2QO5 A;  4I3C A;  4MVL A;  2RCT A;  5H9A A;  5D4A A;  2JU7 A;  2X8S A;  4K19 A;  5LJD A;  1LIF A;  1NGL A;  3ZWE A;  2POA A;  3U0D A;  1KZW A;  3L4R A;  1O1V A;  2G7B A;  1I4U A;  1TW4 A;  1XKI A;  3BRN A;  4I9R A;  2W2B A;  1FEM A;  1S44 A;  1A2D A;  1QFT A;  1GT3 A;  4ORS A;  2AKQ A;  1YUP A;  4O3Y A;  2OFR X;  4GRJ A;  1IFC A;  2JU8 A;  3U9P C;  4EDE A;  3WVM A;  4YGH A;  3S5X A;  4JGL A;  1Y9T A;  1KOI A;  4YMY A;  1TOW A;  3TGA A;  4YCE A;  5B29 A;  3HWF A;  4IB9 A;  1KT5 A;  2WQA E;  2ACP X;  3B2L A;  4OS0 A;  5LJH A;  2ASN X;  1PM1 X;  4YBU A;  4IB7 A;  1FE3 A;  3GAQ A;  3NP1 A;  1T68 X;  4KC8 A;  4ES7 A;  3NX1 A;  4NNS A;  3TZS A;  4ZGF A;  3FEN A;  2ANS A;  4WBK A;  4PSQ A;  4A1H A;  4LKP A;  5FQ7 E;  4TKB A;  2QMI A;  4Y0P A;  2WQ9 A;  3SOT A;  1MUP A;  1U17 A;  5K06 A;  2JU3 A;  5HZQ A;  2NP1 A;  1YIV A;  4Y0Q A;  3B2I A;  5HTE A;  1E00 A;  1KT3 A;  3KFI A;  1YP7 A;  1FEN A;  1T8V A;  4QGV A;  3MBT A;  4ORW A;  2FR2 A;  2GTL N;  3F8A A;  5EPQ A;  3T1D A;  4XMD A;  1SY2 A;  3P6D A;  1I04 A;  3PEC A;  1LFO A;  2NNE A;  5L8I A;  2GC9 A;  3EBK A;  3RBY A;  4ORY A;  1QY0 A;  4WFV A;  5FAZ A;  3RKG A;  5D8J A;  3IFB A;  1CBS A;  4TJZ A;  2LBA A;  1JIW I;  2LB6 A;  1GGL A;  1A3Y A;  3C78 X;  1OPB A;  1VYF A;  3HWD A;  1O1U A;  1ADL A;  5EEE A;  2QOS C;  3EBW A;  2FT9 A;  3FA6 A;  1AEL A;  2BS6 A;  2MJI A;  3ZUO A;  4OS3 A;  4CSB A;  1E06 A;  1GT4 A;  3G7X A;  1VPR A;  2Q2P A;  2OVD A;  4NP1 A;  1X71 A;  2L67 A;  3FMZ A;  4IAX A;  4R0B A;  4XMC A;  3D96 A;  3VG6 A;  1SMP I;  3C77 X;  1T0V A;  4ORX A;  2AT6 X;  1HMT A;  3WJF A;  4INN A;  1RBP A;  1EXS A;  1ALB A;  4GET A;  3RSW A;  3GE2 A;  5IO5 A;  1NP1 A;  1JBH A;  2X45 A;  1SY0 A;  3JSQ A;  5LJC A;  4OS8 A;  1BSQ A;  1ZRY A;  5B27 A;  3FA7 A;  3APU A;  1QQS A;  4AYH A;  3UEU A;  2WSJ A;  1CBR A;  1EQD A;  1GT1 A;  1MX7 A;  1E02 A;  1QWD A;  1CRB A;  2RD7 C;  3BSZ E;  3C76 X;  3FR2 A;  3ELZ A;  3BS2 A;  2Z4H A;  3NX2 A;  4NYR A;  5H9L A;  1OEJ A;  1ZNL A;  2OZQ A;  4L3R A;  4EFG A;  1A57 A;  5IO6 A;  2JMB A;  3RWX A;  1NP4 A;  3I0A A;  5HCC C;  4XMH A;  3D97 A;  1DF3 A;  3STN A;  2MHD A;  2FS7 A;  3KFG A;  2Q9S A;  2FWV A;  