2MHKA

E. coli lpoa n-terminal domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMGTHTPDQSTAYMQGTAQADSAFYLQQMQQSSDDTRINWQLLAIRALVKEGKTGQAVELFNQLPQELNDAQRREKTLLAVEIKLAQKDFAGAQNLLAKITPADLEQNQQARYWQAKIDASQGRPSIDLLRALIAQEPLLGAKEKQQNIDATWQALSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMKAGIADWQKRYPNNPGAKMLPTQLVNVKAFKPAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elongated Structure of the Outer-Membrane Activator of Peptidoglycan Synthesis LpoA: Implications for PBP1A Stimulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords Penicillin-binding protein activator LpoA
total genus 68
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2mhkA01
1.25.40.650 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2mhkA02
1W3BA 3FP3A 2FBNA 3N71A 3Q49B 1ELWA 2WQHA 2OOEA 3CK7A 4J8DA 1HXIA 2C0MA 4HOQA 5M72A 4APOA 2VYIA 3MKRA 4GPKA 3Q15A 3QDNA 4UQYA 2PQNA 3S7FA 1PC2A 2FF4A 3E4BA 2UWJG 4YNDA 5D0OD 2V5FA 4U07A 1NA3A 1P5QA 4JL0A 1KLXA 3EDTB 3PDNA 3UPVA 4JA9A 3RO2A 2YQ8A 4GA2A 3QWWA 3MV2B 2LNIA 4H7YA 4NQ0A 2VGYA 2FO7A 3CVLA 4BTAA 4HOTA 4G23A 3FWVA 2VGXB 3ASGA 4I9EA 3VTXA 1Y8MA 3KD7A 2HR2A 4G1TA 4AY6A 3S7BA 5FJYA 2KCLA 2VGXA 2JLBA 3LYAA 2P58C 2J9QA 3MA5A 3OXGA 1OUVA 4Y6WA 3MV3B 2WPVA 2YHCA 3CK8A 3KS2A 3LCAA 4N5CA 5FZRA 3RO3A 2NC9A 3S7JA 5C1DA 2IFUA 4A1SA 1B89A 5HQ8A 4N2SA 3LY7A 3PE3A 4ME2A 2QFCA 4BT9A 1HH8A 1NZNA 3AS4A 3HYMB 4RG9A 1E96B 4LEUA 5CCMA 5LCWC 5G04C 2KCVA 3OXLA 4IN3B 3TG4A 4G25A 2FI7A 1TJCA 2VSYA 3CV0A 4J0UA 3TGOA 3QWVA 1QQEA 2UY1A 4NRHB 4GYWA 2XCCA 2C2LA 2PZIA 4GA0A 4G26A 2XGMA 4WNGA 3URZA 4EQFA 4F3VA 4CGVA 3ZFWA 3ASHA 3LY9A 3AS5A 4HORA 2HYZA 5KJLA 1HZ4A 3ASFA 4N3AA 3Q5MA 5A7DB 2AVPA 3KAEA 3ZHEB 5AYWD 5CCLA 4O6FA 3Q47B 5FTPA 2UY1B 4JHRA 4KXKB 1WM5A 4GZ6A 2C0LA 4YVOA 3U4TA 5BT1A 1KT0A 2E2EA 3QOUA 5EKQD 4I1AA 4KYOB 5EX0A 3ZPJA 4U0ZA 4CDRA 1IYGA 5G05C 1FCHA 3TG5A 3ZGQA 3MEKA 2R5SA 3QWPA 4U04A 5BW8C 5LCWJ 4J8EA 4KBQA 4UQZA 3LKUA 4Y6CA 4BWRA 1IHGA 2KC7A 5JJ7A 4XI0A 3CK9A 3QKYA 2IF4A 4P29A 4N39A 2PQRA 4H7XA 3PE4A 2GW1A 2L6JA 4I2ZA 4HOSA 2Y4UA 4JA7A 4N3BA 4J8FA 3SF4A 2MHKA 1ZBPA 2VQ2A 3BEEA 3CVPA 3IEGA 5FZSA 3WXXA 3RIBA 5EX3A 4U0SA 4UI9J 4WNFA 2XPIA 3LPZA 3NF1A 4WUYA 3S7DA 2VSNA 3VTYA 2XEVA 5JJ6A 4I9CA 3RJVA 3ULQA 4W9RA 1XNFA 1A17A 4ABNA 4AY5A 3GW4A 3ZN3A 4UI9C 5CHEE 4CGWA 4B94A 5KJMA 2HO1A 3LY8A 2BUGA 3K9IA 4XIFA 3RU0A 4BTBA 4GYYA 4GYOA 3R9AB 2Y4TA 4G2VA 3O48A 5ARGA 1KT1A 2I6HA 2XGSA 5G05J 3RKVA 1ZU2A 1ELRA 1WAO1 2FEZA 4HOUA 4I17A 2KATA 3CKCA 3ESKA 4U0UA 2DBAA 3ASDA 5A6CA 5KJKA 3GZ2A 3SZ7A 5KJNA 3U3WA 4GCOA 3CVQA 1NA0A 2Q7FA 4YVQC 5JJTA 3AS8A 3UQ3A 3GYZA 4N3CA 4I2WA 5D0QD 2XGOA 4G24A 5ARFA 1YA0A 2KCKA 5DIZA 3OXFA 5G04J 4RG6A 5FZQA 3CKBA 3TAXA 4UI9K 2XCBA 4UQXA 4AIFA 3CEQA 4WNDA 2ONDA 4WNEA 3CVNA 3FFLA 3ZHEA 2LSVA 5BNWA 2LSUA 4GA1A 5HI7A 4AM9A 4BT8A 4N2QA 5DBKA 1QZ2A 2PL2A 5FT9A 3JYSA 4GZ3A 4GZ5A 3GZ1A 3Q4AB 4XI9A 3UUXA 4GCNA
chains in the Genus database with same CATH superfamily
2C0MA 1VDYA 3DSXA 4IULA 2IO2C 2GGFA 2LXLA 3MX3A 2LNIA 1U3CA 1NFIE 4M7CA 4CRWA 3UKRG 3NZSA 2VGXA 3PRZA 1INZA 4C0EA 3DWLG 3ABLE 3FH7A 5C1DA 4JEHA 4U7EB 5FWQA 2VSYA 3UINC 2XCCA 2CHZA 4GA0A 4JXTA 2GRPB 3U9WA 1SW6A 2PM7A 4NIKA 3ABME 3ZYMA 1KT0A 2V5QC 3IBEA 3SD5A 4OVVA 3DRAA 1H2UA 2WMNA 4CT4A 2EIME 5JJ7A 4WWNA 3ULYA 4XZ4A 3WXXA 3ZYKA 1N0RA 4ABNA 3FTYA 3PNTB 2GRQB 4UI9C 4LNGA 1TNBA 3I3NA 3FUIA 4DUIA 1DCQA 2DBAA 2VTBB 1YCSB 3CVQA 1UW4B 2DYSE 3IHYA 2KZTB 4Q94A 3AG2E 1OCCE 1HG2A 2FBNA 3Q49B 5D66A 3HXCA 5JMND 5ENPD 1HF8A 1UG3A 3RAUA 3D9JA 3E32A 3JXJA 1FVHA 3MCXA 4K0RA 3R9AB 1JCQA 3IHVA 4DX7D 4RLYA 1NP7A 4ILIA 1NZNA 2KCVA 3OXLA 4I6EA 4G25A 3IV0A 2WXHA 4F3VA 2WXFA 2H6IA 5HKPA 4LRZA 4JD2G 3U4TA 2IY0C 5AQAA 3ASNE 5FIOA 4AVXA 4KZ0A 4BWRA 2ZXWE 3CK9A 1DNPA 2B6CA 5KBAA 2CG3A 1SZ9A 2BTDA 3K9IA 1WG0A 1HU3A 4YDYA 3O48A 3B7UX 5KJNA 4GCOA 3NOCD 1BU9A 4WNEA 4FJZA 4N5QA 3Q4AB 1KZPA 2P9PG 3JXIA 3FY4A 2QC9A 2XZDG 4UQYA 4PS8A 2UWJG 2VTBA 1Z3XA 3FUNA 4FC8A 4AXHA 1TYQG 3NZUA 2VGXB 3T8KA 3KD7A 2HR2A 2WXQA 2QYJA 2Y69E 1MJ0A 1EDUA 3OXGA 2VSXE 3MV3B 1ELKA 5AJDA 4RG9A 2YNQA 4Q96A 1SZAA 1S70B 2WQ7A 3TXMA 4BETA 3SFXA 3ML8A 1JPLA 3O4ZA 2NSZA 5J08A 2WB2A 4HI9A 1V54E 3TG5A 5CBOA 1H6OA 3Q9NC 3QWPA 1E8ZA 3L13A 1AP7A 3CHSA 3FU3A 4JHKA 1KZOA 3VTYA 2WMOA 2KM4A 4W9RA 3D9HA 4ZFHA 3CLJA 1K1BA 3KEAA 1D8DA 3KEZA 3RKVA 5KJKA 4R7LA 3ESKA 3P1UA 3FTVA 4YVQC 2J4BA 3ABKE 4UWHA 1YA0A 3JQ0A 3UT7A 3CHRA 1OCRE 5G55A 4GTOA 4GCNA 2IOLA 3Q78A 2DZOA 4J8DA 2LAIA 4JHJA 5AN8A 1P5QA 2R17C 2ZU6B 1N95A 4KMOA 5H7PA 4G23A 4EBAG 4TXRA 4BX9A 5FJYA 5AQ9A 4MLPA 3KS2A 1HG5A 4DI4A 5HQ8A 2L0TB 1DVPA 2E0IA 4IN3B 3B7SA 3CV0A 4U63A 2UY1A 4HLEA 4HORA 3LY9A 4YDWA 4X8QA 4URKA 1PAQA 3TL5A 3MEKA 1TN7A 3HHMA 2DWZA 2WXPA 4MRUA 2H6GA 4GTVA 2RFMA 1E8WA 1E7UA 3LPZA 4XKCA 5CHEE 1N11A 4G2VA 2V4HC 1KT1A 1D8EA 4L2YA 5AAOA 2Y1LE 3EU9A 4KT6B 4I2WA 2XGOA 5G04J 4FU3A 4RG6A 4F7AA 1MX4A 4J6IA 4E6HA 1N52A 2KZTA 2LSVA 2X6KA 2J8SD 4UWKA 1N4QA 4EPZA 2J4DA 1TJFA 3MKRA 5AQ7A 3EU5A 3PEUB 4M3OA 3TWQA 2VGYA 3CVLA 1TR4A 3SFYA 1EPUA 2ZIRA 5EYPF 4AY6A 5BUZA 3UMVA 2J9QA 3DSSA 4L2LA 3TG4A 4DLOA 3CK8A 4A1SA 3U66A 3P2BA 2ETCA 2HM8A 4LEUA 5LCWC 2P9LG 3UM3A 2FI7A 3ZYQA 4FJYA 3HXDA 4ANVA 2QYUA 4N3AA 3Q5MA 3KAEA 4O6FA 2UY1B 2ETBA 2XQ0A 3SGHA 4BSZB 2CFZA 2XPYA 3E30A 4A3TA 1WY6A 4DPRA 2F0YA 2PQRA 1JWGA 2EQXA 1DCEA 2R2LA 5CRVA 3S2AA 3BEEA 4CCAA 4DRXE 3S7DA 4IRUA 4I9CA 