2MHKA

E. coli lpoa n-terminal domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
b'MGSSHHHHHHSSGLVPRGSHMGTHTPDQSTAYMQGTAQADSAFYLQQMQQSSDDTRINWQLLAIRALVKEGKTGQAVELFNQLPQELNDAQRREKTLLAVEIKLAQKDFAGAQNLLAKITPADLEQNQQARYWQAKIDASQGRPSIDLLRALIAQEPLLGAKEKQQNIDATWQALSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMKAGIADWQKRYPNNPGAKMLPTQLVNVKAFKPAST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein activator LpoA
publication title Elongated Structure of the Outer-Membrane Activator of Peptidoglycan Synthesis LpoA: Implications for PBP1A Stimulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 68
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2mhkA01
1.25.40.650 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2mhkA02
1E96B 3ASFA 5EX3A 4UQYA 3SZ7A 4JA7A 1A17A 5CCMA 4KYOB 4P29A 3AS4A 2P58C 3EDTB 3Q5MA 4XI9A 1FCHA 2BUGA 2XCCA 4IN3B 4J8EA 3E4BA 4YVOA 3S7JA 4BTBA 3ZHEB 3MKRA 5EX0A 4N2SA 4HOQA 4UI9C 4GCNA 4W9RA 2XEVA 2QFCA 4BTAA 1NA3A 2PZIA 3N71A 4GZ3A 5A6CA 3AS8A 1TJCA 3QOUA 5FT9A 4YVQC 2WQHA 3ZFWA 4BT8A 4GA1A 3S7DA 4GA0A 2UY1B 2HO1A 4H7YA 2VYIA 1YA0A 3ASGA 4ME2A 4G24A 3U3WA 3GZ1A 4BWRA 4JA9A 1IYGA 2KCLA 2Y4UA 4J8DA 3AS5A 2XGSA 4N3AA 2OOEA 2VGXA 2IF4A 3KAEA 1QQEA 2Y4TA 1KT1A 4WNGA 5KJLA 1ZU2A 5JJ7A 4CDRA 3Q15A 5BT1A 4UQZA 4I2ZA 4U07A 5KJKA 3UQ3A 2IFUA 2FI7A 5FZSA 3LYAA 4BT9A 3VTYA 2HYZA 4KXKB 3FFLA 4I17A 3LY9A 4O6FA 4GA2A 2L6JA 3GZ2A 4JL0A 3R9AB 2XGMA 3S7FA 4ABNA 4EQFA 1HH8A 2PQRA 3LY8A 3KD7A 4J8FA 4WNDA 4U04A 1QZ2A 3GYZA 3HYMB 3TAXA 5G04J 3LKUA 4RG9A 3LCAA 1NZNA 2VGXB 4WUYA 2FF4A 2I6HA 3OXFA 5BNWA 3CV0A 3RJVA 3RU0A 3RIBA 3ZPJA 5JJ6A 3S7BA 4U0UA 2XGOA 3RO3A 2VGYA 3ESKA 4G26A 2DBAA 3VTXA 4GYOA 2YQ8A 4HORA 1ELWA 2KATA 4JHRA 4I9CA 1P5QA 4G25A 1XNFA 5BW8C 3CVNA 4Y6WA 4GYYA 1HZ4A 5ARFA 2UWJG 5KJMA 2C2LA 3MV2B 4WNEA 4G1TA 4H7XA 2FO7A 2J9QA 4J0UA 3PDNA 4YNDA 3QWWA 5DIZA 1KT0A 3OXLA 4CGWA 4LEUA 2AVPA 3BEEA 3WXXA 5CCLA 2HR2A 3ASHA 4GZ6A 3UUXA 1Y8MA 4RG6A 2LSUA 4U0SA 4I9EA 3ZN3A 4G2VA 5AYWD 5CHEE 4WNFA 2XCBA 2R5SA 3JYSA 4AIFA 3ZGQA 4AY5A 1WAO1 3QKYA 5G04C 3TG4A 3MEKA 4HOSA 4I2WA 3Q49B 4UI9K 3U4TA 2C0MA 3RO2A 5HI7A 2FEZA 5M72A 1PC2A 5D0QD 1OUVA 4F3VA 4N3BA 3CVLA 3CK9A 2PL2A 1KLXA 2Q7FA 3CEQA 2PQNA 3O48A 5HQ8A 2GW1A 2WPVA 2MHKA 5FZQA 4GPKA 4N5CA 5EKQD 3QWPA 4Y6CA 3Q4AB 3MA5A 2E2EA 2VSYA 3QDNA 4GYWA 2KCVA 3PE3A 3IEGA 1NA0A 4A1SA 3K9IA 4GCOA 3GW4A 3UPVA 4B94A 4GZ5A 4N2QA 2NC9A 5FZRA 3Q47B 4G23A 4KBQA 5JJTA 3ASDA 3CKBA 2C0LA 2ONDA 4UQXA 1HXIA 4N3CA 4XIFA 4CGVA 3LY7A 3SF4A 5D0OD 1B89A 2V5FA 4HOTA 4UI9J 5LCWC 2LSVA 4N39A 3TG5A 5G05C 4NQ0A 3TGOA 4I1AA 3MV3B 4U0ZA 5FJYA 2VQ2A 2KC7A 2XPIA 4NRHB 3CVQA 4AM9A 1ELRA 1WM5A 5KJNA 3ULQA 1ZBPA 3ZHEA 5LCWJ 1IHGA 3CVPA 3PE4A 5A7DB 5ARGA 2LNIA 5G05J 4XI0A 2VSNA 3KS2A 4APOA 5C1DA 3CK8A 1W3BA 2JLBA 3FWVA 2YHCA 5DBKA 3CK7A 3OXGA 3FP3A 2UY1A 3URZA 4AY6A 5FTPA 3CKCA 3RKVA 3LPZA 3QWVA 3NF1A 4HOUA 2KCKA 2FBNA
chains in the Genus database with same CATH superfamily
3ASFA 3TWWA 4NACA 3BG1B 4JA7A 1A17A 5CCMA 3Q7AA 1E90A 4DX7D 5T3RA 2A5EA 3AS4A 4DJAA 3EDTB 2V4HC 3DPYA 3APFA 3HG0D 3SFXA 1MJ0A 3ONLA 4N2SA 3UM3A 3HXCA 2J8SD 4GCNA 4DX6D 3DSSA 1HF8A 4YDOA 3N71A 2PZIA 2ZIRA 1TJCA 2IONA 4BT8A 4GA1A 4BSZB 2DWZA 1TEZA 3ASGA 4ILHB 4GZCA 5FWQA 4G24A 4GMLA 4TUUA 4I6GA 4KVOA 4J8DA 3KEZA 4BFRA 3B7BA 5ANRA 1FPPA 3ZEFA 3T9KA 4GTTA 2IF4A 2RKKA 3KAEA 3B7RL 1QQEA 2Y4TA 5BXUA 4NURA 4WNGA 1JCQA 4J8YA 5KJLA 2V8SE 2XS1A 3U9WA 4Q69A 1AWCB 2WXKA 3U64A 2OVBA 4CDRA 3Q15A 2IOSA 4UQZA 4I2ZA 1KZOA 5KJKA 3V31A 2WXQA 3LYAA 4KZ0A 2L9BA 3VTYA 2DCPA 1UG3A 4KXKB 1S0PA 2F8XK 3Q73A 4K03A 5A23A 2GGFA 3TXMA 4U8HA 3D9HA 4O1PA 3SI5A 2PM7A 1DC2A 3R9AB 3TWRA 4FADA 2WXGA 2J09A 2PQRA 3LY8A 5JHAA 5CERB 3KD7A 3FUMA 4HLEA 4J8FA 4WNDA 4U04A 2E0IA 2XRZA 2L0TB 2CG3A 3HYMB 4PS8A 5B3SE 3B7TA 3LCAA 1OWLA 4G11A 3DPDA 4MRUA 2VSOE 4JD2G 4UWKA 1ELKA 1JPLA 3D9JA 4QFVA 3DXKG 2V4LA 4U7EB 5B1BE 2I6HA 3LVRE 3AU5A 3CV0A 1JUQA 4I6EA 5JJ6A 1MHQA 2XGOA 3L6AA 1N9AA 4JHKA 3VTXA 2KZTA 3E33A 5ENSD 3C3RA 4ACKA 4JHRA 1P5QA 3RRNB 4HFGA 3ZYLA 4XZ4A 4BEPA 4L1BA 5BW8C 4I43A 4GYYA 1HZ4A 1Q2ZA 1E8YA 2J08A 3ML9A 1OWOA 4HI8A 3VLDA 1OWPA 2C2LA 4WNEA 5KBAA 4G1TA 1O1RA 3UINC 3Q7FA 3TWVA 3FTYA 3ZUVB 1OT8A 2WXIA 3D9MA 2IU1A 1KT0A 3PS6A 3FTSA 4JZYA 2M63A 3RRUA 3OXLA 5CMYA 4HI9A 1TNYA 4HS2A 1JWFA 1EF1C 5CCLA 2YHEA 3PUJA 1WG0A 2RD0A 4RG6A 2J4DA 4U0SA 1Z6TA 2F37A 5AYWD 2DZNA 2R5SA 2P9NG 2LAIA 2X6JA 4QQIA 1EDUA 4HOSA 3ULEG 1MYOA 3J5PA 3U4TA 1YYHA 4KVMA 2KZTB 3CVYA 2FEZA 5M72A 4CRWA 1K3ZD 2P9UG 2OVFA 3EU9A 1KLXA 3CEQA 4GZDA 2PQNA 3O48A 2XPYA 1MX2A 5FZQA 1QBQA 3SFYA 3UXGA 3G2UA 4GPKA 4N5QA 3HVEA 2R2LA 3D9KA 4DI3A 4K5BA 4GYWA 4AP2A 5E75A 3UKUG 3DRAA 3ZYMA 2J4BA 2Y0BG 4HXIA 3R7RA 3IEGA 5J90A 1LF8A 4A1SA 5AJLA 4GMRA 4M3OA 3UPVA 4N2QA 4C0MA 3Q47B 3KEAA 5LOZA 1JCRA 4KBQA 3CR3A 3SBTB 2C0LA 2BTDA 1L5JA 2EIJE 4URKA 4FHJA 2XEEA 1B89A 2LSVA 3TGOA 2VQ2A 4MBGA 2ZGGA 2KC7A 2XPIA 3VLEA 4C0EA 1ELRA 1WM5A 4K5CA 4TXRA 3I4GA 1KZPA 4Q96A 5G2NA 3ZHEA 4BETA 3RSEG 1OWNA 3PE4A 3EIJA 5ARGA 3CIAA 3L08A 3PREA 3JXIA 4CEMA 5CBNA 2Y3AA 4JC8A 4PH4B 5FQ7A 3NZSA 3PNLB 3IXEA 2QC9A 4LUNU 4LNUD 3FU5A 1RW2A 3FH5A 1PAQA 3FWVA 3RK6A 2WXJA 2UY1A 4U8YD 3UMVA 2XEHA 3FEYA 2XZDG 4HBDA 3G2TA 4RQIA 5FIOA 2I1KA 2XRYA 4TUMA 3E37A 3V30A 3NF1A 1TR4A 1E96B 4GTQA 3JCKC 3IV0A 2X6FA 3Q5MA 1IHBA 3MCXA 4L2YA 2EINE 3HXEA 4XI9A 4AOFA 2QY7A 1V55E 1BI7B 1YMPA 