1KT6 A;  1UZ2 X;  2M4L A;  2LKK A;  3VG2 A;  1SXW A;  4ON1 A;  2XKL A;  3PPT A;  1YWB A;  1JJJ A;  5BYP A;  3DTQ A;  2AT5 X;  1BRQ A;  3FYF A;  4MVE A;  1KZX A;  1X8O A;  3CBC A;  3BY0 A;  1FDQ A;  2GJ5 A;  3N91 A;  1I06 A;  4TKJ A;  1EPA A;  1PBO A;  3RZY A;  2ZAG A;  1FEL A;  4O4U A;  1LNM A;  3HOE A;  4QZU A;  1IW2 A;  4LKT A;  4ZH6 A;  2YG2 A;  4DQ4 A;  5LJE A;  4O4S A;  3BDR A;  3CBS A;  4ALO A;  1U0X A;  5C0N A;  4BOE A;  5F7G A;  1LIE A;  4ZHH A;  5BVQ A;  4HWM A;  5HZ8 A;  3FA9 A;  1EUO A;  4GKC A;  4M7M A;  3PED A;  5F6B A;  1CBI A;  4QYP A;  2FS6 A;  4GE1 A;  2Q4N A;  3P6F A;  1JYD A;  3VU1 A;  1G5W A;  1EI5 A;  4COT A;  1URE A;  3P6G A;  3VG7 A;  5HZ5 A;  2KTD A;  4O3X B;  4LZU A;  1SY3 A;  3HWE A;  1E5P A;  2WR6 A;  5HTD A;  4I9S A;  4U8U N;  4FBR A;  4HFO A;  3STK A;  5KIC A;  1CBQ A;  2QO4 A;  1IKE A;  1GXA A;  2GTF X;  2JN3 A;  4AZO A;  4IBA A;  5L8O A;  4IB6 A;  4KCA A;  4AZQ A;  2RCQ A;  3IA8 A;  4Y0S A;  5AQ6 A;  2A13 A;  2CBS A;  3P6E A;  4KH8 A;  4GDZ A;  4ZHF A;  5CE4 A;  4QGW A;  1X89 A;  1QAB E;  4KII A;  4O3W A;  1I05 A;  5LJK A;  3UEX A;  1BLR A;  2XST A;  4RUU A;  1X8Q A;  4GH7 A;  2L9C A;  5FFH A;  1B0O A;  3DSZ A;  4MIS A;  4N7C A;  4ALB A;  2DM5 A;  3WJD A;  5IO7 A;  3VE1 A;  1HBQ A;  4ZH9 A;  4QRL A;  2WEX A;  4IMN A;  4EQA C;  1EIO A;  4NLJ A;  3WJE A;  1JYJ A;  2CM9 A;  4YFP A;  2FR3 A;  2RA6 A;  1GM6 A;  5H9N A;  3FW5 A;  4A8Z A;  4AZM A;  4ML7 B;  2P8G A;  2QM9 A;  3B2H A;  2E4J A;  5EDB A;  4ZGU A;  1OPA A;  3FA8 A;  1BWY A;  4XMG A;  3HWG A;  1EPB A;  1CJ5 A;  3EM0 A;  5EED A;  2OVA A;  1B8E A;  2CM4 A;  4O3Z A;  1MX8 A;  5F6Z A;  1D2U A;  4ZJ0 A;  3E3C A;  3VG5 A;  2BS5 A;  3HTY A;  3BU1 A;  3OBL A;  5HA0 A;  1BJ7 A;  1X8N A;  3S60 A;  1VYG A;  5H8T A;  3PH6 A;  4FBV A;  1BEB A;  4GNW A;  2AMM X;  4ZR2 A;  1Z24 A;  2G78 A;  3EMM A;  5F58 A;  4YCH A;  1JV4 A;  4ORR A;  5D47 A;  1KT4 A;  3BX8 A;  4DQ3 A;  2ACO A;  3S5V A;  2FTB A;  4HPA A;  3WXQ A;  3ZW2 A;  4QZT A;  4IAB A;  3VPJ E;  1ERX A;  1OBP A;  1SXU A;  1MDC A;  3BU9 A;  3AKN A;  1KXO A;  4O4O A;  1B56 A;  5L8N A;  3PQS A;  2K62 A;  4UU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...