2H6HA 4TV3A 4BSXA 2EINE 3UIOC 1G3NB 3CHOA 5FINA 3T8MA 4ATGA 3EIJA 3I4RB 3MKQB 4WNDA 4GZ3A 3GZ1A 3LJNA 1HE8A 1HXIA 1JCRA 3CHPA 1NL4A 3FU0A 4EBAA 4Z68A 4BFRA 1KPSB 4H7YA 3PH0C 3SO8A 2L6BA 4KVMA 3ASOE 1LD7A 2WPVA 2NC9A 4GTMA 3RRUA 3CHMA 3FUFA 1HH8A 3ENEA 4CT0A 5G04C 3L9TA 4OAVB 3TGOA 3C5RA 4G26A 1OY3D 4G11A 1MHQA 3CSFA 3ZUVB 5CECB 3FULA 3HDXA 2IO3C 3BU8A 1O1SA 3CVYA 3LXUX 4L23A 3TXNA 2IOSA 1A5EA 3LJ3A 3Q9UC 2F8XK 4HXIA 3DSUA 5ENNA 4YDOA 2HE0A 4HRMB 2GRMA 5EYLA 3SF4A 1E7VA 3RIBA 4WUYA 2VSNA 2XEVA 3ULQA 2XS8A 1N9AA 3LY8A 3B7RL 1BLXB 4KVOA 3BUAA 3CVVA 2LUHA 2ILRA 1ZU2A 2H6FA 4U0UA 2WXJA 1L5JA 3TWSA 3FTWA 3HXFA 3ONKA 4XEIG 3B13A 3FFLA 2WXMA 2LSUA 4GA1A 4U8YD 2PM6A 3PNLB 5ANLA 5B1AE 5LP0A 5FQ4A 4I6JA 3TJPA 4I43A 3PUJA 1OWNA 1QBQA 1O1TA 1TNUA 5BV0A 3Q75A 3QWWA 3V30A 3TWRA 4U8VD 4HOTA 3RK6A 1Y6IA 2XRZA 2OCCE 2P9SG 4WWOA 5AJLA 4BY6A 3LY7A 3L82A 3FU6A 1MYOA 2YINA 1TJCA 4ILGA 2XEEA 1UOHA 1MZCA 2WXRA 3EUVA 3URZA 4CGVA 1IKND 4UWLA 2HYZA 1FPPA 2L9BA 5EDSA 5AYWD 1O5MA 3LS8A 3Q47B 1WM5A 5A23A 2M63A 5KNHD 3ZXSA 4EZKA 3Q7AA 5EX0A 3ZPJA 4U0ZA 3EHNA 4CEMA 3NBNB 4XI0A 5C2YA 3RSEG 3FUKA 2GW1A 2L6JA 4I2ZA 3T5XA 3IEGA 1UJKA 1Z3YA 1XNFA 2IJGX 4GTQA 1SQMA 5KJMA 3DSWA 2HO1A 3C3RA 1SA4A 4GZCA 4GYYA 2WXLA 4K5BA 3ZXPA 2CHWA 2I6HA 5E76A 3U3WA 3TAXA 5LOZA 4ILHB 4HRNA 4DX1A 2LAHA 3ZHEA 5BNWA 2PL2A 5ENRD 5CMWA 1ELWA 4O1OA 3Q7FA 2VYIA 4LUNU 2FF4A 1S64A 2V5FA 5EILA 1N4PA 2GROB 1MQSA 3CQGB 4C48B 2P9KG 1Z6TA 3RRNB 2KCLA 2LXMA 3MA5A 1DC2A 3FUMA 3UM2A 3D9PA 1HX8A 4L7TA 3D9KA 3R7QA 3L16A 4NRHB 3UT8A 4U8HA 5KWDA 2JEKA 3AS5A 2OEWA 3PZ1A 1N0QA 4UUCA 4YVOA 2PNNA 3ISMC 2GRRB 4PH4B 1H2VC 3ULEG 2JABA 1IHGA 4L1BA 4JVSA 5CEAA 3QB2A 3LVQE 2IF4A 3C98A 4JA7A 2CFUA 5HS0A 1RW2A 4TXPA 3SY2A 3NF1A 4AY5A 4BESA 2AXVA 3RU0A 3PZ3A 3AG4E 2XGSA 5G05J 2A5EA 3FDHA 3SZ7A 1MX2A 4K5CA 4BERA 5CERB 3AAAC 4NACA 3UM1A 4BEPA 5IY5E 2EIKE 3D3MA 5KNGA 1W3BA 3V79K 1WDYA 2VJ8A 3CK7A 4CDMA 4OAUC 4HOQA 4AEZC 5KCMA 4J8YA 3QDNA 1PC2A 1BPOA 1HO8A 3RO2A 4HBDA 2WXKA 4WWPA 3ZIMA 3FTUA 4NQ0A 1E8YA 5LFAA 3EHQA 4DK5A 5AENA 3AJIA 3CVWA 1XGWA 2I2OA 2AW6A 1TEZA 3FH8A 3OAWA 2XZTG 3L6AA 1H6PA 3HYMB 3AS4A 1E96B 3DXMG 3FTSA 2PZIA 2XGMA 4WNGA 4DX2A 1QYMA 4KXKB 4GZ6A 3J5QB 3QOUA 2KBXA 4GMLA 2ZGGA 4ANXA 3D9IA 4UQZA 2NXPA 3V2OA 2I1KA 4P29A 2A5UA 3VLFA 3U64A 3NB2A 3V2XA 1FT1A 4C9BB 1ZBPA 5EX3A 4U0SA 4WNFA 2XPIA 2OVFA 3ZN3A 4B94A 2BUGA 2Y4TA 5B3SE 2F8YA 1S63A 1OWPA 4HQDA 4N2QA 1NA0A 2EILE 1OXJA 3OXFA 4F1SA 3FU5A 3L54A 4JW1A 3CSTA 1N54A 1IQRA 3R7RA 3T9KA 3QNKA 4B8CB 4B93B 2IONA 3FP3A 3TWWA 1BI7B 4YDEA 2DCPA 1ZB1A 3ONLA 3CR3A 5JHBA 3VLDA 1LF8A 5D0OD 4JL0A 3UPVA 4BTAA 2ETAA 2A4ZA 3G2VA 1O1RA 4K03A 3ML9A 4Q69A 3QARA 3JUIA 5ENSD 1V55E 1HS6A 3E33A 1Z5SC 3PE3A 4O1PA 2F37A 2I1JA 4J7WA 2KXPC 3QWVA 2V4LA 2OV8A 2AXUA 1OCZE 4I1MA 3PEVB 2XEHA 5E75A 3ASFA 3PZ4A 5FTPA 4UWGA 2NYJA 3FUEA 2XENA 2WQ6A 2J09A 3SBTB 2WXNA 3FUHA 2WVIA 4CZ2D 2DVWA 1IQUA 1X81A 2X6IA 4H7XA 2X3MA 3C3OA 4HOSA 2VQ2A 3SQVA 4ACKA 4BT9A 5JJTA 4GTSA 4PS7A 2WXOA 3QC1A 1BD8A 4I1OB 3WG7E 2J08A 4JC8A 4PDXA 1D9SA 2FEZA 4I17A 3FEYA 4HOUA 3CKCA 3ESLA 1OWMA 4N3CA 3B95A 5D0QD 2KCKA 1TN8A 5D2MC 4NURA 1RZ4A 2ONDA 5G2NA 5DBKA 3UUXA 4HB5A 3Q73A 5EN5D 4MBGA 1JUQA 3MGBA 2GRLA 4GA2A 4U96D 2FO7A 4A63B 5ANRA 4QFVA 1N4RA 2AJAA 3PZDA 3FTZA 3RO3A 3S7JA 4F6RD 2IQCA 3ZRHA 4ME2A 3SHFA 1TNYA 5FQ6A 2X6JA 3ZU7B 4J0UA 5B1BE 3ZFWA 3ASHA 5KJLA 5A7DB 2AVPA 4TXQA 5BPPA 3SBSA 4DX6D 1E90A 5BT1A 4I1AA 3NQPA 4GTPA 4ZHBA 4GB9A 2R5SA 5BW8C 3DEPA 4I6GA 3V31A 3EJNA 4GZDA 3CHQA 2X6FA 5JJ6A 5JA4D 4F1PA 1SVXA 1H19A 4F53A 1H6KA 2X38A 1JCSA 2RKKA 2QZAA 3ASDA 3FUDA 1TNZA 2Q7FA 3UXGA 5DIZA 3W9GA 5ENOD 3CVNA 4A1GA 5EIDA 4AM9A 1QZ2A 5FT9A 4IYPA 1X5BA 3N71A 4OYSA 3UT4A 2OOEA 5JHAA 3HVEB 2PQNA 1NA3A 2AWIA 3B7TA 3MV2B 3ZEFA 5BXUA 4E85A 2X6HA 3ZVVA 1H2TC 4G1TA 2DIWA 4HI8A 4DLQA 4FHJA 4MS6A 3MZLB 4QQIA 2BKGA 1OWLA 3D9OA 4AOFA 4C0MA 4JZYA 5FQ8A 4LSZE 3G2TA 3I5PA 1MX6A 3DSTA 3FUJA 4PS3A 1FVFA 1NI1A 2J49A 2P9NG 1IYGA 3E37A 3HRAA 2B0OE 3LVRE 3LDZA 3CGHA 4N39A 4N3BA 3CVPA 3G2SA 3TWXA 3PZ2A 4TRQA 2BKKB 3W9FA 2EIJE 5AQBA 1AWCB 1ELRA 2MYOA 3J5PA 3GYZA 5ARFA 1UJJA 4U95D 3CKBA 3PUKA 3EHMA 3EHRA 4GZ5A 1H0AA 4HFGA 1OWOA 3Q15A 2OEVA 3S7FA 3E4BA 4N2SA 4U07A 3AG1E 2R59A 4D10C 5HRYA 4I9EA 1OCOE 1Y8MA 1IXVA 1Q2ZA 1UN8A 3MJWA 3FHEA 4RSYA 3QK0A 3LYAA 1OUVA 4EHMA 4K5AB 5CRUA 4FA6A 1QNFA 1S0PA 1OT8A 3TWUA 4PUCA 3NOGD 1N94A 5CMYA 4FLHA 4JHRA 4A55A 2AXZA 1K8KG 5T8IA 3QAQA 4KYOB 3DPDA 5G05C 4L9PA 5LCWJ 4J8EA 2XPZA 5AIJA 2MRIA 4KZCA 3D9LA 2MHKA 1JWFA 3VLEA 4WAFA 3RJVA 1A17A 3GW4A 3TWVA 4BTBA 2R03A 3HVEA 5ARGA 5FQ7A 4EZLA 3UTMA 3AS8A 3UQ3A 4LNBA 2XCBA 3UIPC 5HI7A 4BT8A 3C72A 2QY7A 3DXKG 5M72A 2XHEA 2CHXA 4GU5A 3HG0D 4YNDA 3AU5A 1YYHA 3EDTB 1K3ZD 2YQ8A 3BG0B 3RRMB 3FWVA 3VTXA 4APFA 3PS6A 4CYMD 3L17A 4J8SA 2ZISA 2P58C 1B89A 3IXEA 1QQEA 3PREA 4GYWA 2C2LA 4G8KA 3SI5A 5EIBE 2XS1A 2DYRE 4AJWA 2R05A 3CIAA 2VSOE 4RQIA 2RG8A 3JQ1A 3GZSA 1U3DA 2WXIA 5BV1A 3ZW3A 1LTXA 3LKUA 2DZNA 4Y6CA 2KC7A 4ATZD 3PVLA 2RD0A 4JB8P 3PE4A 2Y4UA 2WM9A 5FZSA 4UWFA 2ZGDA 3FEXA 2FULA 4CGWA 5T4YA 4XIFA 3L08A 1EF1C 3CVXA 3R9MA 3BQOA 4OVUA 2KATA 4JEUA 5A6CA 2CG2A 2I9CA 5FZQA 5LX8A 2VGEA 4UI9K 4UQXA 4GTRA 3JYSA 4XI9A 3DSVA 3FH5A 3MKQA 4B89A 4LG6A 4JA9A 3G2WA 4CDNA 4LERA 1HFAA 2OVBA 3ASGA 5BXOA 2IU1A 4FP7A 1GW6A 3AG3E 3D9MA 3S7BA 3ZKJA 3FTXA 3I4GA 2YHCA 5ENQD 4HVBA 3BG1B 4DX5D 4HS2A 1EYHA 4ANUA 2RFAA 