1H2VC 2LAHA 2EIME 5EIBE 3Q75A 4BTBA 3ZHEB 3NB2A 5EX0A 3DEPA 4PUCA 2AWIA 2QFCA 3EHRA 4BTAA 5A6CA 3TJPA 3Q78A 2CG2A 3FUHA 4YVQC 2WQHA 2WXHA 2UY1B 4O60A 4YDWA 4WWPA 3U3WA 3GZ1A 3B13A 3T5VA 3ZRHA 3PUKA 2Y4UA 4DX2A 4OYSA 2P2CP 2GRNB 2VGXA 3GZSA 3PEUB 2DIWA 1MZCA 2EQXA 5ENRD 4MLPA 4GU5A 5BT1A 3UI2A 3Q9NC 3FUNA 4GPMA 4DUIA 5ENOD 1VDYA 3JXJA 5AIJA 2YINA 1O1SA 2CFZA 4U96D 1K1AA 5FZSA 4RVBA 3W9FA 3LY9A 4B0ZA 4WAFA 4GA2A 4AEZC 2L6JA 3JQ0A 4B89A 5AN8A 4I1MA 4J7WA 3G2VA 2XGMA 2NSZA 3MKQA 4ABNA 3PRZA 4IYPA 1HH8A 1BU9A 2ILRA 3HDXA 3EHQA 2J49A 3ZKJA 4DX1A 1OCZE 3L17A 2A4ZA 1D8DA 3TAXA 3V79K 4C9BB 3FHEA 2X38A 4RSYA 4A3TA 4RG9A 2EIKE 5KNHD 1NFIE 3NAWA 4C48B 1OCOE 3MZLB 4DX5D 2ZISA 3KSQA 2OEVA 2PNNA 2VGXB 4WUYA 4IULA 3SNXA 1N52A 3HXDA 4GMJA 3ZYQA 4IRUA 1DNPA 5AQAA 3E32A 1D8EA 5ENNA 3ZPJA 4XKBA 3S7BA 5ENQD 1O1TA 3LDZA 3OTNA 2YQ8A 1S64A 2XHEA 4HORA 1ELWA 3TWQA 3C5RA 3ONKA 4GTPA 3FH8A 3QARA 4Y6WA 3AU4A 4TXPA 3PZ1A 3SQVA 1LD8A 1TYQG 3MKQB 4J0UA 3LS8A 2VJ8A 2IJGX 2QYJA 4L9PA 3QWWA 2WMOA 4TRQA 2WXLA 1LD7A 2ZXWE 1IKND 5EYPF 2WMNA 4BSXA 3B7UX 3WXXA 2HR2A 3ASHA 2H6GA 3CHSA 4I9EA 5LP0A 3ZN3A 1OCRE 3DEOA 4G2VA 3CLJA 4WNFA 2R59A 3ZIMA 5G04C 3FTWA 3LXUX 2DYSE 3QJZA 2IQCA 4XEIG 2P9LG 3ULYA 3FUKA 5HRYA 4ACLA 2L0IA 2ETBA 4F3VA 1H2UA 4N3BA 3CVLA 4ANUA 2OCCE 4JVSA 3CSFA 2MHKA 4CT0A 5EKQD 3JUIA 4F6RD 4FULA 2VSYA 1N4SA 2DYRE 3FTXA 4GTRA 4CT4A 1GW6A 3SD5A 1TN7A 4HQDA 4KMOA 3PZ2A 3P1UA 3GW4A 3UIPC 4B94A 3FUIA 1E8WA 2WXNA 2PM6A 2AJAA 4ANVA 4EECA 4JW1A 5JJTA 3CKBA 2OEWA 3VLFA 2ONDA 4L23A 3LJ3A 2CHZA 1H19A 3ISMC 3ML8A 3LY7A 4LCTA 2FO1E 5CEDB 5D0OD 2X6IA 3E34A 2V5FA 4HOTA 2LXLA 3TG5A 4NIKA 3UM2A 4NQ0A 4KT6B 4U63A 5LFAA 3CVQA 2KBXA 1E7VA 1U3CA 2Y69E 1ZBPA 4LSZE 5A7DB 2R03A 3CVPA 4FU3A 2XS8A 3DSXA 4HB5A 4XI0A 3ZXSA 3CQGB 3I4RB 3CHMA 3CK8A 1OCCE 1W3BA 4J8SA 1E8XA 4XE0A 5EN5D 5HS0A 2HE0A 2YHCA 3CK7A 4UWLA 3FP3A 4GTOA 4LNGA 3G2SA 4EBAG 1UOHA 5FTPA 2WVIA 4ANWA 3CVVA 3DSTA 2P9SG 4YDEA 3DSVA 2KCKA 5AAOA 5CMWA 4B93B 3TWSA 2WQ7A 4UQYA 3ABKE 3SZ7A 4LG6A 4P29A 4KYOB 3PH0C 1FCHA 2BUGA 2XCCA 3PZDA 4FC8A 1FVHA 3ABME 1TN8A 3FDHA 1MX4A 3T8MA 3UIOC 4UWFA 2BKGA 2WXMA 3WG7E 1WDYA 4HOQA 4UI9C 4W9RA 2XEVA 1N4QA 2F0YA 1NA3A 1FT1A 3MX3A 2ETCA 3AS8A 3RRMB 3QOUA 2H6HA 3L54A 5EILA 5FT9A 3BG0B 3NBNB 4B8CB 4GA0A 2HO1A 4H7YA 1RZ4A 1SQMA 2VYIA 4YDYA 4ME2A 2P9PG 2KM4A 4BWRA 4DK5A 2ZU6B 3NZUA 2KCLA 3UM1A 4UWHA 2XGSA 3FU0A 4KZCA 4N3AA 1OY3D 4EBAA 3CVXA 5AQ7A 2DVWA 3L16A 1X81A 3MGBA 4DRXE 2JABA 3FTZA 1ZU2A 3HVEB 3KSLA 3FTVA 4XX5A 4BY6A 2QYUA 5D2MC 2RFAA 1SW6A 4U07A 5CBOA 4TV3A 1BPOA 2IFUA 3D9OA 2FI7A 3LVQE 3FH7A 4GTSA 3FU3A 3NOCD 3CVWA 3S2AA 2HYZA 3FFLA 4I17A 4O6FA 4FJYA 4BESA 4FLHA 2AXUA 4HRLA 1IQRA 3QC1A 4Q94A 5LX8A 3S7FA 5BXOA 3HHMA 3C3QA 2AXZA 1SA5A 1JWGA 2XPZA 1QZ2A 3EIQC 1H6OA 3LKUA 2CFUA 3L22A 2WXOA 3QK0A 3L82A 1Z3XA 2NXPA 2MYOA 1N0QA 1INZA 3QB2A 2LXMA 2FF4A 4E85A 5BNWA 3Q9UC 3RJVA 4ATGA 4LNBA 3RU0A 3RIBA 2H6IA 1WY6A 4U0UA 3O4ZA 4K5AB 2VGYA 1U3DA 3ESKA 4G26A 2DBAA 2IOLA 3ZW3A 4GTVA 1N4PA 4GYOA 5B1AE 3F6QA 2OV8A 5CECB 4I9CA 2Y1LE 4I6JA 3CHRA 1XNFA 1XGWA 3LJNA 3DXMG 2UWJG 1OWMA 5HKPA 4L2LA 5CEAA 1D9SA 5KJMA 2ZGDA 1U2VG 5FQ4A 5EYLA 3UT7A 5AQ9A 4H7XA 4HRMB 2J9QA 4JEHA 2IY0C 4LRZA 1AP7A 4BX9A 4V3IA 5JHBA 4YNDA 4CZ2D 2WXRA 2MRIA 3HXFA 5DIZA 5ENPD 5H7PA 1N54A 2AVPA 4EZJA 1K8KG 4PS3A 2XQ0A 3UUXA 3NOGD 1SVXA 2LSUA 3CQCB 4GTMA 3EHMA 3DSUA 4ILIA 3D9IA 3JYSA 3ZGQA 2BF0X 3T5XA 1WAO1 2GROB 2AXVA 3B7SA 3MEKA 4I2WA 1YCSB 1H0AA 2C0MA 3RO2A 3TWUA 4PS7A 4EHMA 3SHFA 3EHNA 3FUJA 5KNGA 3CK9A 2Q7FA 4DPRA 5HQ8A 2WXFA 2GW1A 2WPVA 1IXVA 4N5CA 4U95D 3Q4AB 3FUEA 3DSWA 3QDNA 3HIZA 4OAUC 3PE3A 3NQPA 4HVBA 3AJIA 4ILGA 3L9TA 4PDXA 3ZNGA 1EYHA 4R7LA 2GRMA 3SFZA 1SA4A 2NC9A 3QAQA 5KWDA 4AV7A 2LO6A 3R7QA 1HXIA 4N3CA 4XIFA 1DVPA 1DCQA 3SF4A 4A63B 4G8KA 3APCA 3MV3B 5FJYA 1QNFA 4NRHB 4ANXA 1UW4B 2FULA 4AM9A 3ULQA 5BV1A 4O1OA 3IKOB 1K1BA 3OAWA 5LCWJ 1IHGA 1HX8A 4HLLA 3UKRG 1S70B 5G05J 2VSNA 2VTBA 5J08A 1FVFA 5C1DA 3W9GA 3ASNE 4I1OB 4G8LA 3APDA 1TNBA 3OXGA 3D9LA 3AAAC 3URZA 5T8IA 3CKCA 1NI1A 3HXBA 2X6HA 1FT2A 4OVUA 3LPZA 2J07A 1TN6A 1MQSA 3FULA 4LERA 2WB2A 1HE8A 2I2OA 5AJDA 3JUEA 3ASOE 3MJWA 5EX3A 4UWGA 3P2BA 3C98A 1Z3YA 3L13A 3UX4A 3D9NA 4RLYA 5AENA 1SZAA 4K0RA 1UN8A 2P58C 4IN3B 3ESLA 1UN9A 2WQ6A 4J8EA 3E4BA 4CYMD 4YVOA 3FEXA 3S7JA 2RFMA 3T8KA 4ZFHA 3MKRA 2I9CA 1TNUA 5BV0A 4HNAD 1DCEA 1BD8A 2VTBB 1H6PA 2GRLA 2WM9A 1BLXB 4BX8A 2XZTG 4GZ3A 5JMND 2IO3C 3ZXPA 3ZFWA 3S7DA 5ITZF 2R02A 1YA0A 4FA6A 4HRNA 4JA9A 1EPUA 1A5EA 1N0RA 2X3MA 2BKKB 1IYGA 3AS5A 4FP7A 5G55A 2OOEA 2XENA 1IQUA 3DWLG 3QNKA 4U8VD 3ZU7B 1KT1A 2BEDA 5T4YA 3R9MA 2R17C 3IBEA 5JJ7A 2AW6A 3AG4E 3FTUA 2P9IG 4GAAA 3CVUA 1JCSA 4X8QA 4EPZA 4L7TA 4CDMA 3UQ3A 5BUZA 3TXNA 1X5BA 4A55A 3ZVVA 3FUFA 4BT9A 2I1JA 2IO2C 3BUAA 1HS6A 3TL5A 1N4RA 3FU6A 3IHVA 2JEKA 1OXJA 1QYMA 4FHKA 3C72A 3GZ2A 4JL0A 1HG2A 3X2QE 3CSTA 2L6BA 3RAUA 4EQFA 2LUHA 3ABLE 5EDSA 2IEJA 3GYZA 4MS6A 2GRQB 3C3OA 3D9PA 2F8YA 5G04J 4CDNA 1NZNA 2RG8A 3UT8A 3E30A 5FINA 4J6IA 3OXFA 1N11A 3EJNA 3UTMA 2HM8A 4Z68A 3G2WA 1HO8A 4AJWA 2WXPA 4DI4A 1SZ9A 1PY1A 3RO3A 4ATZD 3EU5A 3BU8A 3CGHA 4WWOA 4JPSA 2KATA 3TWTA 4F1SA 4G25A 1LTXA 4EZLA 3CVNA 4JHJA 5ARFA 5FQ6A 3U66A 3EUVA 2R05A 4CCAA 4F7AA 3MV2B 3HRAA 3I5PA 1O5MA 4DLQA 2FO7A 4F1PA 2P9KG 3PDNA 4M7CA 3V2XA 4DLOA 4A3VA 2CHXA 4JEUA 1S63A 2QZAA 3MYVA 1G3NB 5EIDA 4OAVB 1H6KA 1TNOA 4LEUA 4MKTA 4D10C 4CGWA 3BEEA 2A5UA 3AG3E 4GZ6A 1Y8MA 1ZB1A 2GRRB 3CHOA 3BQOA 5CHEE 2XCBA 4AIFA 3PVLA 4JB8P 4AY5A 3QKYA 3I3NA 3TG4A 3Q49B 4UI9K 3UT4A 5CRUA 5HI7A 1HFAA 1PC2A 5D0QD 2DZOA 1OUVA 4UUCA 2B6CA 1Y6IA 5JA4D 3CHQA 2ETAA 1N95A 2PL2A 2KXPC 3Q79A 2MOWA 3ENEA 1TNZA 5IY5E 3SY2A 3QWPA 4Y6CA 4AXHA 5ENTD 3ZYKA 3MA5A 2E2EA 3PEVB 2KCVA 4WWNA 3AG1E 5CRVA 5C2YA 4APFA 3SBSA 1BI8B 3TWXA 3V2OA 3CHPA 1NA0A 4JXTA 4FJZA 2X6KA 3K9IA 4GCOA 4GZ5A 5FZRA 4BERA 4G23A 2VSXE 3ASDA 4FLBA 5BPPA 4UQXA 1UJJA 4F53A 1N94A 3J5QB 3PZ4A 1H2TC 3PZ3A 4CGVA 4E6HA 2GRPB 1Z5SC 4UI9J 5LCWC 4GB9A 3AG2E 4N39A 5AARA 4ZHBA 4EZKA 5G05C 4I1AA 4U0ZA 1V54E 5KJNA 2V0PA 2VGEA 3DBSA 1NL4A 3IHYA 3FY4A 3UM0A 5D66A 3PNTB 1E7UA 4OVVA 2V5QC 3D3MA 2YNQA 2LNIA 3B95A 1NP7A 3KS2A 4APOA 4TXQA 3SGHA 5KCMA 5E76A 2JLBA 4XKCA 1KPSB 3FUDA 5DBKA 2H6FA 2CHWA 1E8ZA 1MX6A 2EILE 5ANLA 5AQBA 4AY6A 4B8AA 2B0OE 1UJKA 3RKVA 3LEWA 1TJFA 4AVXA 3SO8A 1HG5A 5FQ8A 3JQ1A 1HU3A 3QWVA 4HOUA 2NYJA 4A1GA 2FBNA
chains in the Genus database with same CATH topology
1E96B 3ASFA 3JCKC 5EX3A 4UWGA 3P2BA 2WQ7A 3C98A 1Z3YA 4NACA 4UQYA 3BG1B 3L13A 3UX4A 3D9NA 3SZ7A 5AENA 1SZAA 4JA7A 1A17A 4P29A 3IV0A 4KYOB 1E90A 5CCMA 5T3RA 2X6FA 4K0RA 1UN8A 3AS4A 2P58C 4DJAA 3EDTB 3Q5MA 4L2YA 3MCXA 4XI9A 4AOFA 3PH0C 1FCHA 2BUGA 2QY7A 2XCCA 4IN3B 3ESLA 3PZDA 1UN9A 4FC8A 1FVHA 2WQ6A 3FDHA 4J8EA 1H2VC 2LAHA 3T8MA 3E4BA 4UWFA 3APFA 4YVOA 3FEXA 3S7JA 2WXMA 4BTBA 3ZHEB 3MKRA 2I9CA 3ONLA 5EX0A 5BV0A 4N2SA 4HOQA 4UI9C 4PUCA 2VTBB 4GCNA 4W9RA 2GRLA 2WM9A 2XEVA 1HF8A 4BX8A 2AWIA 2QFCA 1NA3A 2PZIA 3N71A 4BTAA 4GZ3A 5A6CA 3MX3A 3TJPA 3AS8A 1TJCA 3RRMB 3QOUA 3L54A 2CG2A 5FT9A 3BG0B 2IONA 3FUHA 4YVQC 2WQHA 3ZFWA 2WXHA 4BT8A 4GA1A 4B8CB 3S7DA 4GA0A 2UY1B 2HO1A 4H7YA 1SQMA 2VYIA 1TEZA 1YA0A 3ASGA 4ILHB 4ME2A 4WWPA 4GZCA 5FWQA 4G24A 4FA6A 3U3WA 2KM4A 3GZ1A 3B13A 3T5VA 4GMLA 4BWRA 4DK5A 4JA9A 1EPUA 2ZU6B 3NZUA 4TUUA 2X3MA 3ZRHA 4I6GA 2KCLA 4KVOA 3PUKA 2Y4UA 1IYGA 4J8DA 4UWHA 4OYSA 3AS5A 3KEZA 4FP7A 4BFRA 2XGSA 3FU0A 4KZCA 4N3AA 5G55A 5ANRA 4EBAA 3ZEFA 3CVXA 2OOEA 2VGXA 2IF4A 1IQUA 3GZSA 3L16A 3QNKA 3KAEA 3PEUB 2DIWA 3B7RL 1QQEA 3MGBA 2Y4TA 1KT1A 2EQXA 4NURA 4WNGA 5KJLA 2V8SE 3U9WA 3FTZA 4Q69A 1ZU2A 4MLPA 3HVEB 5T4YA 2R17C 3IBEA 2WXKA 3U64A 2AW6A 5JJ7A 3FTVA 4XX5A 2OVBA 4BY6A 3FTUA 4GU5A 4CDRA 3Q15A 2IOSA 5BT1A 4GAAA 4UQZA 4I2ZA 4U07A 3FUNA 3CVUA 4EPZA 4L7TA 4TV3A 1BPOA 5KJKA 4CDMA 3UQ3A 5BUZA 2IFUA 3D9OA 1VDYA 3TXNA 1X5BA 5AIJA 4A55A 2YINA 2CFZA 2FI7A 3LVQE 3ZVVA 3FH7A 2WXQA 5FZSA 3FU3A 3LYAA 4KZ0A 3FUFA 4BT9A 2I1JA 2L9BA 3CVWA 4RVBA 3VTYA 2DCPA 3S2AA 2HYZA 1UG3A 4KXKB 1HS6A 3FFLA 3TL5A 4I17A 3LY9A 1S0PA 4FJYA 4O6FA 4B0ZA 4WAFA 4K03A 4FLHA 2AXUA 2GGFA 3FU6A 2JEKA 3IHVA 4GA2A 4U8HA 3TXMA 4AEZC 2L6JA 1IQRA 3JQ0A 4FHKA 3QC1A 4B89A 3SI5A 3GZ2A 4JL0A 2PM7A 1HG2A 3R9AB 4FADA 4I1MA 3CSTA 2WXGA 3G2VA 2XGMA 2NSZA 4Q94A 3MKQA 3S7FA 4ABNA 5LX8A 3PRZA 4IYPA 4EQFA 3HHMA 2J09A 1HH8A 2PQRA 3LY8A 5JHAA 2ILRA 2AXZA 3KD7A 3HDXA 3FUMA 4HLEA 4J8FA 2J49A 4WNDA 5EDSA 4U04A 1JWGA 2E0IA 3L17A 2XPZA 1QZ2A 3EIQC 3GYZA 2XRZA 2L0TB 4MS6A 2A4ZA 2CG3A 3HYMB 4PS8A 3TAXA 3D9PA 4C9BB 3FHEA 3B7TA 2X38A 4RSYA 5G04J 3LKUA 4A3TA 4CDNA 2CFUA 3L22A 4RG9A 3LCAA 2WXOA 1OWLA 3QK0A 1Z3XA 4G11A 2NXPA 3DPDA 4MRUA 5A23A 2VSOE 3MZLB 4UWKA 1ELKA 1JPLA 1INZA 3D9JA 4QFVA 3QB2A 2V4LA 1NZNA 2RG8A 2VGXB 4IULA 2FF4A 2I6HA 3LVRE 4J6IA 4WUYA 3UT8A 4E85A 3AU5A 3OXFA 5BNWA 3CV0A 3RJVA 3SNXA 3EJNA 1N52A 4GMJA 3ZYQA 4ATGA 2HM8A 1JUQA 1DNPA 4IRUA 3G2WA 1HO8A 3RU0A 4AJWA 3RIBA 2WXPA 4DI4A 5ENNA 3ZPJA 4XKBA 1WY6A 4I6EA 5JJ6A 3S7BA 1MHQA 4U0UA 1SZ9A 3O4ZA 1PY1A 2XGOA 3L6AA 3RO3A 2VGYA 1U3DA 3ESKA 3LDZA 4G26A 2DBAA 4JHKA 2IOLA 3ZW3A 3OTNA 3VTXA 4GYOA 2KZTA 2YQ8A 3CGHA 4WWOA 4JPSA 4ACKA 2XHEA 4HORA 1ELWA 2KATA 4JHRA 2OV8A 4I9CA 1P5QA 4I6JA 4HFGA 4G25A 3RRNB 3ZYLA 4F1SA 3ONKA 3CHRA 1XNFA 4EZLA 1XGWA 3FH8A 4XZ4A 4L1BA 3QARA 5BW8C 4I43A 5A7DB 3CVNA 4Y6WA 4JHJA 4GYYA 1HZ4A 5ARFA 3AU4A 2UWJG 1E8YA 1OWMA 4L2LA 5FQ6A 3U66A 2J08A 3ML9A 1OWOA 5KJMA 4CCAA 3VLDA 1OWPA 2C2LA 4F7AA 3MV2B 5FQ4A 4WNEA 3I5PA 4G1TA 3UT7A 3MKQB 4H7XA 4DLQA 2FO7A 2J9QA 4J0UA 4JEHA 3LS8A 2VJ8A 2IJGX 4LRZA 3FTYA 4BX9A 3PDNA 4V3IA 2WXIA 5JHBA 4YNDA 3QWWA 3D9MA 2WMOA 2WXRA 4TRQA 4DLOA 2IU1A 2MRIA 4A3VA 5DIZA 2CHXA 2WXLA 1KT0A 4JEUA 3PS6A 3FTSA 3MYVA 4JZYA 2M63A 3RRUA 2WMNA 4BSXA 3OXLA 5CMYA 1N54A 1H6KA 4CGWA 4HS2A 4LEUA 4MKTA 4D10C 3B7UX 1JWFA 1EF1C 2AVPA 3BEEA 3WXXA 2A5UA 4EZJA 5CCLA 2HR2A 4PS3A 2YHEA 3ASHA 4GZ6A 2XQ0A 3UUXA 3PUJA 1Y8MA 3CHSA 2RD0A 4RG6A 2J4DA 2LSUA 3CHOA 4U0SA 4I9EA 5LP0A 3ZN3A 1Z6TA 3CQCB 4G2VA 3CLJA 3EHMA 5AYWD 5CHEE 4WNFA 2R59A 2XCBA 4ILIA 2R5SA 3D9IA 3JYSA 3ZGQA 2BF0X 3PVLA 3T5XA 1WAO1 4AIFA 2LAIA 3I3NA 3QKYA 3ZIMA 2AXVA 4AY5A 3B7SA 5G04C 3TG4A 2X6JA 3FTWA 3MEKA 1EDUA 3LXUX 4HOSA 4I2WA 3QJZA 3Q49B 4UI9K 2IQCA 1H0AA 3U4TA 2C0MA 3RO2A 5HI7A 3UT4A 4KVMA 2KZTB 3CVYA 3FUKA 4PS7A 2FEZA 1HFAA 5M72A 1PC2A 5D0QD 3SHFA 4CRWA 4ACLA 1OUVA 2L0IA 1Y6IA 3EHNA 3FUJA 4F3VA 3CHQA 2OVFA 1H2UA 4N3BA 3CVLA 3CK9A 2PL2A 4ANUA 1KLXA 4JVSA 2Q7FA 3CSFA 3CEQA 4GZDA 4DPRA 2PQNA 3O48A 2MOWA 5HQ8A 2WXFA 2GW1A 2WPVA 2MHKA 2XPYA 3ENEA 5FZQA 4GPKA 3G2UA 4CT0A 5AJDA 4N5CA 5EKQD 3QWPA 4Y6CA 3Q4AB 3JUIA 4AXHA 3FUEA 4FULA 3HVEA 3ZYKA 3MA5A 2E2EA 3D9KA 3PEVB 4DI3A 2VSYA 3QDNA 4GYWA 3HIZA 4AP2A 2KCVA 4WWNA 5E75A 3PE3A 3NQPA 4HVBA 5C2YA 3FTXA 4APFA 3SBSA 4CT4A 2J4BA 1GW6A 4HXIA 3SD5A 3ZYMA 3R7RA 