3APFA 2FO1E 4JPSA 2Y3AA 5CCMA 3CVUA 3E34A 4GMRA 3JUEA 5ITZF 1HZ4A 3ZHEB 5CCLA 4GMJA 5ENTD 4B0ZA 2C0LA 4BX8A 3DEOA 4ANWA 2E2EA 5EKQD 3MYVA 4LCTA 2GRNB 2WXGA 3X2QE 4U04A 4KBQA 2IEJA 4B8AA 4DJAA 3QKYA 4FHKA 4V3IA 1YMPA 3KSLA 1N4SA 4J8FA 3CQCB 4XE0A 4UI9J 3ZYLA 4TUMA 4TUUA 2XRYA 2V8SE 3G2UA 5AARA 1K1AA 4RVBA 1FT2A 4HNAD 4GPMA 3D9NA 4FADA 3SNXA 3T5VA 4G24A 1IHBA 1TN6A 3DBSA 3JCKC 4AIFA 3CEQA 3DPYA 4G8LA 4O60A 3OTNA 4XX5A 4AV7A 4EZJA 4A3VA 4EQFA 4HLLA 3EIQC 2MOWA 2WQHA 4APOA 2P9UG 3UX4A 4GPKA 4GAAA 1KLXA 3C3QA 3PDNA 2V0PA 5CEDB 5J90A 3LEWA 2P9IG 1UN9A 1SA5A 3UI2A 3HXEA 3QJZA 4FULA 3ZNGA 2LO6A 2JLBA 4Y6WA 3B7BA 4N5CA 5FZRA 3LCAA 2IFUA 2L0IA 2P2CP 3HXBA 2QFCA 2YHEA 3F6QA 3L22A 5T3RA 3APCA 4FLBA 5CBNA 1LD8A 4ACLA 2Y0BG 4EECA 1E8XA 4GTTA 2J07A 3Q79A 2R02A 4CDRA 1FCHA 3AU4A 3HIZA 4LNUD 1BI8B 4HRLA 1PY1A 3IKOB 3APDA 3TWTA 1U2VG 4GYOA 1TNOA 3ZGQA 1WAO1 4DI3A 3GZ2A 3NAWA 3UM0A 4XKBA 3KSQA 4AP2A 2BEDA 3UKUG 3SFZA 2BF0X 4MKTA
chains in the Genus database with same CATH topology
1W3BA 1H0AA 4HFGA 2VJ8A 3CK7A 4CDMA 1TJFA 1OWOA 2C0MA 4HOQA 1VDYA 4AEZC 5KCMA 3MKRA 3Q15A 3QDNA 3S7FA 1PC2A 3E4BA 4N2SA 3PEUB 4U07A 1BPOA 2R59A 1HO8A 4IULA 3RO2A 4D10C 2GGFA 3MX3A 4M3OA 2WXKA 4WWPA 2LNIA 3ZIMA 3FTUA 4NQ0A 1E8YA 1U3CA 2VGYA 3CVLA 5LFAA 4I9EA 1Y8MA 4CRWA 1EPUA 3NZSA 4DK5A 1UN8A 3MJWA 5AENA 4AY6A 5BUZA 3FHEA 2VGXA 3PRZA 4RSYA 1INZA 3QK0A 3LYAA 3UMVA 2J9QA 4L2LA 3TG4A 3CVWA 1OUVA 4C0EA 4DLOA 3CK8A 1XGWA 2I2OA 2AW6A 3FH7A 5C1DA 1TEZA 4A1SA 3U66A 3FH8A 3OAWA 3L6AA 3P2BA 4JEHA 4FA6A 3HYMB 3AS4A 1QNFA 1E96B 2HM8A 4LEUA 5LCWC 1S0PA 5FWQA 2FI7A 2VSYA 3ZYQA 3FTSA 4PUCA 4FJYA 2XCCA 2CHZA 2PZIA 4GA0A 2XGMA 4JXTA 4WNGA 5CMYA 3U9WA 4ANVA 4FLHA 4N3AA 3Q5MA 3KAEA 4O6FA 2PM7A 2UY1B 4JHRA 4KXKB 4A55A 4GZ6A 2AXZA 3ZYMA 2XQ0A 5T8IA 1KT0A 3QOUA 3IBEA 3QAQA 3SD5A 4OVVA 4KYOB 3SGHA 3DPDA 5G05C 4GMLA 1H2UA 5LCWJ 4ANXA 2WMNA 2CFZA 3D9IA 2XPYA 4J8EA 4UQZA 2NXPA 4CT4A 2XPZA 4A3TA 5AIJA 2MRIA 5JJ7A 1WY6A 4DPRA 2I1KA 4P29A 2PQRA 2A5UA 3VLFA 3U64A 1JWGA 4KZCA 2EQXA 4WWNA 3D9LA 3S2AA 2MHKA 1ZBPA 3BEEA 1JWFA 4C9BB 4XZ4A 3VLEA 4CCAA 3WXXA 5EX3A 4U0SA 4WNFA 2XPIA 3S7DA 3ZYKA 4IRUA 2OVFA 4WAFA 4ABNA 4I9CA 3RJVA 1A17A 3FTYA 3PNTB 4TV3A 3GW4A 3ZN3A 4UI9C 4B94A 2BUGA 4BSXA 3I3NA 4BTBA 2Y4TA 3HVEA 5ARGA 5FQ7A 4EZLA 3FUIA 3CHOA 1OWPA 2DBAA 2VTBB 4N2QA 3CVQA 1NA0A 1UW4B 3AS8A 3T8MA 3UQ3A 4ATGA 3EIJA 3OXFA 4F1SA 3IHYA 3FU5A 3L54A 4JW1A 2KZTB 2XCBA 1N54A 3CSTA 3I4RB 3MKQB 4WNDA 1IQRA 5HI7A 4Q94A 3R7RA 4BT8A 3QNKA 4B8CB 4GZ3A 3GZ1A 2QY7A 1HG2A 2IONA 3FP3A 2FBNA 1HE8A 3Q49B 2DCPA 1HXIA 5M72A 2XHEA 3ONLA 3CR3A 3VLDA 3CHPA 5JHBA 2CHXA 1LF8A 3FU0A 4GU5A 4YNDA 3AU5A 5D0OD 4EBAA 4JL0A 4BFRA 3EDTB 3UPVA 2YQ8A 4H7YA 3BG0B 3RRMB 3PH0C 1HF8A 1UG3A 4BTAA 3D9JA 3FWVA 3VTXA 2A4ZA 3G2VA 4KVMA 3PS6A 4APFA 4K03A 1FVHA 3ML9A 4Q69A 3QARA 3MCXA 4K0RA 3JUIA 3L17A 4J8SA 2P58C 3R9AB 2WPVA 3IHVA 2NC9A 1HS6A 3RRUA 1B89A 1NP7A 3PE3A 4ILIA 3CHMA 3FUFA 1HH8A 1NZNA 3ENEA 4CT0A 5G04C 2KCVA 3OXLA 4I6EA 4G25A 2I1JA 3IV0A 2WXHA 3TGOA 3QWVA 1QQEA 3PREA 2V4LA 2OV8A 2AXUA 4GYWA 4F3VA 2C2LA 4I1MA 4G26A 2WXFA 3PEVB 4G11A 3SI5A 5E75A 1MHQA 3ASFA 3CSFA 3FULA 3HDXA 4LRZA 5FTPA 4UWGA 3LXUX 4AJWA 3U4TA 3CVYA 3CIAA 2VSOE 4L23A 3FUEA 3TXNA 2WQ6A 2J09A 3SBTB 2IOSA 2WXNA 2RG8A 3FUHA 3JQ1A 3GZSA 2WVIA 1U3DA 2WXIA 3LJ3A 5BV1A 3ZW3A 4HXIA 4AVXA 3LKUA 4Y6CA 4KZ0A 4BWRA 2KC7A 5ENNA 1IQUA 2X6IA 3CK9A 3PVLA 2RD0A 4H7XA 3PE4A 1DNPA 2X3MA 4HOSA 2Y4UA 2GRMA 2WM9A 3SF4A 2VQ2A 1E7VA 5FZSA 4ACKA 3RIBA 2CG3A 4WUYA 4BT9A 5JJTA 2VSNA 2XEVA 4UWFA 3ULQA 3FEXA 1SZ9A 2FULA 4PS7A 2BTDA 5T4YA 4CGWA 3LY8A 2WXOA 3K9IA 4XIFA 3L08A 3B7RL 1EF1C 3QC1A 4I1OB 4KVOA 3CVXA 3CVVA 2J08A 1HU3A 4JC8A 3O48A 4PDXA 3B7UX 4OVUA 2ILRA 1ZU2A 2FEZA 4I17A 3FEYA 4HOUA 2KATA 3CKCA 4JEUA 4U0UA 5A6CA 2WXJA 1L5JA 5KJNA 3ESLA 4GCOA 1OWMA 2CG2A 4N3CA 3FTWA 5D0QD 2KCKA 2I9CA 5FZQA 4NURA 5LX8A 4UI9K 3ONKA 4UQXA 3B13A 4WNEA 2ONDA 4FJZA 3FFLA 5G2NA 2WXMA 2LSUA 4GA1A 2PM6A 5DBKA 3JYSA 3PNLB 4XI9A 5ANLA 3Q4AB 5LP0A 3UUXA 5FQ4A 3FH5A 3FY4A 4I6JA 3TJPA 4I43A 3MKQA 3PUJA 1OWNA 4B89A 1JUQA 4UQYA 4PS8A 2UWJG 3MGBA 2VTBA 4JA9A 5BV0A 1Z3XA 2GRLA 4GA2A 3QWWA 3FUNA 3G2WA 4CDNA 4FC8A 2FO7A 4AXHA 4HOTA 4LERA 1HFAA 2OVBA 3NZUA 2VGXB 1Y6IA 2IU1A 3ASGA 3RK6A 4FP7A 1GW6A 3KD7A 2HR2A 5ANRA 4QFVA 2XRZA 2WXQA 3D9MA 3S7BA 3PZDA 3FTXA 3I4GA 1EDUA 3FTZA 3OXGA 2VSXE 3MV3B 2YHCA 3RO3A 3BG1B 4WWOA 1ELKA 3S7JA 4HVBA 4HS2A 1EYHA 5AJDA 5AJLA 4ANUA 3APFA 4BY6A 2IQCA 3ZRHA 3LY7A 4ME2A 4JPSA 3SHFA 3FU6A 2Y3AA 4RG9A 2YNQA 4Q96A 5CCMA 5FQ6A 1SZAA 3CVUA 2YINA 2X6JA 2WQ7A 1TJCA 4J0UA 4ILGA 3TXMA 2WXRA 3URZA 4CGVA 4UWLA 3ZFWA 3ASHA 2HYZA 5KJLA 1HZ4A 5A7DB 2L9BA 2AVPA 3ZHEB 3ML8A 5AYWD 5CCLA 3LS8A 3Q47B 4GMJA 3SBSA 5BPPA 5EDSA 1E90A 1JPLA 1WM5A 4B0ZA 2C0LA 3O4ZA 2M63A 2NSZA 4BX8A 4ANWA 5A23A 5BT1A 2E2EA 5EKQD 5J08A 3ZXSA 3MYVA 4LCTA 4EZKA 4I1AA 5EX0A 3ZPJA 3NQPA 4U0ZA 2WB2A 3TG5A 4GB9A 2R5SA 2WXGA 3EHNA 3QWPA 4U04A 5BW8C 4CEMA 4KBQA 1E8ZA 4B8AA 4XI0A 4DJAA 5C2YA 3QKYA 4FHKA 4V3IA 3FUKA 2GW1A 2L6JA 3L13A 4I2ZA 3T5XA 4J8FA 3CHSA 3CQCB 4XE0A 3FU3A 3IEGA 3EJNA 4I6GA 4GZDA 4JHKA 4UI9J 3CHQA 2X6FA 3ZYLA 1UJKA 1Z3YA 3VTYA 2WMOA 5JJ6A 2KM4A 4W9RA 1XNFA 2IJGX 1H19A 1SQMA 4F53A 5KJMA 3CLJA 2HO1A 4TUUA 2XRYA 4GZCA 2V8SE 4GYYA 2WXLA 1H6KA 3G2UA 2X38A 2CHWA 2I6HA 3KEZA 4RVBA 3RKVA 5KJKA 4R7LA 3ESKA 5E76A 3P1UA 3ASDA 3FUDA 3FTVA 3U3WA 4YVQC 3D9NA 2J4BA 2Q7FA 3SNXA 4FADA 3T5VA 4UWHA 4G24A 1YA0A 5DIZA 3DBSA 3TAXA 3JQ0A 5LOZA 3JCKC 4ILHB 4AIFA 3CEQA 2LAHA 3CVNA 3ZHEA 4A1GA 5BNWA 3UT7A 3OTNA 4XX5A 4AV7A 4EZJA 3CHRA 4A3VA 4AM9A 1QZ2A 2PL2A 5FT9A 5G55A 4IYPA 4EQFA 4GCNA 1X5BA 3EIQC 5CMWA 3N71A 4OYSA 1ELWA 2MOWA 2WQHA 2IOLA 2OOEA 3UT4A 4J8DA 5JHAA 2LAIA 4JHJA 4APOA 2VYIA 3UX4A 3HVEB 4GPKA 4LUNU 2PQNA 2FF4A 4GAAA 2V5FA 1NA3A 1P5QA 2R17C 1KLXA 2ZU6B 3PDNA 2V0PA 2AWIA 3B7TA 5J90A 3MV2B 3LEWA 3ZEFA 4KMOA 1UN9A 1MQSA 4G23A 4EBAG 4E85A 3CQGB 2X6HA 3ZVVA 3QJZA 4FULA 1H2TC 4G1TA 4BX9A 1Z6TA 5FJYA 2KCLA 3RRNB 2DIWA 2LO6A 4MLPA 2JLBA 3MA5A 3FUMA 4Y6WA 4DLQA 4FHJA 4N5CA 5FZRA 4MS6A 3KS2A 3LCAA 1HG5A 3MZLB 2IFUA 2L0IA 4DI4A 1OWLA 3D9OA 5HQ8A 3D9PA 2L0TB 1DVPA 2E0IA 2QFCA 2YHEA 4AOFA 1HX8A 4C0MA 3L22A 4IN3B 3B7SA 3CV0A 4L7TA 4JZYA 5FQ8A 3D9KA 3R7QA 4U63A 2UY1A 3G2TA 3L16A 4NRHB 3I5PA 5T3RA 3UT8A 4U8HA 3APCA 4FLBA 2JEKA 3FUJA 4PS3A 3LY9A 4HLEA 3AS5A 4HORA 4ACLA 4URKA 1FVFA 1PAQA 4EECA 2J49A 1E8XA 4YVOA 2J07A 3TL5A 4PH4B 1IYGA 4CDRA 1FCHA 1H2VC 3AU4A 3MEKA 3HIZA 3LVRE 3LDZA 3HHMA 2WXPA 1IHGA 4MRUA 4JVSA 4L1BA 3CGHA 3QB2A 3LVQE 2IF4A 4N39A 3C98A 1PY1A 4JA7A 4N3BA 2CFUA 3IKOB 3APDA 3CVPA 1E8WA 1E7UA 3G2SA 3LPZA 3NF1A 4AY5A 4TRQA 4XKCA 2AXVA 5CHEE 3RU0A 4GYOA 4G2VA 1KT1A 2XGSA 5G05J 3ZGQA 4L2YA 1ELRA 1WAO1 3FDHA 3GZ2A 3SZ7A 4DI3A 4KT6B 3GYZA 4I2WA 2XGOA 5ARFA 1UJJA 4XKBA 5G04J 4FU3A 4NACA 4RG6A 4AP2A 3CKBA 4F7AA 4J6IA 4E6HA 1N52A 3D3MA 2KZTA 3PUKA 2LSVA 2X6KA 3SFZA 4UWKA 3EHMA 4EPZA 2J4DA 2BF0X 4GZ5A 4MKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3B A;  3FP3 A;  2FBN A;  3N71 A;  3Q49 B;  1ELW A;  2WQH A;  2OOE A;  3CK7 A;  4J8D A;  1HXI A;  2C0M A;  4HOQ A;  5M72 A;  4APO A;  2VYI A;  3MKR A;  4GPK A;  3Q15 A;  3QDN A;  4UQY A;  2PQN A;  3S7F A;  1PC2 A;  2FF4 A;  3E4B A;  2UWJ G;  4YND A;  5D0O D;  2V5F A;  4U07 A;  1NA3 A;  1P5Q A;  4JL0 A;  1KLX A;  3EDT B;  3PDN A;  3UPV A;  4JA9 A;  3RO2 A;  2YQ8 A;  4GA2 A;  3QWW A;  3MV2 B;  2LNI A;  4H7Y A;  4NQ0 A;  2VGY A;  2FO7 A;  3CVL A;  4BTA A;  4HOT A;  4G23 A;  3FWV A;  2VGX B;  3ASG A;  4I9E A;  3VTX A;  1Y8M A;  3KD7 A;  2HR2 A;  4G1T A;  4AY6 A;  3S7B A;  5FJY A;  2KCL A;  2VGX A;  2JLB A;  3LYA A;  2P58 C;  2J9Q A;  3MA5 A;  3OXG A;  1OUV A;  4Y6W A;  3MV3 B;  2WPV A;  2YHC A;  3CK8 A;  3KS2 A;  3LCA A;  4N5C A;  5FZR A;  3RO3 A;  2NC9 A;  3S7J A;  5C1D A;  2IFU A;  4A1S A;  1B89 A;  5HQ8 A;  4N2S A;  3LY7 A;  3PE3 A;  4ME2 A;  2QFC A;  4BT9 A;  1HH8 A;  1NZN A;  3AS4 A;  3HYM B;  4RG9 A;  1E96 B;  4LEU A;  5CCM A;  5LCW C;  5G04 C;  2KCV A;  3OXL A;  4IN3 B;  3TG4 A;  4G25 A;  2FI7 A;  1TJC A;  2VSY A;  3CV0 A;  4J0U A;  3TGO A;  3QWV A;  1QQE A;  2UY1 A;  4NRH B;  4GYW A;  2XCC A;  2C2L A;  2PZI A;  4GA0 A;  4G26 A;  2XGM A;  4WNG A;  3URZ A;  4EQF A;  4F3V A;  4CGV A;  3ZFW A;  3ASH A;  3LY9 A;  3AS5 A;  4HOR A;  2HYZ A;  5KJL A;  1HZ4 A;  3ASF A;  4N3A A;  3Q5M A;  5A7D B;  2AVP A;  3KAE A;  3ZHE B;  5AYW D;  5CCL A;  4O6F A;  3Q47 B;  5FTP A;  2UY1 B;  4JHR A;  4KXK B;  1WM5 A;  4GZ6 A;  2C0L A;  4YVO A;  3U4T A;  5BT1 A;  1KT0 A;  2E2E A;  3QOU A;  5EKQ D;  4I1A A;  4KYO B;  5EX0 A;  3ZPJ A;  4U0Z A;  4CDR A;  1IYG A;  5G05 C;  1FCH A;  3TG5 A;  3ZGQ A;  3MEK A;  2R5S A;  3QWP A;  4U04 A;  5BW8 C;  5LCW J;  4J8E A;  4KBQ A;  4UQZ A;  3LKU A;  4Y6C A;  4BWR A;  1IHG A;  2KC7 A;  5JJ7 A;  4XI0 A;  3CK9 A;  3QKY A;  2IF4 A;  4P29 A;  4N39 A;  2PQR A;  4H7X A;  3PE4 A;  2GW1 A;  2L6J A;  4I2Z A;  4HOS A;  2Y4U A;  4JA7 A;  4N3B A;  4J8F A;  3SF4 A;  2MHK A;  1ZBP A;  2VQ2 A;  3BEE A;  3CVP A;  3IEG A;  5FZS A;  3WXX A;  3RIB A;  5EX3 A;  4U0S A;  4UI9 J;  4WNF A;  2XPI A;  3LPZ A;  3NF1 A;  4WUY A;  3S7D A;  2VSN A;  3VTY A;  2XEV A;  5JJ6 A;  4I9C A;  3RJV A;  3ULQ A;  4W9R A;  1XNF A;  1A17 A;  4ABN A;  4AY5 A;  3GW4 A;  3ZN3 A;  4UI9 C;  5CHE E;  4CGW A;  4B94 A;  5KJM A;  2HO1 A;  3LY8 A;  2BUG A;  3K9I A;  4XIF A;  3RU0 A;  4BTB A;  4GYY A;  4GYO A;  3R9A B;  2Y4T A;  4G2V A;  3O48 A;  5ARG A;  1KT1 A;  2I6H A;  2XGS A;  5G05 J;  3RKV A;  1ZU2 A;  1ELR A;  1WAO 1;  2FEZ A;  4HOU A;  4I17 A;  2KAT A;  3CKC A;  3ESK A;  4U0U A;  2DBA A;  3ASD A;  5A6C A;  5KJK A;  3GZ2 A;  3SZ7 A;  5KJN A;  3U3W A;  4GCO A;  3CVQ A;  1NA0 A;  2Q7F A;  4YVQ C;  5JJT A;  3AS8 A;  3UQ3 A;  3GYZ A;  4N3C A;  4I2W A;  5D0Q D;  2XGO A;  4G24 A;  5ARF A;  1YA0 A;  2KCK A;  5DIZ A;  3OXF A;  5G04 J;  4RG6 A;  5FZQ A;  3CKB A;  3TAX A;  4UI9 K;  2XCB A;  4UQX A;  4AIF A;  3CEQ A;  4WND A;  2OND A;  4WNE A;  3CVN A;  3FFL A;  3ZHE A;  2LSV A;  5BNW A;  2LSU A;  4GA1 A;  5HI7 A;  4AM9 A;  4BT8 A;  4N2Q A;  5DBK A;  1QZ2 A;  2PL2 A;  5FT9 A;  3JYS A;  4GZ3 A;  4GZ5 A;  3GZ1 A;  3Q4A B;  4XI9 A;  3UUX A;  4GCN A; 
#chains in the Genus database with same CATH topology