4ILGA 3IEGA 5J90A 1LF8A 3CHPA 4KMOA 1NA0A 4JXTA 4A1SA 4FJZA 2X6KA 3K9IA 3P1UA 4PDXA 1EYHA 5AJLA 4GCOA 4M3OA 3GW4A 4R7LA 3UPVA 2GRMA 4B94A 3FUIA 4GZ5A 3SFZA 4N2QA 2NC9A 4C0MA 1E8WA 5FZRA 2WXNA 3Q47B 2PM6A 3QAQA 4G23A 4ANVA 4EECA 4AV7A 5LOZA 2LO6A 4JW1A 2VSXE 3CR3A 4KBQA 3ASDA 3SBTB 5JJTA 4FLBA 3CKBA 3R7QA 5BPPA 3VLFA 2C0LA 1UJJA 2ONDA 3LJ3A 4L23A 1HXIA 4N3CA 4UQXA 1H2TC 4F53A 2CHZA 2BTDA 1L5JA 4XIFA 1H19A 4CGVA 1DVPA 3ML8A 3LY7A 4LCTA 4URKA 4E6HA 3SF4A 4FHJA 5D0OD 2X6IA 1B89A 2V5FA 4HOTA 4UI9J 5LCWC 2LSVA 4GB9A 3APCA 4N39A 3TG5A 4EZKA 5G05C 4NQ0A 3TGOA 4I1AA 3MV3B 4KT6B 4U0ZA 5FJYA 2VQ2A 4U63A 1QNFA 2KC7A 2XPIA 1UW4B 4NRHB 3VLEA 4ANXA 2FULA 3CVQA 5LFAA 4C0EA 4AM9A 1ELRA 1WM5A 5KJNA 1E7VA 1U3CA 2V0PA 3ULQA 5BV1A 1ZBPA 3I4GA 3IKOB 3DBSA 3OAWA 4Q96A 3IHYA 5G2NA 3ZHEA 3FY4A 5LCWJ 1OWNA 3PNTB 1IHGA 1HX8A 3CVPA 1E7UA 3EIJA 3PE4A 4FU3A 4OVVA 5ARGA 3D3MA 3CIAA 3L08A 2YNQA 2LNIA 5G05J 3PREA 4XI0A 2VSNA 2VTBA 1NP7A 3ZXSA 5J08A 4CEMA 1FVFA 2Y3AA 4JC8A 3KS2A 4PH4B 4APOA 5C1DA 3CQGB 3SGHA 5FQ7A 3I4RB 3NZSA 5KCMA 3PNLB 5E76A 3CHMA 3CK8A 1W3BA 4J8SA 4LUNU 3FU5A 2JLBA 4XKCA 1E8XA 4XE0A 4I1OB 3FH5A 1PAQA 3FWVA 3APDA 3RK6A 2YHCA 3FUDA 5DBKA 3CK7A 3OXGA 3D9LA 4UWLA 2CHWA 3FP3A 2WXJA 2UY1A 1E8ZA 5ANLA 3G2SA 4EBAG 3URZA 5T8IA 4AY6A 4B8AA 5FTPA 3UMVA 1UJKA 3CKCA 2WVIA 3RKVA 3FEYA 4ANWA 3LEWA 2X6HA 1TJFA 3G2TA 4OVUA 4AVXA 3CVVA 3LPZA 2J07A 1HG5A 2I1KA 3JQ1A 5FQ8A 1HU3A 1MQSA 2XRYA 3FULA 3QWVA 4LERA 2WB2A 3NF1A 4HOUA 1HE8A 2I2OA 2KCKA 5CMWA 4A1GA 2FBNA 3MJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E96 B;  3ASF A;  5EX3 A;  4UQY A;  3SZ7 A;  4JA7 A;  1A17 A;  5CCM A;  4KYO B;  4P29 A;  3AS4 A;  2P58 C;  3EDT B;  3Q5M A;  4XI9 A;  1FCH A;  2BUG A;  2XCC A;  4IN3 B;  4J8E A;  3E4B A;  4YVO A;  3S7J A;  4BTB A;  3ZHE B;  3MKR A;  5EX0 A;  4N2S A;  4HOQ A;  4UI9 C;  4GCN A;  4W9R A;  2XEV A;  2QFC A;  4BTA A;  1NA3 A;  2PZI A;  3N71 A;  4GZ3 A;  5A6C A;  3AS8 A;  1TJC A;  3QOU A;  5FT9 A;  4YVQ C;  2WQH A;  3ZFW A;  4BT8 A;  4GA1 A;  3S7D A;  4GA0 A;  2UY1 B;  2HO1 A;  4H7Y A;  2VYI A;  1YA0 A;  3ASG A;  4ME2 A;  4G24 A;  3U3W A;  3GZ1 A;  4BWR A;  4JA9 A;  1IYG A;  2KCL A;  2Y4U A;  4J8D A;  3AS5 A;  2XGS A;  4N3A A;  2OOE A;  2VGX A;  2IF4 A;  3KAE A;  1QQE A;  2Y4T A;  1KT1 A;  4WNG A;  5KJL A;  1ZU2 A;  5JJ7 A;  4CDR A;  3Q15 A;  5BT1 A;  4UQZ A;  4I2Z A;  4U07 A;  5KJK A;  3UQ3 A;  2IFU A;  2FI7 A;  5FZS A;  3LYA A;  4BT9 A;  3VTY A;  2HYZ A;  4KXK B;  3FFL A;  4I17 A;  3LY9 A;  4O6F A;  4GA2 A;  2L6J A;  3GZ2 A;  4JL0 A;  3R9A B;  2XGM A;  3S7F A;  4ABN A;  4EQF A;  1HH8 A;  2PQR A;  3LY8 A;  3KD7 A;  4J8F A;  4WND A;  4U04 A;  1QZ2 A;  3GYZ A;  3HYM B;  3TAX A;  5G04 J;  3LKU A;  4RG9 A;  3LCA A;  1NZN A;  2VGX B;  4WUY A;  2FF4 A;  2I6H A;  3OXF A;  5BNW A;  3CV0 A;  3RJV A;  3RU0 A;  3RIB A;  3ZPJ A;  5JJ6 A;  3S7B A;  4U0U A;  2XGO A;  3RO3 A;  2VGY A;  3ESK A;  4G26 A;  2DBA A;  3VTX A;  4GYO A;  2YQ8 A;  4HOR A;  1ELW A;  2KAT A;  4JHR A;  4I9C A;  1P5Q A;  4G25 A;  1XNF A;  5BW8 C;  3CVN A;  4Y6W A;  4GYY A;  1HZ4 A;  5ARF A;  2UWJ G;  5KJM A;  2C2L A;  3MV2 B;  4WNE A;  4G1T A;  4H7X A;  2FO7 A;  2J9Q A;  4J0U A;  3PDN A;  4YND A;  3QWW A;  5DIZ A;  1KT0 A;  3OXL A;  4CGW A;  4LEU A;  2AVP A;  3BEE A;  3WXX A;  5CCL A;  2HR2 A;  3ASH A;  4GZ6 A;  3UUX A;  1Y8M A;  4RG6 A;  2LSU A;  4U0S A;  4I9E A;  3ZN3 A;  4G2V A;  5AYW D;  5CHE E;  4WNF A;  2XCB A;  2R5S A;  3JYS A;  4AIF A;  3ZGQ A;  4AY5 A;  1WAO 1;  3QKY A;  5G04 C;  3TG4 A;  3MEK A;  4HOS A;  4I2W A;  3Q49 B;  4UI9 K;  3U4T A;  2C0M A;  3RO2 A;  5HI7 A;  2FEZ A;  5M72 A;  1PC2 A;  5D0Q D;  1OUV A;  4F3V A;  4N3B A;  3CVL A;  3CK9 A;  2PL2 A;  1KLX A;  2Q7F A;  3CEQ A;  2PQN A;  3O48 A;  5HQ8 A;  2GW1 A;  2WPV A;  2MHK A;  5FZQ A;  4GPK A;  4N5C A;  5EKQ D;  3QWP A;  4Y6C A;  3Q4A B;  3MA5 A;  2E2E A;  2VSY A;  3QDN A;  4GYW A;  2KCV A;  3PE3 A;  3IEG A;  1NA0 A;  4A1S A;  3K9I A;  4GCO A;  3GW4 A;  3UPV A;  4B94 A;  4GZ5 A;  4N2Q A;  2NC9 A;  5FZR A;  3Q47 B;  4G23 A;  4KBQ A;  5JJT A;  3ASD A;  3CKB A;  2C0L A;  2OND A;  4UQX A;  1HXI A;  4N3C A;  4XIF A;  4CGV A;  3LY7 A;  3SF4 A;  5D0O D;  1B89 A;  2V5F A;  4HOT A;  4UI9 J;  5LCW C;  2LSV A;  4N39 A;  3TG5 A;  5G05 C;  4NQ0 A;  3TGO A;  4I1A A;  3MV3 B;  4U0Z A;  5FJY A;  2VQ2 A;  2KC7 A;  2XPI A;  4NRH B;  3CVQ A;  4AM9 A;  1ELR A;  1WM5 A;  5KJN A;  3ULQ A;  1ZBP A;  3ZHE A;  5LCW J;  1IHG A;  3CVP A;  3PE4 A;  5A7D B;  5ARG A;  2LNI A;  5G05 J;  4XI0 A;  2VSN A;  3KS2 A;  4APO A;  5C1D A;  3CK8 A;  1W3B A;  2JLB A;  3FWV A;  2YHC A;  5DBK A;  3CK7 A;  3OXG A;  3FP3 A;  2UY1 A;  3URZ A;  4AY6 A;  5FTP A;  3CKC A;  3RKV A;  3LPZ A;  3QWV A;  3NF1 A;  4HOU A;  2KCK A;  2FBN A; 
#chains in the Genus database with same CATH topology
 3ASF A;  3TWW A;  4NAC A;  3BG1 B;  4JA7 A;  1A17 A;  5CCM A;  3Q7A A;  1E90 A;  4DX7 D;  5T3R A;  2A5E A;  3AS4 A;  4DJA A;  3EDT B;  2V4H C;  3DPY A;  3APF A;  3HG0 D;  3SFX A;  1MJ0 A;  3ONL A;  4N2S A;  3UM3 A;  3HXC A;  2J8S D;  4GCN A;  4DX6 D;  3DSS A;  1HF8 A;  4YDO A;  3N71 A;  2PZI A;  2ZIR A;  1TJC A;  2ION A;  4BT8 A;  4GA1 A;  4BSZ B;  2DWZ A;  1TEZ A;  3ASG A;  4ILH B;  4GZC A;  5FWQ A;  4G24 A;  4GML A;  4TUU A;  4I6G A;  4KVO A;  4J8D A;  3KEZ A;  4BFR A;  3B7B A;  5ANR A;  1FPP A;  3ZEF A;  3T9K A;  4GTT A;  2IF4 A;  2RKK A;  3KAE A;  3B7R L;  1QQE A;  2Y4T A;  5BXU A;  4NUR A;  4WNG A;  1JCQ A;  4J8Y A;  5KJL A;  2V8S E;  2XS1 A;  3U9W A;  4Q69 A;  1AWC B;  2WXK A;  3U64 A;  2OVB A;  4CDR A;  3Q15 A;  2IOS A;  4UQZ A;  4I2Z A;  1KZO A;  5KJK A;  3V31 A;  2WXQ A;  3LYA A;  4KZ0 A;  2L9B A;  3VTY A;  2DCP A;  1UG3 A;  4KXK B;  1S0P A;  2F8X K;  3Q73 A;  4K03 A;  5A23 A;  2GGF A;  3TXM A;  4U8H A;  3D9H A;  4O1P A;  3SI5 A;  2PM7 A;  1DC2 A;  3R9A B;  3TWR A;  4FAD A;  2WXG A;  2J09 A;  2PQR A;  3LY8 A;  5JHA A;  5CER B;  3KD7 A;  3FUM A;  4HLE A;  4J8F A;  4WND A;  4U04 A;  2E0I A;  2XRZ A;  2L0T B;  2CG3 A;  3HYM B;  4PS8 A;  5B3S E;  3B7T A;  3LCA A;  1OWL A;  4G11 A;  3DPD A;  4MRU A;  2VSO E;  4JD2 G;  4UWK A;  1ELK A;  1JPL A;  3D9J A;  4QFV A;  3DXK G;  2V4L A;  4U7E B;  5B1B E;  2I6H A;  3LVR E;  3AU5 A;  3CV0 A;  1JUQ A;  4I6E A;  5JJ6 A;  1MHQ A;  2XGO A;  3L6A A;  1N9A A;  4JHK A;  3VTX A;  2KZT A;  3E33 A;  5ENS D;  3C3R A;  4ACK A;  4JHR A;  1P5Q A;  3RRN B;  4HFG A;  3ZYL A;  4XZ4 A;  4BEP A;  4L1B A;  5BW8 C;  4I43 A;  4GYY A;  1HZ4 A;  1Q2Z A;  1E8Y A;  2J08 A;  3ML9 A;  1OWO A;  4HI8 A;  3VLD A;  1OWP A;  2C2L A;  4WNE A;  5KBA A;  4G1T A;  1O1R A;  3UIN C;  3Q7F A;  3TWV A;  3FTY A;  3ZUV B;  1OT8 A;  2WXI A;  3D9M A;  2IU1 A;  1KT0 A;  3PS6 A;  3FTS A;  4JZY A;  2M63 A;  3RRU A;  3OXL A;  5CMY A;  4HI9 A;  1TNY A;  4HS2 A;  1JWF A;  1EF1 C;  5CCL A;  2YHE A;  3PUJ A;  1WG0 A;  2RD0 A;  4RG6 A;  2J4D A;  4U0S A;  1Z6T A;  2F37 A;  5AYW D;  2DZN A;  2R5S A;  2P9N G;  2LAI A;  2X6J A;  4QQI A;  1EDU A;  4HOS A;  3ULE G;  1MYO A;  3J5P A;  3U4T A;  1YYH A;  4KVM A;  2KZT B;  3CVY A;  2FEZ A;  5M72 A;  4CRW A;  1K3Z D;  2P9U G;  2OVF A;  3EU9 A;  1KLX A;  3CEQ A;  4GZD A;  2PQN A;  3O48 A;  2XPY A;  1MX2 A;  5FZQ A;  1QBQ A;  3SFY A;  3UXG A;  3G2U A;  4GPK A;  4N5Q A;  3HVE A;  2R2L A;  3D9K A;  4DI3 A;  4K5B A;  4GYW A;  4AP2 A;  5E75 A;  3UKU G;  3DRA A;  3ZYM A;  2J4B A;  2Y0B G;  4HXI A;  3R7R A;  3IEG A;  5J90 A;  1LF8 A;  4A1S A;  5AJL A;  4GMR A;  4M3O A;  3UPV A;  4N2Q A;  4C0M A;  3Q47 B;  3KEA A;  5LOZ A;  1JCR A;  4KBQ A;  3CR3 A;  3SBT B;  2C0L A;  2BTD A;  1L5J A;  2EIJ E;  4URK A;  4FHJ A;  2XEE A;  1B89 A;  2LSV A;  3TGO A;  2VQ2 A;  4MBG A;  2ZGG A;  2KC7 A;  2XPI A;  3VLE A;  4C0E A;  1ELR A;  1WM5 A;  4K5C A;  4TXR A;  3I4G A;  1KZP A;  4Q96 A;  5G2N A;  3ZHE A;  4BET A;  3RSE G;  1OWN A;  3PE4 A;  3EIJ A;  5ARG A;  3CIA A;  3L08 A;  3PRE A;  3JXI A;  4CEM A;  5CBN A;  2Y3A A;  4JC8 A;  4PH4 B;  5FQ7 A;  3NZS A;  3PNL B;  3IXE A;  2QC9 A;  4LUN U;  4LNU D;  3FU5 A;  1RW2 A;  3FH5 A;  1PAQ A;  3FWV A;  3RK6 A;  2WXJ A;  2UY1 A;  4U8Y D;  3UMV A;  2XEH A;  3FEY A;  2XZD G;  4HBD A;  3G2T A;  4RQI A;  5FIO A;  2I1K A;  2XRY A;  4TUM A;  3E37 A;  3V30 A;  3NF1 A;  1TR4 A;  1E96 B;  4GTQ A;  3JCK C;  3IV0 A;  2X6F A;  3Q5M A;  1IHB A;  3MCX A;  4L2Y A;  2EIN E;  3HXE A;  4XI9 A;  4AOF A;  2QY7 A;  1V55 E;  1BI7 B;  1YMP A;  1H2V C;  2LAH A;  2EIM E;  5EIB E;  3Q75 A;  4BTB A;  3ZHE B;  3NB2 A;  5EX0 A;  3DEP A;  4PUC A;  2AWI A;  2QFC A;  3EHR A;  4BTA A;  5A6C A;  3TJP A;  3Q78 A;  2CG2 A;  3FUH A;  4YVQ C;  2WQH A;  2WXH A;  2UY1 B;  4O60 A;  4YDW A;  4WWP A;  3U3W A;  3GZ1 A;  3B13 A;  3T5V A;  3ZRH A;  3PUK A;  2Y4U A;  4DX2 A;  4OYS A;  2P2C P;  2GRN B;  2VGX A;  3GZS A;  3PEU B;  2DIW A;  1MZC A;  2EQX A;  5ENR D;  4MLP A;  4GU5 A;  5BT1 A;  3UI2 A;  3Q9N C;  3FUN A;  4GPM A;  4DUI A;  5ENO D;  1VDY A;  3JXJ A;  5AIJ A;  2YIN A;  1O1S A;  2CFZ A;  4U96 D;  1K1A A;  5FZS A;  4RVB A;  3W9F A;  3LY9 A;  4B0Z A;  4WAF A;  4GA2 A;  4AEZ C;  2L6J A;  3JQ0 A;  4B89 A;  5AN8 A;  4I1M A;  4J7W A;  3G2V A;  2XGM A;  2NSZ A;  3MKQ A;  4ABN A;  3PRZ A;  4IYP A;  1HH8 A;  1BU9 A;  2ILR A;  3HDX A;  3EHQ A;  2J49 A;  3ZKJ A;  4DX1 A;  1OCZ E;  3L17 A;  2A4Z A;  1D8D A;  3TAX A;  3V79 K;  4C9B B;  3FHE A;  2X38 A;  4RSY A;  4A3T A;  4RG9 A;  2EIK E;  5KNH D;  1NFI E;  3NAW A;  4C48 B;  1OCO E;  3MZL B;  4DX5 D;  2ZIS A;  3KSQ A;  2OEV A;  2PNN A;  2VGX B;  4WUY A;  4IUL A;  3SNX A;  1N52 A;  3HXD A;  4GMJ A;  3ZYQ A;  4IRU A;  1DNP A;  5AQA A;  3E32 A;  1D8E A;  5ENN A;  3ZPJ A;  4XKB A;  3S7B A;  5ENQ D;  1O1T A;  3LDZ A;  3OTN A;  2YQ8 A;  1S64 A;  2XHE A;  4HOR A;  1ELW A;  3TWQ A;  3C5R A;  3ONK A;  4GTP A;  3FH8 A;  3QAR A;  4Y6W A;  3AU4 A;  4TXP A;  3PZ1 A;  3SQV A;  1LD8 A;  1TYQ G;  3MKQ B;  4J0U A;  3LS8 A;  2VJ8 A;  2IJG X;  2QYJ A;  4L9P A;  3QWW A;  2WMO A;  4TRQ A;  2WXL A;  1LD7 A;  2ZXW E;  1IKN D;  5EYP F;  2WMN A;  4BSX A;  3B7U X;  3WXX A;  2HR2 A;  3ASH A;  2H6G A;  3CHS A;  4I9E A;  5LP0 A;  3ZN3 A;  1OCR E;  3DEO A;  4G2V A;  3CLJ A;  4WNF A;  2R59 A;  3ZIM A;  5G04 C;  3FTW A;  3LXU X;  2DYS E;  3QJZ A;  2IQC A;  4XEI G;  2P9L G;  3ULY A;  3FUK A;  5HRY A;  4ACL A;  2L0I A;  2ETB A;  4F3V A;  1H2U A;  4N3B A;  3CVL A;  4ANU A;  2OCC E;  4JVS A;  3CSF A;  2MHK A;  4CT0 A;  5EKQ D;  3JUI A;  4F6R D;  4FUL A;  2VSY A;  1N4S A;  2DYR E;  3FTX A;  4GTR A;  4CT4 A;  1GW6 A;  3SD5 A;  1TN7 A;  4HQD A;  4KMO A;  3PZ2 A;  3P1U A;  3GW4 A;  3UIP C;  4B94 A;  3FUI A;  1E8W A;  2WXN A;  2PM6 A;  2AJA A;  4ANV A;  4EEC A;  4JW1 A;  5JJT A;  3CKB A;  2OEW A;  3VLF A;  2OND A;  4L23 A;  3LJ3 