 2C0M A;  1VDY A;  3DSX A;  4IUL A;  2IO2 C;  2GGF A;  2LXL A;  3MX3 A;  2LNI A;  1U3C A;  1NFI E;  4M7C A;  4CRW A;  3UKR G;  3NZS A;  2VGX A;  3PRZ A;  1INZ A;  4C0E A;  3DWL G;  3ABL E;  3FH7 A;  5C1D A;  4JEH A;  4U7E B;  5FWQ A;  2VSY A;  3UIN C;  2XCC A;  2CHZ A;  4GA0 A;  4JXT A;  2GRP B;  3U9W A;  1SW6 A;  2PM7 A;  4NIK A;  3ABM E;  3ZYM A;  1KT0 A;  2V5Q C;  3IBE A;  3SD5 A;  4OVV A;  3DRA A;  1H2U A;  2WMN A;  4CT4 A;  2EIM E;  5JJ7 A;  4WWN A;  3ULY A;  4XZ4 A;  3WXX A;  3ZYK A;  1N0R A;  4ABN A;  3FTY A;  3PNT B;  2GRQ B;  4UI9 C;  4LNG A;  1TNB A;  3I3N A;  3FUI A;  4DUI A;  1DCQ A;  2DBA A;  2VTB B;  1YCS B;  3CVQ A;  1UW4 B;  2DYS E;  3IHY A;  2KZT B;  4Q94 A;  3AG2 E;  1OCC E;  1HG2 A;  2FBN A;  3Q49 B;  5D66 A;  3HXC A;  5JMN D;  5ENP D;  1HF8 A;  1UG3 A;  3RAU A;  3D9J A;  3E32 A;  3JXJ A;  1FVH A;  3MCX A;  4K0R A;  3R9A B;  1JCQ A;  3IHV A;  4DX7 D;  4RLY A;  1NP7 A;  4ILI A;  1NZN A;  2KCV A;  3OXL A;  4I6E A;  4G25 A;  3IV0 A;  2WXH A;  4F3V A;  2WXF A;  2H6I A;  5HKP A;  4LRZ A;  4JD2 G;  3U4T A;  2IY0 C;  5AQA A;  3ASN E;  5FIO A;  4AVX A;  4KZ0 A;  4BWR A;  2ZXW E;  3CK9 A;  1DNP A;  2B6C A;  5KBA A;  2CG3 A;  1SZ9 A;  2BTD A;  3K9I A;  1WG0 A;  1HU3 A;  4YDY A;  3O48 A;  3B7U X;  5KJN A;  4GCO A;  3NOC D;  1BU9 A;  4WNE A;  4FJZ A;  4N5Q A;  3Q4A B;  1KZP A;  2P9P G;  3JXI A;  3FY4 A;  2QC9 A;  2XZD G;  4UQY A;  4PS8 A;  2UWJ G;  2VTB A;  1Z3X A;  3FUN A;  4FC8 A;  4AXH A;  1TYQ G;  3NZU A;  2VGX B;  3T8K A;  3KD7 A;  2HR2 A;  2WXQ A;  2QYJ A;  2Y69 E;  1MJ0 A;  1EDU A;  3OXG A;  2VSX E;  3MV3 B;  1ELK A;  5AJD A;  4RG9 A;  2YNQ A;  4Q96 A;  1SZA A;  1S70 B;  2WQ7 A;  3TXM A;  4BET A;  3SFX A;  3ML8 A;  1JPL A;  3O4Z A;  2NSZ A;  5J08 A;  2WB2 A;  4HI9 A;  1V54 E;  3TG5 A;  5CBO A;  1H6O A;  3Q9N C;  3QWP A;  1E8Z A;  3L13 A;  1AP7 A;  3CHS A;  3FU3 A;  4JHK A;  1KZO A;  3VTY A;  2WMO A;  2KM4 A;  4W9R A;  3D9H A;  4ZFH A;  3CLJ A;  1K1B A;  3KEA A;  1D8D A;  3KEZ A;  3RKV A;  5KJK A;  4R7L A;  3ESK A;  3P1U A;  3FTV A;  4YVQ C;  2J4B A;  3ABK E;  4UWH A;  1YA0 A;  3JQ0 A;  3UT7 A;  3CHR A;  1OCR E;  5G55 A;  4GTO A;  4GCN A;  2IOL A;  3Q78 A;  2DZO A;  4J8D A;  2LAI A;  4JHJ A;  5AN8 A;  1P5Q A;  2R17 C;  2ZU6 B;  1N95 A;  4KMO A;  5H7P A;  4G23 A;  4EBA G;  4TXR A;  4BX9 A;  5FJY A;  5AQ9 A;  4MLP A;  3KS2 A;  1HG5 A;  4DI4 A;  5HQ8 A;  2L0T B;  1DVP A;  2E0I A;  4IN3 B;  3B7S A;  3CV0 A;  4U63 A;  2UY1 A;  4HLE A;  4HOR A;  3LY9 A;  4YDW A;  4X8Q A;  4URK A;  1PAQ A;  3TL5 A;  3MEK A;  1TN7 A;  3HHM A;  2DWZ A;  2WXP A;  4MRU A;  2H6G A;  4GTV A;  2RFM A;  1E8W A;  1E7U A;  3LPZ A;  4XKC A;  5CHE E;  1N11 A;  4G2V A;  2V4H C;  1KT1 A;  1D8E A;  4L2Y A;  5AAO A;  2Y1L E;  3EU9 A;  4KT6 B;  4I2W A;  2XGO A;  5G04 J;  4FU3 A;  4RG6 A;  4F7A A;  1MX4 A;  4J6I A;  4E6H A;  1N52 A;  2KZT A;  2LSV A;  2X6K A;  2J8S D;  4UWK A;  1N4Q A;  4EPZ A;  2J4D A;  1TJF A;  3MKR A;  5AQ7 A;  3EU5 A;  3PEU B;  4M3O A;  3TWQ A;  2VGY A;  3CVL A;  1TR4 A;  3SFY A;  1EPU A;  2ZIR A;  5EYP F;  4AY6 A;  5BUZ A;  3UMV A;  2J9Q A;  3DSS A;  4L2L A;  3TG4 A;  4DLO A;  3CK8 A;  4A1S A;  3U66 A;  3P2B A;  2ETC A;  2HM8 A;  4LEU A;  5LCW C;  2P9L G;  3UM3 A;  2FI7 A;  3ZYQ A;  4FJY A;  3HXD A;  4ANV A;  2QYU A;  4N3A A;  3Q5M A;  3KAE A;  4O6F A;  2UY1 B;  2ETB A;  2XQ0 A;  3SGH A;  4BSZ B;  2CFZ A;  2XPY A;  3E30 A;  4A3T A;  1WY6 A;  4DPR A;  2F0Y A;  2PQR A;  1JWG A;  2EQX A;  1DCE A;  2R2L A;  5CRV A;  3S2A A;  3BEE A;  4CCA A;  4DRX E;  3S7D A;  4IRU A;  4I9C A;  2H6H A;  4TV3 A;  4BSX A;  2EIN E;  3UIO C;  1G3N B;  3CHO A;  5FIN A;  3T8M A;  4ATG A;  3EIJ A;  3I4R B;  3MKQ B;  4WND A;  4GZ3 A;  3GZ1 A;  3LJN A;  1HE8 A;  1HXI A;  1JCR A;  3CHP A;  1NL4 A;  3FU0 A;  4EBA A;  4Z68 A;  4BFR A;  1KPS B;  4H7Y A;  3PH0 C;  3SO8 A;  2L6B A;  4KVM A;  3ASO E;  1LD7 A;  2WPV A;  2NC9 A;  4GTM A;  3RRU A;  3CHM A;  3FUF A;  1HH8 A;  3ENE A;  4CT0 A;  5G04 C;  3L9T A;  4OAV B;  3TGO A;  3C5R A;  4G26 A;  1OY3 D;  4G11 A;  1MHQ A;  3CSF A;  3ZUV B;  5CEC B;  3FUL A;  3HDX A;  2IO3 C;  3BU8 A;  1O1S A;  3CVY A;  3LXU X;  4L23 A;  3TXN A;  2IOS A;  1A5E A;  3LJ3 A;  3Q9U C;  2F8X K;  4HXI A;  3DSU A;  5ENN A;  4YDO A;  2HE0 A;  4HRM B;  2GRM A;  5EYL A;  3SF4 A;  1E7V A;  3RIB A;  4WUY A;  2VSN A;  2XEV A;  3ULQ A;  2XS8 A;  1N9A A;  3LY8 A;  3B7R L;  1BLX B;  4KVO A;  3BUA A;  3CVV A;  2LUH A;  2ILR A;  1ZU2 A;  2H6F A;  4U0U A;  2WXJ A;  1L5J A;  3TWS A;  3FTW A;  3HXF A;  3ONK A;  4XEI G;  3B13 A;  3FFL A;  2WXM A;  2LSU A;  4GA1 A;  4U8Y D;  2PM6 A;  3PNL B;  5ANL A;  5B1A E;  5LP0 A;  5FQ4 A;  4I6J A;  3TJP A;  4I43 A;  3PUJ A;  1OWN A;  1QBQ A;  1O1T A;  1TNU A;  5BV0 A;  3Q75 A;  3QWW A;  3V30 A;  3TWR A;  4U8V D;  4HOT A;  3RK6 A;  1Y6I A;  2XRZ A;  2OCC E;  2P9S G;  4WWO A;  5AJL A;  4BY6 A;  3LY7 A;  3L82 A;  3FU6 A;  1MYO A;  2YIN A;  1TJC A;  4ILG A;  2XEE A;  1UOH A;  1MZC A;  2WXR A;  3EUV A;  3URZ A;  4CGV A;  1IKN D;  4UWL A;  2HYZ A;  1FPP A;  2L9B A;  5EDS A;  5AYW D;  1O5M A;  3LS8 A;  3Q47 B;  1WM5 A;  5A23 A;  2M63 A;  5KNH D;  3ZXS A;  4EZK A;  3Q7A A;  5EX0 A;  3ZPJ A;  4U0Z A;  3EHN A;  4CEM A;  3NBN B;  4XI0 A;  5C2Y A;  3RSE G;  3FUK A;  2GW1 A;  2L6J A;  4I2Z A;  3T5X A;  3IEG A;  1UJK A;  1Z3Y A;  1XNF A;  2IJG X;  4GTQ A;  1SQM A;  5KJM A;  3DSW A;  2HO1 A;  3C3R A;  1SA4 A;  4GZC A;  4GYY A;  2WXL A;  4K5B A;  3ZXP A;  2CHW A;  2I6H A;  5E76 A;  3U3W A;  3TAX A;  5LOZ A;  4ILH B;  4HRN A;  4DX1 A;  2LAH A;  3ZHE A;  5BNW A;  2PL2 A;  5ENR D;  5CMW A;  1ELW A;  4O1O A;  3Q7F A;  2VYI A;  4LUN U;  2FF4 A;  1S64 A;  2V5F A;  5EIL A;  1N4P A;  2GRO B;  1MQS A;  3CQG B;  4C48 B;  2P9K G;  1Z6T A;  3RRN B;  2KCL A;  2LXM A;  3MA5 A;  1DC2 A;  3FUM A;  3UM2 A;  3D9P A;  1HX8 A;  4L7T A;  3D9K A;  3R7Q A;  3L16 A;  4NRH