A;  2CHZ A;  1H19 A;  3ISM C;  3ML8 A;  3LY7 A;  4LCT A;  2FO1 E;  5CED B;  5D0O D;  2X6I A;  3E34 A;  2V5F A;  4HOT A;  2LXL A;  3TG5 A;  4NIK A;  3UM2 A;  4NQ0 A;  4KT6 B;  4U63 A;  5LFA A;  3CVQ A;  2KBX A;  1E7V A;  1U3C A;  2Y69 E;  1ZBP A;  4LSZ E;  5A7D B;  2R03 A;  3CVP A;  4FU3 A;  2XS8 A;  3DSX A;  4HB5 A;  4XI0 A;  3ZXS A;  3CQG B;  3I4R B;  3CHM A;  3CK8 A;  1OCC E;  1W3B A;  4J8S A;  1E8X A;  4XE0 A;  5EN5 D;  5HS0 A;  2HE0 A;  2YHC A;  3CK7 A;  4UWL A;  3FP3 A;  4GTO A;  4LNG A;  3G2S A;  4EBA G;  1UOH A;  5FTP A;  2WVI A;  4ANW A;  3CVV A;  3DST A;  2P9S G;  4YDE A;  3DSV A;  2KCK A;  5AAO A;  5CMW A;  4B93 B;  3TWS A;  2WQ7 A;  4UQY A;  3ABK E;  3SZ7 A;  4LG6 A;  4P29 A;  4KYO B;  3PH0 C;  1FCH A;  2BUG A;  2XCC A;  3PZD A;  4FC8 A;  1FVH A;  3ABM E;  1TN8 A;  3FDH A;  1MX4 A;  3T8M A;  3UIO C;  4UWF A;  2BKG A;  2WXM A;  3WG7 E;  1WDY A;  4HOQ A;  4UI9 C;  4W9R A;  2XEV A;  1N4Q A;  2F0Y A;  1NA3 A;  1FT1 A;  3MX3 A;  2ETC A;  3AS8 A;  3RRM B;  3QOU A;  2H6H A;  3L54 A;  5EIL A;  5FT9 A;  3BG0 B;  3NBN B;  4B8C B;  4GA0 A;  2HO1 A;  4H7Y A;  1RZ4 A;  1SQM A;  2VYI A;  4YDY A;  4ME2 A;  2P9P G;  2KM4 A;  4BWR A;  4DK5 A;  2ZU6 B;  3NZU A;  2KCL A;  3UM1 A;  4UWH A;  2XGS A;  3FU0 A;  4KZC A;  4N3A A;  1OY3 D;  4EBA A;  3CVX A;  5AQ7 A;  2DVW A;  3L16 A;  1X81 A;  3MGB A;  4DRX E;  2JAB A;  3FTZ A;  1ZU2 A;  3HVE B;  3KSL A;  3FTV A;  4XX5 A;  4BY6 A;  2QYU A;  5D2M C;  2RFA A;  1SW6 A;  4U07 A;  5CBO A;  4TV3 A;  1BPO A;  2IFU A;  3D9O A;  2FI7 A;  3LVQ E;  3FH7 A;  4GTS A;  3FU3 A;  3NOC D;  3CVW A;  3S2A A;  2HYZ A;  3FFL A;  4I17 A;  4O6F A;  4FJY A;  4BES A;  4FLH A;  2AXU A;  4HRL A;  1IQR A;  3QC1 A;  4Q94 A;  5LX8 A;  3S7F A;  5BXO A;  3HHM A;  3C3Q A;  2AXZ A;  1SA5 A;  1JWG A;  2XPZ A;  1QZ2 A;  3EIQ C;  1H6O A;  3LKU A;  2CFU A;  3L22 A;  2WXO A;  3QK0 A;  3L82 A;  1Z3X A;  2NXP A;  2MYO A;  1N0Q A;  1INZ A;  3QB2 A;  2LXM A;  2FF4 A;  4E85 A;  5BNW A;  3Q9U C;  3RJV A;  4ATG A;  4LNB A;  3RU0 A;  3RIB A;  2H6I A;  1WY6 A;  4U0U A;  3O4Z A;  4K5A B;  2VGY A;  1U3D A;  3ESK A;  4G26 A;  2DBA A;  2IOL A;  3ZW3 A;  4GTV A;  1N4P A;  4GYO A;  5B1A E;  3F6Q A;  2OV8 A;  5CEC B;  4I9C A;  2Y1L E;  4I6J A;  3CHR A;  1XNF A;  1XGW A;  3LJN A;  3DXM G;  2UWJ G;  1OWM A;  5HKP A;  4L2L A;  5CEA A;  1D9S A;  5KJM A;  2ZGD A;  1U2V G;  5FQ4 A;  5EYL A;  3UT7 A;  5AQ9 A;  4H7X A;  4HRM B;  2J9Q A;  4JEH A;  2IY0 C;  4LRZ A;  1AP7 A;  4BX9 A;  4V3I A;  5JHB A;  4YND A;  4CZ2 D;  2WXR A;  2MRI A;  3HXF A;  5DIZ A;  5ENP D;  5H7P A;  1N54 A;  2AVP A;  4EZJ A;  1K8K G;  4PS3 A;  2XQ0 A;  3UUX A;  3NOG D;  1SVX A;  2LSU A;  3CQC B;  4GTM A;  3EHM A;  3DSU A;  4ILI A;  3D9I A;  3JYS A;  3ZGQ A;  2BF0 X;  3T5X A;  1WAO 1;  2GRO B;  2AXV A;  3B7S A;  3MEK A;  4I2W A;  1YCS B;  1H0A A;  2C0M A;  3RO2 A;  3TWU A;  4PS7 A;  4EHM A;  3SHF A;  3EHN A;  3FUJ A;  5KNG A;  3CK9 A;  2Q7F A;  4DPR A;  5HQ8 A;  2WXF A;  2GW1 A;  2WPV A;  1IXV A;  4N5C A;  4U95 D;  3Q4A B;  3FUE A;  3DSW A;  3QDN A;  3HIZ A;  4OAU C;  3PE3 A;  3NQP A;  4HVB A;  3AJI A;  4ILG A;  3L9T A;  4PDX A;  3ZNG A;  1EYH A;  4R7L A;  2GRM A;  3SFZ A;  1SA4 A;  2NC9 A;  3QAQ A;  5KWD A;  4AV7 A;  2LO6 A;  3R7Q A;  1HXI A;  4N3C A;  4XIF A;  1DVP A;  1DCQ A;  3SF4 A;  4A63 B;  4G8K A;  3APC A;  3MV3 B;  5FJY A;  1QNF A;  4NRH B;  4ANX A;  1UW4 B;  2FUL A;  4AM9 A;  3ULQ A;  5BV1 A;  4O1O A;  3IKO B;  1K1B A;  3OAW A;  5LCW J;  1IHG A;  1HX8 A;  4HLL A;  3UKR G;  1S70 B;  5G05 J;  2VSN A;  2VTB A;  5J08 A;  1FVF A;  5C1D A;  3W9G A;  3ASN E;  4I1O B;  4G8L A;  3APD A;  1TNB A;  3OXG A;  3D9L A;  3AAA C;  3URZ A;  5T8I A;  3CKC A;  1NI1 A;  3HXB A;  2X6H A;  1FT2 A;  4OVU A;  3LPZ A;  2J07 A;  1TN6 A;  1MQS A;  3FUL A;  4LER A;  2WB2 A;  1HE8 A;  2I2O A;  5AJD A;  3JUE A;  3ASO E;  3MJW A;  5EX3 A;  4UWG A;  3P2B A;  3C98 A;  1Z3Y A;  3L13 A;  3UX4 A;  3D9N A;  4RLY A;  5AEN A;  1SZA A;  4K0R A;  1UN8 A;  2P58 C;  4IN3 B;  3ESL A;  1UN9 A;  2WQ6 A;  4J8E A;  3E4B A;  4CYM D;  4YVO A;  3FEX A;  3S7J A;  2RFM A;  3T8K A;  4ZFH A;  3MKR A;  2I9C A;  1TNU A;  5BV0 A;  4HNA D;  1DCE A;  1BD8 A;  2VTB B;  1H6P A;  2GRL A;  2WM9 A;  1BLX B;  4BX8 A;  2XZT G;  4GZ3 A;  5JMN D;  2IO3 C;  3ZXP A;  3ZFW A;  3S7D A;  5ITZ F;  2R02 A;  1YA0 A;  4FA6 A;  4HRN A;  4JA9 A;  1EPU A;  1A5E A;  1N0R A;  2X3M A;  2BKK B;  1IYG A;  3AS5 A;  4FP7 A;  5G55 A;  2OOE A;  2XEN A;  1IQU A;  3DWL G;  3QNK A;  4U8V D;  3ZU7 B;  1KT1 A;  2BED A;  5T4Y A;  3R9M A;  2R17 C;  3IBE A;  5JJ7 A;  2AW6 A;  3AG4 E;  3FTU A;  2P9I G;  4GAA A;  3CVU A;  1JCS A;  4X8Q A;  4EPZ A;  4L7T A;  4CDM A;  3UQ3 A;  5BUZ A;  3TXN A;  1X5B A;  4A55 A;  3ZVV A;  3FUF A;  4BT9 A;  2I1J A;  2IO2 C;  3BUA A;  1HS6 A;  3TL5 A;  1N4R A;  3FU6 A;  3IHV A;  2JEK A;  1OXJ A;  1QYM A;  4FHK A;  3C72 A;  3GZ2 A;  4JL0 A;  1HG2 A;  3X2Q E;  3CST A;  2L6B A;  3RAU A;  4EQF A;  2LUH A;  3ABL E;  5EDS A;  2IEJ A;  3GYZ A;  4MS6 A;  2GRQ B;  3C3O A;  3D9P A;  2F8Y A;  5G04 J;  4CDN A;  1NZN A;  2RG8 A;  3UT8 A;  3E30 A;  5FIN A;  4J6I A;  3OXF A;  1N11 A;  3EJN A;  3UTM A;  2HM8 A;  4Z68 A;  3G2W A;  1HO8 A;  4AJW A;  2WXP A;  4DI4 A;  1SZ9 A;  1PY1 A;  3RO3 A;  4ATZ D;  3EU5 A;  3BU8 A;  3CGH A;  4WWO A;  4JPS A;  2KAT A;  3TWT A;  4F1S A;  4G25 A;  1LTX A;  4EZL A;  3CVN A;  4JHJ A;  5ARF A;  5FQ6 A;  3U66 A;  3EUV A;  2R05 A;  4CCA A;  4F7A A;  3MV2 B;  3HRA A;  3I5P A;  1O5M A;  4DLQ A;  2FO7 A;  4F1P A;  2P9K G;  3PDN A;  4M7C A;  3V2X A;  4DLO A;  4A3V A;  2CHX A;  4JEU A;  1S63 A;  2QZA A;  3MYV A;  1G3N B;  5EID A;  4OAV B;  1H6K A;  1TNO A;  4LEU A;  4MKT A;  4D10 C;  4CGW A;  3BEE A;  2A5U A;  3AG3 E;  4GZ6 A;  1Y8M A;  1ZB1 A;  2GRR B;  3CHO A;  3BQO A;  5CHE E;  2XCB A;  4AIF A;  3PVL A;  4JB8 P;  4AY5 A;  3QKY A;  3I3N A;  3TG4 A;  3Q49 B;  4UI9 K;  3UT4 A;  5CRU A;  5HI7 A;  1HFA A;  1PC2 A;  5D0Q D;  2DZO A;  1OUV A;  4UUC A;  2B6C A;  1Y6I A;  5JA4 D;  3CHQ A;  2ETA A;  1N95 A;  2PL2 A;  2KXP C;  3Q79 A;  2MOW A;  3ENE A;  1TNZ A;  5IY5 E;  3SY2 A;  3QWP A;  4Y6C A;  4AXH A;  5ENT D;  3ZYK A;  3MA5 A;  2E2E A;  3PEV B;  2KCV A;  4WWN A;  3AG1 E;  5CRV A;  5C2Y A;  4APF A;  3SBS A;  1BI8 B;  3TWX A;  3V2O A;  3CHP A;  1NA0 A;  4JXT A;  4FJZ A;  2X6K A;  3K9I A;  4GCO A;  4GZ5 A;  5FZR A;  4BER A;  4G23 A;  2VSX E;  3ASD A;  4FLB A;  5BPP A;  4UQX A;  1UJJ A;  4F53 A;  1N94 A;  3J5Q B;  3PZ4 A;  1H2T C;  3PZ3 A;  4CGV A;  4E6H A;  2GRP B;  1Z5S C;  4UI9 J;  5LCW C;  4GB9 A;  3AG2 E;  4N39 A;  5AAR A;  4ZHB A;  4EZK A;  5G05 C;  4I1A A;  4U0Z A;  1V54 E;  5KJN A;  2V0P A;  2VGE A;  3DBS A;  1NL4 A;  3IHY A;  3FY4 A;  3UM0 A;  5D66 A;  3PNT B;  1E7U A;  4OVV A;  2V5Q C;  3D3M A;  2YNQ A;  2LNI A;  3B95 A;  1NP7 A;  3KS2 A;  4APO A;  4TXQ A;  3SGH A;  5KCM A;  5E76 A;  2JLB A;  4XKC A;  1KPS B;  3FUD A;  5DBK A;  2H6F A;  2CHW A;  1E8Z A;  1MX6 A;  2EIL E;  5ANL A;  5AQB A;  4AY6 A;  4B8A A;  2B0O E;  1UJK A;  3RKV A;  3LEW A;  1TJF A;  4AVX A;  3SO8 A;  1HG5 A;  5FQ8 A;  3JQ1 A;  1HU3 A;  3QWV A;  4HOU A;  2NYJ A;  4A1G A;  2FBN A; 
#chains in the Genus database with same CATH homology
 1E96 B;  3ASF A;  3JCK C;  5EX3 A;  4UWG A;  3P2B A;  2WQ7 A;  3C98 A;  1Z3Y A;  4NAC A;  4UQY A;  3BG1 B;  3L13 A;  3UX4 A;  3D9N A;  3SZ7 A;  5AEN A;  1SZA A;  4JA7 A;  1A17 A;  4P29 A;  3IV0 A;  4KYO B;  1E90 A;  5CCM A;  5T3R A;  2X6F A;  4K0R A;  1UN8 A;  3AS4 A;  2P58 C;  4DJA A;  3EDT B;  3Q5M A;  4L2Y A;  3MCX A;  4XI9 A;  4AOF A;  3PH0 C;  1FCH A;  2BUG A;  2QY7 A;  2XCC A;  4IN3 B;  3ESL A;  3PZD A;  1UN9 A;  4FC8 A;  1FVH A;  2WQ6 A;  3FDH A;  4J8E A;  1H2V C;  2LAH A;  3T8M A;  3E4B A;  4UWF A;  3APF A;  4YVO A;  3FEX A;  3S7J A;  2WXM A;  4BTB A;  3ZHE B;  3MKR A;  2I9C A;  3ONL A;  5EX0 A;  5BV0 A;  4N2S A;  4HOQ A;  4UI9 C;  4PUC A;  2VTB B;  4GCN A;  4W9R A;  2GRL A;  2WM9 A;  2XEV A;  1HF8 A;  4BX8 A;  2AWI A;  2QFC A;  1NA3 A;  2PZI A;  3N71 A;  4BTA A;  4GZ3 A;  5A6C A;  3MX3 A;  3TJP A;  3AS8 A;  1TJC A;  3RRM B;  3QOU A;  3L54 A;  2CG2 A;  5FT9 A;  3BG0 B;  2ION A;  3FUH A;  4YVQ C;  2WQH A;  3ZFW A;  2WXH A;  4BT8 A;  4GA1 A;  4B8C B;  3S7D A;  4GA0 A;  2UY1 B;  2HO1 A;  4H7Y A;  1SQM A;  2VYI A;  1TEZ A;  1YA0 A;  3ASG A;  4ILH B;  4ME2 A;  4WWP A;  4GZC A;  5FWQ A;  4G24 A;  4FA6 A;  3U3W A;  2KM4 A;  3GZ1 A;  3B13 A;  3T5V A;  4GML A;  4BWR A;  4DK5 A;  4JA9 A;  1EPU A;  2ZU6 B;  3NZU A;  4TUU A;  2X3M A;  3ZRH A;  4I6G A;  2KCL A;  4KVO A;  3PUK A;  2Y4U A;  1IYG A;  4J8D A;  4UWH A;  4OYS A;  3AS5 A;  3KEZ A;  4FP7 A;  4BFR A;  2XGS A;  3FU0 A;  4KZC A;  4N3A A;  5G55 A;  5ANR A;  4EBA A;  3ZEF A;  3CVX A;  2OOE A;  2VGX A;  2IF4 A;  1IQU A;  3GZS A;  3L16 A;  3QNK A;  3KAE A;  3PEU B;  2DIW A;  3B7R L;  1QQE A;  3MGB A;  2Y4T A;  1KT1 A;  2EQX A;  4NUR A;  4WNG A;  5KJL A;  2V8S E;  3U9W A;  3FTZ A;  4Q69 A;  1ZU2 A;  4MLP A;  3HVE B;  5T4Y A;  2R17 C;  3IBE A;  2WXK A;  3U64 A;  2AW6 A;  5JJ7 A;  3FTV A;  4XX5 A;  2OVB A;  4BY6 A;  3FTU A;  4GU5 A;  4CDR A;  3Q15 A;  2IOS A;  5BT1 A;  4GAA A;  4UQZ A;  4I2Z A;  4U07 A;  3FUN A;  3CVU A;  4EPZ A;  4L7T A;  4TV3 A;  1BPO A;  5KJK A;  4CDM A;  3UQ3 A;  5BUZ A;  2IFU A;  3D9O A;  1VDY A;  3TXN A;  1X5B A;  5AIJ A;  4A55 A;  2YIN A;  2CFZ A;  2FI7 A;  3LVQ E;  3ZVV A;  3FH7 A;  2WXQ A;  5FZS A;  3FU3 A;  3LYA A;  4KZ0 A;  3FUF A;  4BT9 A;  2I1J A;  2L9B A;  3CVW A;  4RVB A;  3VTY A;  2DCP A;  3S2A A;  2HYZ A;  1UG3 A;  4KXK B;  1HS6 A;  3FFL A;  3TL5 A;  4I17 A;  3LY9 A;  1S0P A;  4FJY A;  4O6F A;  4B0Z A;  4WAF A;  4K03 A;  4FLH A;  2AXU A;  2GGF A;  3FU6 A;  2JEK A;  3IHV A;  4GA2 A;  4U8H A;  3TXM A;  4AEZ C;  2L6J A;  1IQR A;  3JQ0 A;  4FHK A;  3QC1 A;  4B89 A;  3SI5 A;  3GZ2 A;  4JL0 A;  2PM7 A;  1HG2 A;  3R9A B;  4FAD A;  4I1M A;  3CST A;  2WXG A;  3G2V A;  2XGM A;  2NSZ A;  4Q94 A;  3MKQ A;  3S7F A;  4ABN A;  5LX8 A;  3PRZ A;  4IYP A;  4EQF A;  3HHM A;  2J09 A;  1HH8 A;  2PQR A;  3LY8 A;  5JHA A;  2ILR A;  2AXZ A;  3KD7 A;  3HDX A;  3FUM A;  4HLE A;  4J8F A;  2J49 A;  4WND A;  5EDS A;  4U04 A;  1JWG A;  2E0I A;  3L17 A;  2XPZ A;  1QZ2 A;  3EIQ C;  3GYZ A;  2XRZ A;  2L0T B;  4MS6 A;  2A4Z A;  2CG3 A;  3HYM B;  4PS8 A;  3TAX A;  3D9P A;  4C9B B;  3FHE A;  3B7T A;  2X38 A;  4RSY A;  5G04 J;  3LKU A;  4A3T A;  4CDN A;  2CFU A;  3L22 A;  4RG9 A;  3LCA A;  2WXO A;  1OWL A;  3QK0 A;  1Z3X A;  4G11 A;  2NXP A;  3DPD A;  4MRU A;  5A23 A;  2VSO E;  3MZL B;  4UWK A;  1ELK A;  1JPL A;  1INZ A;  3D9J A;  4QFV A;  3QB2 A;  2V4L A;  1NZN A;  2RG8 A;  2VGX B;  4IUL A;  2FF4 A;  2I6H A;  3LVR E;  4J6I A;  4WUY