B;  3UT8 A;  4U8H A;  5KWD A;  2JEK A;  3AS5 A;  2OEW A;  3PZ1 A;  1N0Q A;  4UUC A;  4YVO A;  2PNN A;  3ISM C;  2GRR B;  4PH4 B;  1H2V C;  3ULE G;  2JAB A;  1IHG A;  4L1B A;  4JVS A;  5CEA A;  3QB2 A;  3LVQ E;  2IF4 A;  3C98 A;  4JA7 A;  2CFU A;  5HS0 A;  1RW2 A;  4TXP A;  3SY2 A;  3NF1 A;  4AY5 A;  4BES A;  2AXV A;  3RU0 A;  3PZ3 A;  3AG4 E;  2XGS A;  5G05 J;  2A5E A;  3FDH A;  3SZ7 A;  1MX2 A;  4K5C A;  4BER A;  5CER B;  3AAA C;  4NAC A;  3UM1 A;  4BEP A;  5IY5 E;  2EIK E;  3D3M A;  5KNG A;  1W3B A;  3V79 K;  1WDY A;  2VJ8 A;  3CK7 A;  4CDM A;  4OAU C;  4HOQ A;  4AEZ C;  5KCM A;  4J8Y A;  3QDN A;  1PC2 A;  1BPO A;  1HO8 A;  3RO2 A;  4HBD A;  2WXK A;  4WWP A;  3ZIM A;  3FTU A;  4NQ0 A;  1E8Y A;  5LFA A;  3EHQ A;  4DK5 A;  5AEN A;  3AJI A;  3CVW A;  1XGW A;  2I2O A;  2AW6 A;  1TEZ A;  3FH8 A;  3OAW A;  2XZT G;  3L6A A;  1H6P A;  3HYM B;  3AS4 A;  1E96 B;  3DXM G;  3FTS A;  2PZI A;  2XGM A;  4WNG A;  4DX2 A;  1QYM A;  4KXK B;  4GZ6 A;  3J5Q B;  3QOU A;  2KBX A;  4GML A;  2ZGG A;  4ANX A;  3D9I A;  4UQZ A;  2NXP A;  3V2O A;  2I1K A;  4P29 A;  2A5U A;  3VLF A;  3U64 A;  3NB2 A;  3V2X A;  1FT1 A;  4C9B B;  1ZBP A;  5EX3 A;  4U0S A;  4WNF A;  2XPI A;  2OVF A;  3ZN3 A;  4B94 A;  2BUG A;  2Y4T A;  5B3S E;  2F8Y A;  1S63 A;  1OWP A;  4HQD A;  4N2Q A;  1NA0 A;  2EIL E;  1OXJ A;  3OXF A;  4F1S A;  3FU5 A;  3L54 A;  4JW1 A;  3CST A;  1N54 A;  1IQR A;  3R7R A;  3T9K A;  3QNK A;  4B8C B;  4B93 B;  2ION A;  3FP3 A;  3TWW A;  1BI7 B;  4YDE A;  2DCP A;  1ZB1 A;  3ONL A;  3CR3 A;  5JHB A;  3VLD A;  1LF8 A;  5D0O D;  4JL0 A;  3UPV A;  4BTA A;  2ETA A;  2A4Z A;  3G2V A;  1O1R A;  4K03 A;  3ML9 A;  4Q69 A;  3QAR A;  3JUI A;  5ENS D;  1V55 E;  1HS6 A;  3E33 A;  1Z5S C;  3PE3 A;  4O1P A;  2F37 A;  2I1J A;  4J7W A;  2KXP C;  3QWV A;  2V4L A;  2OV8 A;  2AXU A;  1OCZ E;  4I1M A;  3PEV B;  2XEH A;  5E75 A;  3ASF A;  3PZ4 A;  5FTP A;  4UWG A;  2NYJ A;  3FUE A;  2XEN A;  2WQ6 A;  2J09 A;  3SBT B;  2WXN A;  3FUH A;  2WVI A;  4CZ2 D;  2DVW A;  1IQU A;  1X81 A;  2X6I A;  4H7X A;  2X3M A;  3C3O A;  4HOS A;  2VQ2 A;  3SQV A;  4ACK A;  4BT9 A;  5JJT A;  4GTS A;  4PS7 A;  2WXO A;  3QC1 A;  1BD8 A;  4I1O B;  3WG7 E;  2J08 A;  4JC8 A;  4PDX A;  1D9S A;  2FEZ A;  4I17 A;  3FEY A;  4HOU A;  3CKC A;  3ESL A;  1OWM A;  4N3C A;  3B95 A;  5D0Q D;  2KCK A;  1TN8 A;  5D2M C;  4NUR A;  1RZ4 A;  2OND A;  5G2N A;  5DBK A;  3UUX A;  4HB5 A;  3Q73 A;  5EN5 D;  4MBG A;  1JUQ A;  3MGB A;  2GRL A;  4GA2 A;  4U96 D;  2FO7 A;  4A63 B;  5ANR A;  4QFV A;  1N4R A;  2AJA A;  3PZD A;  3FTZ A;  3RO3 A;  3S7J A;  4F6R D;  2IQC A;  3ZRH A;  4ME2 A;  3SHF A;  1TNY A;  5FQ6 A;  2X6J A;  3ZU7 B;  4J0U A;  5B1B E;  3ZFW A;  3ASH A;  5KJL A;  5A7D B;  2AVP A;  4TXQ A;  5BPP A;  3SBS A;  4DX6 D;  1E90 A;  5BT1 A;  4I1A A;  3NQP A;  4GTP A;  4ZHB A;  4GB9 A;  2R5S A;  5BW8 C;  3DEP A;  4I6G A;  3V31 A;  3EJN A;  4GZD A;  3CHQ A;  2X6F A;  5JJ6 A;  5JA4 D;  4F1P A;  1SVX A;  1H19 A;  4F53 A;  1H6K A;  2X38 A;  1JCS A;  2RKK A;  2QZA A;  3ASD A;  3FUD A;  1TNZ A;  2Q7F A;  3UXG A;  5DIZ A;  3W9G A;  5ENO D;  3CVN A;  4A1G A;  5EID A;  4AM9 A;  1QZ2 A;  5FT9 A;  4IYP A;  1X5B A;  3N71 A;  4OYS A;  3UT4 A;  2OOE A;  5JHA A;  3HVE B;  2PQN A;  1NA3 A;  2AWI A;  3B7T A;  3MV2 B;  3ZEF A;  5BXU A;  4E85 A;  2X6H A;  3ZVV A;  1H2T C;  4G1T A;  2DIW A;  4HI8 A;  4DLQ A;  4FHJ A;  4MS6 A;  3MZL B;  4QQI A;  2BKG A;  1OWL A;  3D9O A;  4AOF A;  4C0M A;  4JZY A;  5FQ8 A;  4LSZ E;  3G2T A;  3I5P A;  1MX6 A;  3DST A;  3FUJ A;  4PS3 A;  1FVF A;  1NI1 A;  2J49 A;  2P9N G;  1IYG A;  3E37 A;  3HRA A;  2B0O E;  3LVR E;  3LDZ A;  3CGH A;  4N39 A;  4N3B A;  3CVP A;  3G2S A;  3TWX A;  3PZ2 A;  4TRQ A;  2BKK B;  3W9F A;  2EIJ E;  5AQB A;  1AWC B;  1ELR A;  2MYO A;  3J5P A;  3GYZ A;  5ARF A;  1UJJ A;  4U95 D;  3CKB A;  3PUK A;  3EHM A;  3EHR A;  4GZ5 A;  1H0A A;  4HFG A;  1OWO A;  3Q15 A;  2OEV A;  3S7F A;  3E4B A;  4N2S A;  4U07 A;  3AG1 E;  2R59 A;  4D10 C;  5HRY A;  4I9E A;  1OCO E;  1Y8M A;  1IXV A;  1Q2Z A;  1UN8 A;  3MJW A;  3FHE A;  4RSY A;  3QK0 A;  3LYA A;  1OUV A;  4EHM A;  4K5A B;  5CRU A;  4FA6 A;  1QNF A;  1S0P A;  1OT8 A;  3TWU A;  4PUC A;  3NOG D;  1N94 A;  5CMY A;  4FLH A;  4JHR A;  4A55 A;  2AXZ A;  1K8K G;  5T8I A;  3QAQ A;  4KYO B;  3DPD A;  5G05 C;  4L9P A;  5LCW J;  4J8E A;  2XPZ A;  5AIJ A;  2MRI A;  4KZC A;  3D9L A;  2MHK A;  1JWF A;  3VLE A;  4WAF A;  3RJV A;  1A17 A;  3GW4 A;  3TWV A;  4BTB A;  2R03 A;  3HVE A;  5ARG A;  5FQ7 A;  4EZL A;  3UTM A;  3AS8 A;  3UQ3 A;  4LNB A;  2XCB A;  3UIP C;  5HI7 A;  4BT8 A;  3C72 A;  2QY7 A;  3DXK G;  5M72 A;  2XHE A;  2CHX A;  4GU5 A;  3HG0 D;  4YND A;  3AU5 A;  1YYH A;  3EDT B;  1K3Z D;  2YQ8 A;  3BG0 B;  3RRM B;  3FWV A;  3VTX A;  4APF A;  3PS6 A;  4CYM D;  3L17 A;  4J8S A;  2ZIS A;  2P58 C;  1B89 A;  3IXE A;  1QQE A;  3PRE A;  4GYW A;  2C2L A;  4G8K A;  3SI5 A;  5EIB E;  2XS1 A;  2DYR E;  4AJW A;  2R05 A;  3CIA A;  2VSO E;  4RQI A;  2RG8 A;  3JQ1 A;  3GZS A;  1U3D A;  2WXI A;  5BV1 A;  3ZW3 A;  1LTX A;  3LKU A;  2DZN A;  4Y6C A;  2KC7 A;  4ATZ D;  3PVL A;  2RD0 A;  4JB8 P;  3PE4 A;  2Y4U A;  2WM9 A;  5FZS A;  4UWF A;  2ZGD A;  3FEX A;  2FUL A;  4CGW A;  5T4Y A;  4XIF A;  3L08 A;  1EF1 C;  3CVX A;  3R9M A;  3BQO A;  4OVU A;  2KAT A;  4JEU A;  5A6C A;  2CG2 A;  2I9C A;  5FZQ A;  5LX8 A;  2VGE A;  4UI9 K;  4UQX A;  4GTR A;  3JYS A;  4XI9 A;  3DSV A;  3FH5 A;  3MKQ A;  4B89 A;  4LG6 A;  4JA9 A;  3G2W A;  4CDN A;  4LER A;  1HFA A;  2OVB A;  3ASG A;  5BXO A;  2IU1 A;  4FP7 A;  1GW6 A;  3AG3 E;  3D9M A;  3S7B A;  3ZKJ A;  3FTX A;  3I4G A;  2YHC A;  5ENQ D;  4HVB A;  3BG1 B;  4DX5 D;  4HS2 A;  1EYH A;  4ANU A;  2RFA A;  3APF A;  2FO1 E;  4JPS A;  2Y3A A;  5CCM A;  3CVU A;  3E34 A;  4GMR A;  3JUE A;  5ITZ F;  1HZ4 A;  3ZHE B;  5CCL A;  4GMJ A;  5ENT D;  4B0Z A;  2C0L A;  4BX8 A;  3DEO A;  4ANW A;  2E2E A;  5EKQ D;  3MYV A;  4LCT A;  2GRN B;  2WXG A;  3X2Q E;  4U04 A;  4KBQ A;  2IEJ A;  4B8A A;  4DJA A;  3QKY A;  4FHK A;  4V3I A;  1YMP A;  3KSL A;  1N4S A;  4J8F A;  3CQC B;  4XE0 A;  4UI9 J;  3ZYL A;  4TUM A;  4TUU A;  2XRY A;  2V8S E;  3G2U A;  5AAR A;  1K1A A;  4RVB A;  1FT2 A;  4HNA D;  4GPM A;  3D9N A;  4FAD A;  3SNX A;  3T5V A;  4G24 A;  1IHB A;  1TN6 A;  3DBS A;  3JCK C;  4AIF A;  3CEQ A;  3DPY A;  4G8L A;  4O60 A;  3OTN A;  4XX5 A;  4AV7 A;  4EZJ A;  4A3V A;  4EQF A;  4HLL A;  3EIQ C;  2MOW A;  2WQH A;  4APO A;  2P9U G;  3UX4 A;  4GPK A;  4GAA A;  1KLX A;  3C3Q A;  3PDN A;  2V0P A;  5CED B;  5J90 A;  3LEW A;  2P9I G;  1UN9 A;  1SA5 A;  3UI2 A;  3HXE A;  3QJZ A;  4FUL A;  3ZNG A;  2LO6 A;  2JLB A;  4Y6W A;  3B7B A;  4N5C A;  5FZR A;  3LCA A;  2IFU A;  2L0I A;  2P2C P;  3HXB A;  2QFC A;  2YHE A;  3F6Q A;  3L22 A;  5T3R A;  3APC A;  4FLB A;  5CBN A;  1LD8 A;  4ACL A;  2Y0B G;  4EEC A;  1E8X A;  4GTT A;  2J07 A;  3Q79 A;  2R02 A;  4CDR A;  1FCH A;  3AU4 A;  3HIZ A;  4LNU D;  1BI8 B;  4HRL A;  1PY1 A;  3IKO B;  3APD A;  3TWT A;  1U2V G;  4GYO A;  1TNO A;  3ZGQ A;  1WAO 1;  4DI3 A;  3GZ2 A;  3NAW A;  3UM0 A;  4XKB A;  3KSQ A;  4AP2 A;  2BED A;  3UKU G;  3SFZ A;  2BF0 X;  4MKT A; 
#chains in the Genus database with same CATH homology
 1W3B A;  1H0A A;  4HFG A;  2VJ8 A;  3CK7 A;  4CDM A;  1TJF A;  1OWO A;  2C0M A;  4HOQ A;  1VDY A;  4AEZ C;  5KCM A;  3MKR A;  3Q15 A;  3QDN A;  3S7F A;  1PC2 A;  3E4B A;  4N2S A;  3PEU B;  4U07 A;  1BPO A;  2R59 A;  1HO8 A;  4IUL A;  3RO2 A;  4D10 C;  2GGF A;  3MX3 A;  4M3O A;  2WXK A;  4WWP A;  2LNI A;  3ZIM A;  3FTU A;  4NQ0 A;  1E8Y A;  1U3C A;  2VGY A;  3CVL A;  5LFA A;  4I9E A;  1Y8M A;  4CRW A;  1EPU A;  3NZS A;  4DK5 A;  1UN8 A;  3MJW A;  5AEN A;  4AY6 A;  5BUZ A;  3FHE A;  2VGX A;  3PRZ A;  4RSY A;  1INZ A;  3QK0 A;  3LYA A;  3UMV A;  2J9Q A;  4L2L A;  3TG4 A;  3CVW A;  1OUV A;  4C0E A;  4DLO A;  3CK8 A;  1XGW A;  2I2O A;  2AW6 A;  3FH7 A;  5C1D A;  1TEZ A;  4A1S A;  3U66 A;  3FH8 A;  3OAW A;  3L6A A;  3P2B A;  4JEH A;  4FA6 A;  3HYM B;  3AS4 A;  1QNF A;  1E96 B;  2HM8 A;  4LEU A;  5LCW C;  1S0P A;  5FWQ A;  2FI7 A;  2VSY A;  3ZYQ A;  3FTS A;  4PUC A;  4FJY A;  2XCC A;  2CHZ A;  2PZI A;  4GA0 A;  2XGM A;  4JXT A;  4WNG A;  5CMY A;  3U9W A;  4ANV A;  4FLH A;  4N3A A;  3Q5M A;  3KAE A;  4O6F A;  2PM7 A;  2UY1 B;  4JHR A;  4KXK B;  4A55 A;  4GZ6 A;  2AXZ A;  3ZYM A;  2XQ0 A;  5T8I A;  1KT0 A;  3QOU A;  3IBE A;  3QAQ A;  3SD5 A;  4OVV A;  4KYO B;  3SGH A;  3DPD A;  5G05 C;  4GML A;  1H2U A;  5LCW J;  4ANX A;  2WMN A;  2CFZ A;  3D9I A;  2XPY A;  4J8E A;  4UQZ A;  2NXP A;  4CT4 A;  2XPZ A;  4A3T A;  5AIJ A;  2MRI A;  5JJ7 A;  1WY6 A;  4DPR A;  2I1K A;  4P29 A;  2PQR A;  2A5U A;  3VLF A;  3U64 A;  1JWG A;  4KZC A;  2EQX A;  4WWN A;  3D9L A;  3S2A A;  2MHK A;  1ZBP A;  3BEE A;  1JWF A;  4C9B B;  4XZ4 A;  3VLE A;  4CCA A;  3WXX A;  5EX3 A;  4U0S A;  4WNF A;  2XPI A;  3S7D A;  3ZYK A;  4IRU A;  2OVF A;  4WAF A;  4ABN A;  4I9C A;  3RJV A;  1A17 A;  3FTY A;  3PNT B;  4TV3 A;  3GW4 A;  3ZN3 A;  4UI9 C;  4B94 A;  2BUG A;  4BSX A;  3I3N A;  4BTB A;  2Y4T A;  3HVE A;  5ARG A;  5FQ7 A;  4EZL A;  3FUI A;  3CHO A;  1OWP A;  2DBA A;  2VTB B;  4N2Q A;  3CVQ A;  1NA0 A;  1UW4 B;  3AS8 A;  3T8M A;  3UQ3 A;  4ATG A;  3EIJ A;  3OXF A;  4F1S A;  3IHY A;  3FU5 A;  3L54 A;  4JW1 A;  2KZT B;  2XCB A;  1N54 A;  3CST A;  3I4R B;  3MKQ B;  4WND A;  1IQR A;  5HI7 A;  4Q94 A;  3R7R A;  4BT8 A;  3QNK A;  4B8C B;  4GZ3 A;  3GZ1 A;  2QY7 A;  1HG2 A;  2ION A;  3FP3 A;  2FBN A;  1HE8 A;  3Q49 B;  2DCP A;  1HXI A;  5M72 A;  2XHE A;  3ONL A;  3CR3 A;  3VLD A;  3CHP A;  5JHB A;  2CHX A;  1LF8 A;  3FU0 A;  4GU5 A;  4YND A;  3AU5 A;  5D0O D;  4EBA A;  4JL0 A;  4BFR A;  3EDT B;  3UPV A;  2YQ8 A;  4H7Y A;  3BG0 B;  3RRM B;  3PH0 C;  1HF8 A;  1UG3 A;  4BTA A;  3D9J A;  3FWV A;  3VTX A;  2A4Z A;  3G2V A;  4KVM A;  3PS6 A;  4APF A;  4K03 A;  1FVH A;  3ML9 A;  4Q69 A;  3QAR A;  3MCX A;  4K0R A;  3JUI A;  3L17 A;  4J8S A;  2P58 C;  3R9A B;  2WPV A;  3IHV A;  2NC9 A;  1HS6 A;  3RRU A;  1B89 A;  1NP7 A;  3PE3 A;  4ILI A;  3CHM A;  3FUF A;  1HH8 A;  1NZN A;  3ENE A;  4CT0 A;  5G04 C;  2KCV A;  3OXL A;  4I6E A;  4G25 A;  2I1J A;  3IV0 A;  2WXH A;  3TGO A;  3QWV A;  1QQE A;  3PRE A;  2V4L A;  2OV8 A;  2AXU A;  4GYW A;  4F3V A;  2C2L A;  4I1M A;  4G26 A;  2WXF A;  3PEV B;  4G11 A;  3SI5 A;  5E75 A;  1MHQ A;  3ASF A;  3CSF A;  3FUL A;  3HDX A;  4LRZ A;  5FTP A;  4UWG A;  3LXU X;  4AJW A;  3U4T A;  3CVY A;  3CIA A;  2VSO E;  4L23 A;  3FUE A;  3TXN A;  2WQ6 A;  2J09 A;  3SBT B;  2IOS A;  2WXN A;  2RG8 A;  3FUH A;  3JQ1 A;  3GZS A;  2WVI A;  1U3D A;  2WXI A;  3LJ3 A;  5BV1 A;  3ZW3 A;  4HXI A;  4AVX A;  3LKU A;  4Y6C A;  4KZ0 