A;  3UT8 A;  4E85 A;  3AU5 A;  3OXF A;  5BNW A;  3CV0 A;  3RJV A;  3SNX A;  3EJN A;  1N52 A;  4GMJ A;  3ZYQ A;  4ATG A;  2HM8 A;  1JUQ A;  1DNP A;  4IRU A;  3G2W A;  1HO8 A;  3RU0 A;  4AJW A;  3RIB A;  2WXP A;  4DI4 A;  5ENN A;  3ZPJ A;  4XKB A;  1WY6 A;  4I6E A;  5JJ6 A;  3S7B A;  1MHQ A;  4U0U A;  1SZ9 A;  3O4Z A;  1PY1 A;  2XGO A;  3L6A A;  3RO3 A;  2VGY A;  1U3D A;  3ESK A;  3LDZ A;  4G26 A;  2DBA A;  4JHK A;  2IOL A;  3ZW3 A;  3OTN A;  3VTX A;  4GYO A;  2KZT A;  2YQ8 A;  3CGH A;  4WWO A;  4JPS A;  4ACK A;  2XHE A;  4HOR A;  1ELW A;  2KAT A;  4JHR A;  2OV8 A;  4I9C A;  1P5Q A;  4I6J A;  4HFG A;  4G25 A;  3RRN B;  3ZYL A;  4F1S A;  3ONK A;  3CHR A;  1XNF A;  4EZL A;  1XGW A;  3FH8 A;  4XZ4 A;  4L1B A;  3QAR A;  5BW8 C;  4I43 A;  5A7D B;  3CVN A;  4Y6W A;  4JHJ A;  4GYY A;  1HZ4 A;  5ARF A;  3AU4 A;  2UWJ G;  1E8Y A;  1OWM A;  4L2L A;  5FQ6 A;  3U66 A;  2J08 A;  3ML9 A;  1OWO A;  5KJM A;  4CCA A;  3VLD A;  1OWP A;  2C2L A;  4F7A A;  3MV2 B;  5FQ4 A;  4WNE A;  3I5P A;  4G1T A;  3UT7 A;  3MKQ B;  4H7X A;  4DLQ A;  2FO7 A;  2J9Q A;  4J0U A;  4JEH A;  3LS8 A;  2VJ8 A;  2IJG X;  4LRZ A;  3FTY A;  4BX9 A;  3PDN A;  4V3I A;  2WXI A;  5JHB A;  4YND A;  3QWW A;  3D9M A;  2WMO A;  2WXR A;  4TRQ A;  4DLO A;  2IU1 A;  2MRI A;  4A3V A;  5DIZ A;  2CHX A;  2WXL A;  1KT0 A;  4JEU A;  3PS6 A;  3FTS A;  3MYV A;  4JZY A;  2M63 A;  3RRU A;  2WMN A;  4BSX A;  3OXL A;  5CMY A;  1N54 A;  1H6K A;  4CGW A;  4HS2 A;  4LEU A;  4MKT A;  4D10 C;  3B7U X;  1JWF A;  1EF1 C;  2AVP A;  3BEE A;  3WXX A;  2A5U A;  4EZJ A;  5CCL A;  2HR2 A;  4PS3 A;  2YHE A;  3ASH A;  4GZ6 A;  2XQ0 A;  3UUX A;  3PUJ A;  1Y8M A;  3CHS A;  2RD0 A;  4RG6 A;  2J4D A;  2LSU A;  3CHO A;  4U0S A;  4I9E A;  5LP0 A;  3ZN3 A;  1Z6T A;  3CQC B;  4G2V A;  3CLJ A;  3EHM A;  5AYW D;  5CHE E;  4WNF A;  2R59 A;  2XCB A;  4ILI A;  2R5S A;  3D9I A;  3JYS A;  3ZGQ A;  2BF0 X;  3PVL A;  3T5X A;  1WAO 1;  4AIF A;  2LAI A;  3I3N A;  3QKY A;  3ZIM A;  2AXV A;  4AY5 A;  3B7S A;  5G04 C;  3TG4 A;  2X6J A;  3FTW A;  3MEK A;  1EDU A;  3LXU X;  4HOS A;  4I2W A;  3QJZ A;  3Q49 B;  4UI9 K;  2IQC A;  1H0A A;  3U4T A;  2C0M A;  3RO2 A;  5HI7 A;  3UT4 A;  4KVM A;  2KZT B;  3CVY A;  3FUK A;  4PS7 A;  2FEZ A;  1HFA A;  5M72 A;  1PC2 A;  5D0Q D;  3SHF A;  4CRW A;  4ACL A;  1OUV A;  2L0I A;  1Y6I A;  3EHN A;  3FUJ A;  4F3V A;  3CHQ A;  2OVF A;  1H2U A;  4N3B A;  3CVL A;  3CK9 A;  2PL2 A;  4ANU A;  1KLX A;  4JVS A;  2Q7F A;  3CSF A;  3CEQ A;  4GZD A;  4DPR A;  2PQN A;  3O48 A;  2MOW A;  5HQ8 A;  2WXF A;  2GW1 A;  2WPV A;  2MHK A;  2XPY A;  3ENE A;  5FZQ A;  4GPK A;  3G2U A;  4CT0 A;  5AJD A;  4N5C A;  5EKQ D;  3QWP A;  4Y6C A;  3Q4A B;  3JUI A;  4AXH A;  3FUE A;  4FUL A;  3HVE A;  3ZYK A;  3MA5 A;  2E2E A;  3D9K A;  3PEV B;  4DI3 A;  2VSY A;  3QDN A;  4GYW A;  3HIZ A;  4AP2 A;  2KCV A;  4WWN A;  5E75 A;  3PE3 A;  3NQP A;  4HVB A;  5C2Y A;  3FTX A;  4APF A;  3SBS A;  4CT4 A;  2J4B A;  1GW6 A;  4HXI A;  3SD5 A;  3ZYM A;  3R7R A;  4ILG A;  3IEG A;  5J90 A;  1LF8 A;  3CHP A;  4KMO A;  1NA0 A;  4JXT A;  4A1S A;  4FJZ A;  2X6K A;  3K9I A;  3P1U A;  4PDX A;  1EYH A;  5AJL A;  4GCO A;  4M3O A;  3GW4 A;  4R7L A;  3UPV A;  2GRM A;  4B94 A;  3FUI A;  4GZ5 A;  3SFZ A;  4N2Q A;  2NC9 A;  4C0M A;  1E8W A;  5FZR A;  2WXN A;  3Q47 B;  2PM6 A;  3QAQ A;  4G23 A;  4ANV A;  4EEC A;  4AV7 A;  5LOZ A;  2LO6 A;  4JW1 A;  2VSX E;  3CR3 A;  4KBQ A;  3ASD A;  3SBT B;  5JJT A;  4FLB A;  3CKB A;  3R7Q A;  5BPP A;  3VLF A;  2C0L A;  1UJJ A;  2OND A;  3LJ3 A;  4L23 A;  1HXI A;  4N3C A;  4UQX A;  1H2T C;  4F53 A;  2CHZ A;  2BTD A;  1L5J A;  4XIF A;  1H19 A;  4CGV A;  1DVP A;  3ML8 A;  3LY7 A;  4LCT A;  4URK A;  4E6H A;  3SF4 A;  4FHJ A;  5D0O D;  2X6I A;  1B89 A;  2V5F A;  4HOT A;  4UI9 J;  5LCW C;  2LSV A;  4GB9 A;  3APC A;  4N39 A;  3TG5 A;  4EZK A;  5G05 C;  4NQ0 A;  3TGO A;  4I1A A;  3MV3 B;  4KT6 B;  4U0Z A;  5FJY A;  2VQ2 A;  4U63 A;  1QNF A;  2KC7 A;  2XPI A;  1UW4 B;  4NRH B;  3VLE A;  4ANX A;  2FUL A;  3CVQ A;  5LFA A;  4C0E A;  4AM9 A;  1ELR A;  1WM5 A;  5KJN A;  1E7V A;  1U3C A;  2V0P A;  3ULQ A;  5BV1 A;  1ZBP A;  3I4G A;  3IKO B;  3DBS A;  3OAW A;  4Q96 A;  3IHY A;  5G2N A;  3ZHE A;  3FY4 A;  5LCW J;  1OWN A;  3PNT B;  1IHG A;  1HX8 A;  3CVP A;  1E7U A;  3EIJ A;  3PE4 A;  4FU3 A;  4OVV A;  5ARG A;  3D3M A;  3CIA A;  3L08 A;  2YNQ A;  2LNI A;  5G05 J;  3PRE A;  4XI0 A;  2VSN A;  2VTB A;  1NP7 A;  3ZXS A;  5J08 A;  4CEM A;  1FVF A;  2Y3A A;  4JC8 A;  3KS2 A;  4PH4 B;  4APO A;  5C1D A;  3CQG B;  3SGH A;  5FQ7 A;  3I4R B;  3NZS A;  5KCM A;  3PNL B;  5E76 A;  3CHM A;  3CK8 A;  1W3B A;  4J8S A;  4LUN U;  3FU5 A;  2JLB A;  4XKC A;  1E8X A;  4XE0 A;  4I1O B;  3FH5 A;  1PAQ A;  3FWV A;  3APD A;  3RK6 A;  2YHC A;  3FUD A;  5DBK A;  3CK7 A;  3OXG A;  3D9L A;  4UWL A;  2CHW A;  3FP3 A;  2WXJ A;  2UY1 A;  1E8Z A;  5ANL A;  3G2S A;  4EBA G;  3URZ A;  5T8I A;  4AY6 A;  4B8A A;  5FTP A;  3UMV A;  1UJK A;  3CKC A;  2WVI A;  3RKV A;  3FEY A;  4ANW A;  3LEW A;  2X6H A;  1TJF A;  3G2T A;  4OVU A;  4AVX A;  3CVV A;  3LPZ A;  2J07 A;  1HG5 A;  2I1K A;  3JQ1 A;  5FQ8 A;  1HU3 A;  1MQS A;  2XRY A;  3FUL A;  3QWV A;  4LER A;  2WB2 A;  3NF1 A;  4HOU A;  1HE8 A;  2I2O A;  2KCK A;  5CMW A;  4A1G A;  2FBN A;  3MJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...