A;  4BWR A;  2KC7 A;  5ENN A;  1IQU A;  2X6I A;  3CK9 A;  3PVL A;  2RD0 A;  4H7X A;  3PE4 A;  1DNP A;  2X3M A;  4HOS A;  2Y4U A;  2GRM A;  2WM9 A;  3SF4 A;  2VQ2 A;  1E7V A;  5FZS A;  4ACK A;  3RIB A;  2CG3 A;  4WUY A;  4BT9 A;  5JJT A;  2VSN A;  2XEV A;  4UWF A;  3ULQ A;  3FEX A;  1SZ9 A;  2FUL A;  4PS7 A;  2BTD A;  5T4Y A;  4CGW A;  3LY8 A;  2WXO A;  3K9I A;  4XIF A;  3L08 A;  3B7R L;  1EF1 C;  3QC1 A;  4I1O B;  4KVO A;  3CVX A;  3CVV A;  2J08 A;  1HU3 A;  4JC8 A;  3O48 A;  4PDX A;  3B7U X;  4OVU A;  2ILR A;  1ZU2 A;  2FEZ A;  4I17 A;  3FEY A;  4HOU A;  2KAT A;  3CKC A;  4JEU A;  4U0U A;  5A6C A;  2WXJ A;  1L5J A;  5KJN A;  3ESL A;  4GCO A;  1OWM A;  2CG2 A;  4N3C A;  3FTW A;  5D0Q D;  2KCK A;  2I9C A;  5FZQ A;  4NUR A;  5LX8 A;  4UI9 K;  3ONK A;  4UQX A;  3B13 A;  4WNE A;  2OND A;  4FJZ A;  3FFL A;  5G2N A;  2WXM A;  2LSU A;  4GA1 A;  2PM6 A;  5DBK A;  3JYS A;  3PNL B;  4XI9 A;  5ANL A;  3Q4A B;  5LP0 A;  3UUX A;  5FQ4 A;  3FH5 A;  3FY4 A;  4I6J A;  3TJP A;  4I43 A;  3MKQ A;  3PUJ A;  1OWN A;  4B89 A;  1JUQ A;  4UQY A;  4PS8 A;  2UWJ G;  3MGB A;  2VTB A;  4JA9 A;  5BV0 A;  1Z3X A;  2GRL A;  4GA2 A;  3QWW A;  3FUN A;  3G2W A;  4CDN A;  4FC8 A;  2FO7 A;  4AXH A;  4HOT A;  4LER A;  1HFA A;  2OVB A;  3NZU A;  2VGX B;  1Y6I A;  2IU1 A;  3ASG A;  3RK6 A;  4FP7 A;  1GW6 A;  3KD7 A;  2HR2 A;  5ANR A;  4QFV A;  2XRZ A;  2WXQ A;  3D9M A;  3S7B A;  3PZD A;  3FTX A;  3I4G A;  1EDU A;  3FTZ A;  3OXG A;  2VSX E;  3MV3 B;  2YHC A;  3RO3 A;  3BG1 B;  4WWO A;  1ELK A;  3S7J A;  4HVB A;  4HS2 A;  1EYH A;  5AJD A;  5AJL A;  4ANU A;  3APF A;  4BY6 A;  2IQC A;  3ZRH A;  3LY7 A;  4ME2 A;  4JPS A;  3SHF A;  3FU6 A;  2Y3A A;  4RG9 A;  2YNQ A;  4Q96 A;  5CCM A;  5FQ6 A;  1SZA A;  3CVU A;  2YIN A;  2X6J A;  2WQ7 A;  1TJC A;  4J0U A;  4ILG A;  3TXM A;  2WXR A;  3URZ A;  4CGV A;  4UWL A;  3ZFW A;  3ASH A;  2HYZ A;  5KJL A;  1HZ4 A;  5A7D B;  2L9B A;  2AVP A;  3ZHE B;  3ML8 A;  5AYW D;  5CCL A;  3LS8 A;  3Q47 B;  4GMJ A;  3SBS A;  5BPP A;  5EDS A;  1E90 A;  1JPL A;  1WM5 A;  4B0Z A;  2C0L A;  3O4Z A;  2M63 A;  2NSZ A;  4BX8 A;  4ANW A;  5A23 A;  5BT1 A;  2E2E A;  5EKQ D;  5J08 A;  3ZXS A;  3MYV A;  4LCT A;  4EZK A;  4I1A A;  5EX0 A;  3ZPJ A;  3NQP A;  4U0Z A;  2WB2 A;  3TG5 A;  4GB9 A;  2R5S A;  2WXG A;  3EHN A;  3QWP A;  4U04 A;  5BW8 C;  4CEM A;  4KBQ A;  1E8Z A;  4B8A A;  4XI0 A;  4DJA A;  5C2Y A;  3QKY A;  4FHK A;  4V3I A;  3FUK A;  2GW1 A;  2L6J A;  3L13 A;  4I2Z A;  3T5X A;  4J8F A;  3CHS A;  3CQC B;  4XE0 A;  3FU3 A;  3IEG A;  3EJN A;  4I6G A;  4GZD A;  4JHK A;  4UI9 J;  3CHQ A;  2X6F A;  3ZYL A;  1UJK A;  1Z3Y A;  3VTY A;  2WMO A;  5JJ6 A;  2KM4 A;  4W9R A;  1XNF A;  2IJG X;  1H19 A;  1SQM A;  4F53 A;  5KJM A;  3CLJ A;  2HO1 A;  4TUU A;  2XRY A;  4GZC A;  2V8S E;  4GYY A;  2WXL A;  1H6K A;  3G2U A;  2X38 A;  2CHW A;  2I6H A;  3KEZ A;  4RVB A;  3RKV A;  5KJK A;  4R7L A;  3ESK A;  5E76 A;  3P1U A;  3ASD A;  3FUD A;  3FTV A;  3U3W A;  4YVQ C;  3D9N A;  2J4B A;  2Q7F A;  3SNX A;  4FAD A;  3T5V A;  4UWH A;  4G24 A;  1YA0 A;  5DIZ A;  3DBS A;  3TAX A;  3JQ0 A;  5LOZ A;  3JCK C;  4ILH B;  4AIF A;  3CEQ A;  2LAH A;  3CVN A;  3ZHE A;  4A1G A;  5BNW A;  3UT7 A;  3OTN A;  4XX5 A;  4AV7 A;  4EZJ A;  3CHR A;  4A3V A;  4AM9 A;  1QZ2 A;  2PL2 A;  5FT9 A;  5G55 A;  4IYP A;  4EQF A;  4GCN A;  1X5B A;  3EIQ C;  5CMW A;  3N71 A;  4OYS A;  1ELW A;  2MOW A;  2WQH A;  2IOL A;  2OOE A;  3UT4 A;  4J8D A;  5JHA A;  2LAI A;  4JHJ A;  4APO A;  2VYI A;  3UX4 A;  3HVE B;  4GPK A;  4LUN U;  2PQN A;  2FF4 A;  4GAA A;  2V5F A;  1NA3 A;  1P5Q A;  2R17 C;  1KLX A;  2ZU6 B;  3PDN A;  2V0P A;  2AWI A;  3B7T A;  5J90 A;  3MV2 B;  3LEW A;  3ZEF A;  4KMO A;  1UN9 A;  1MQS A;  4G23 A;  4EBA G;  4E85 A;  3CQG B;  2X6H A;  3ZVV A;  3QJZ A;  4FUL A;  1H2T C;  4G1T A;  4BX9 A;  1Z6T A;  5FJY A;  2KCL A;  3RRN B;  2DIW A;  2LO6 A;  4MLP A;  2JLB A;  3MA5 A;  3FUM A;  4Y6W A;  4DLQ A;  4FHJ A;  4N5C A;  5FZR A;  4MS6 A;  3KS2 A;  3LCA A;  1HG5 A;  3MZL B;  2IFU A;  2L0I A;  4DI4 A;  1OWL A;  3D9O A;  5HQ8 A;  3D9P A;  2L0T B;  1DVP A;  2E0I A;  2QFC A;  2YHE A;  4AOF A;  1HX8 A;  4C0M A;  3L22 A;  4IN3 B;  3B7S A;  3CV0 A;  4L7T A;  4JZY A;  5FQ8 A;  3D9K A;  3R7Q A;  4U63 A;  2UY1 A;  3G2T A;  3L16 A;  4NRH B;  3I5P A;  5T3R A;  3UT8 A;  4U8H A;  3APC A;  4FLB A;  2JEK A;  3FUJ A;  4PS3 A;  3LY9 A;  4HLE A;  3AS5 A;  4HOR A;  4ACL A;  4URK A;  1FVF A;  1PAQ A;  4EEC A;  2J49 A;  1E8X A;  4YVO A;  2J07 A;  3TL5 A;  4PH4 B;  1IYG A;  4CDR A;  1FCH A;  1H2V C;  3AU4 A;  3MEK A;  3HIZ A;  3LVR E;  3LDZ A;  3HHM A;  2WXP A;  1IHG A;  4MRU A;  4JVS A;  4L1B A;  3CGH A;  3QB2 A;  3LVQ E;  2IF4 A;  4N39 A;  3C98 A;  1PY1 A;  4JA7 A;  4N3B A;  2CFU A;  3IKO B;  3APD A;  3CVP A;  1E8W A;  1E7U A;  3G2S A;  3LPZ A;  3NF1 A;  4AY5 A;  4TRQ A;  4XKC A;  2AXV A;  5CHE E;  3RU0 A;  4GYO A;  4G2V A;  1KT1 A;  2XGS A;  5G05 J;  3ZGQ A;  4L2Y A;  1ELR A;  1WAO 1;  3FDH A;  3GZ2 A;  3SZ7 A;  4DI3 A;  4KT6 B;  3GYZ A;  4I2W A;  2XGO A;  5ARF A;  1UJJ A;  4XKB A;  5G04 J;  4FU3 A;  4NAC A;  4RG6 A;  4AP2 A;  3CKB A;  4F7A A;  4J6I A;  4E6H A;  1N52 A;  3D3M A;  2KZT A;  3PUK A;  2LSV A;  2X6K A;  3SFZ A;  4UWK A;  3EHM A;  4EPZ A;  2J4D A;  2BF0 X;  4GZ5 A;  4MKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...