2MHRA

Structure of myohemerythrin in the azidomet state at 1.7(slash)1.3 angstroms resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
118
structure length
118
Chain Sequence
b'GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWLVNHIKGTDFKYKGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOHEMERYTHRIN
publication title Structure of myohemerythrin in the azidomet state at 1.7/1.3 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen binding
total genus 49
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1987-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2mhrA00
1A7DA 3AGTA 4XPYA 1A7EA 1HMOA 2HMQA 1I4YA 2MHRA 2HMZA 2AWCA 4XPXA 4XPWA 3AGUA 1HMDA 3WAQA 3WHNA 4XQ1A 1I4ZA 2AVKA 2AWYA
chains in the Genus database with same CATH superfamily
2WB7A 1E83A 1OQCA 3A9CA 2H7VC 2L6HA 2P1AA 2CNWD 3POVA 4JURI 4EBJA 2QNLA 2Y3HA 5L0GA 1ZYRF 2LK4A 4LDKA 1GM5A 3R2PA 2WZFA 3MYIA 2I8BA 2L81A 2VH3A 3GORA 3IEEA 1NFOA 2ZPAA 3V5ZA 3K33A 1LKXA 3TQOA 4RBNA 1A7VA 5B3SC 2Y3BA 4JTDB 4GEHA 1VOMA 2XL6A 3TD7A 4AX2A 1C02A 2EIKC 5AC5A 2R7QA 5E33A 1HY5A 2KSFA 3SNHA 4U5HA 3UNGC 4LDQA 4I1OB 3RQEA 3X2QC 4N4WA 1OR3A 3HJCA 3N24A 2NSGA 4CSAC 2ASRA 1HE1A 4PR9A 4XPYA 2XLVA 3N0TA 4RDAA 1D1BA 2IXNA 1YARO 4JZAA 1HW2A 3FAPB 1RXQA 256BA 4MVRA 2NG1A 5BQIA 3A11A 2NUPA 3RVZA 3S84A 4DVYP 1T6QA 3ABMC 4PJJA 4YL0A 1F1MA 4CSAA 3JSEO 3QTHA 4RD9A 5AGFA 1ST6A 3C62A 1VYIA 1VMAA 2LP4A 2OKUA 1WASA 3OWTA 4MVUA 4P9FA 2X0CA 3HKKA 1QSPA 1TR2A 4W8PA 3PDMP 1U0BB 4JW1A 3DM5A 2HSQA 2UUIA 4LLEA 2DGJA 1U6HA 1IW7F 2P7VA 2EPKX 1WTYA 3GM1A 3IQTA 3LJBA 3QW1A 4XWJA 4YJWA 2ZXPA 3ECSA 4OINF 4QDLA 3VRCA 2KC3A 3MLGA 3ZWIA 1RKEA 1APCA 4CS8C 1XZPA 3LLIA 2LFDA 2EIJC 1NU7D 1V4AA 3LNMB 3EH2A 3J06A 4HE8D 5JUAA 3RFYA 1LPEA 4PFOA 5A69A 1ORJA 1ZW3A 2B0HA 2QLAA 3DAFA 4O6YA 2QUPA 2Y3DA 3AG3C 3MBGA 2WZGA 2R7TA 4G78A 4U5CE 3VM6A 2EPLX 3G4ZA 3LAYA 4YN0B 1NG1A 3ZC4A 1FNTc 1M57C 1SZIA 1TWHA 3AG2C 2GAQA 3EQLF 3US6A 4ZLDA 3HLZA 1A0BA 4YT8A 1B68A 4JIOA 3SP1A 3AG4C 2HV6A 4MW3A 3W2WA 4NCQA 3DKAA 1MMGA 4Z9JA 3B0VC 3TOLA 4AE4A 3KKBA 4B6IA 4N6CA 2OQMA 4Q4ZF 1OKKA 3ZSUA 2OJED 3FMSA 5KYUA 1G5ZA 1YYXA 2HS5A 3JSZA 1T9KA 3E9VA 5A6BD 2E87A 3SEOA 5COGA 3NYJA 1SYQA 5A6KA 3DE9A 4U5FE 3I5PA 3MX3A 2EINC 3I5QA 2GFHA 2LFFA 3GEEA 2R7WA 4FWVA 3LUTB 2J45A 2VB6A 4OIPF 1MNEA 1WN0A 3KL4A 1VLTA 4JTAB 3UMIA 1CGME 3GEHA 4O7GA 1D1CA 1RKEB 3U9MA 1HMDA 5F5HA 3TJ6A 1JOGA 1JPJA 3NKEA 4YL1A 1GQAA 4ULVA 1Q0KA 3PCVA 3RQGA 1Z7Qc 1V74B 2IBFA 4EBBA 3QZCA 4U5BE 4MVOA 3GEIA 2OU6A 1FFTC 2G62A 2PF4E 3C8GB 3U2MA 1E86A 2HMQA 3NG1A 4DRIB 3ASOC 1VLSA 3EGDA 2XL8A 4JCZA 2CCYA 4N06A 4U5GA 1G8XA 4CDAA 1M2VA 4KBLA 1BR4A 4C3EA 2Q9AA 4O79A 1H9GA 3EZHA 1S05A 4MW8A 5L3QA 2IXPA 2M64A 2EPNA 4M63A 5E3CA 4WGZA 3JT1A 1Z63A 4NQFA 3PMRA 4AE4B 4MTOA 2HFIA 2YL3A 4DVZA 1ZHYA 2JD3A 3AGUA 5F28E 3EG9B 1CPRA 3DD7A 4DBQA 3WHNA 3VYWA 5L0FA 2MYSA 2Q3TA 2QY9A 1ZHZA 3MYFA 1CGOA 2UUHA 2R25A 3O6XA 3B0PA 4GQHA 2M4EA 3ATPA 2R7RA 1R5ID 1Z6AA 3S28A 3F47A 4U5DE 4AL1A 1ZU5A 2HUJA 1L7CA 2H7BA 2NSFA 3T4RA 4L6RA 1RJ9A 3U0CA 2PNOA 4A2NB 3B0UX 1D1AA 2XM0A 5BQGA 2GDCA 1VK5A 2HMZA 1DOWA 2YL7A 3IQ5A 5T3TA 1L3PA 2JX0A 4IGGA 2VCAA 5DS5A 3H65A 2XLEA 3IQCA 2P6VA 3CEXA 4JC7A 2KK1A 2ZXWC 1YYJA 3JTLO 5JSLA 3RKOF 4KI2A 3NDBB 1K40A 5JS5A 2VCBA 4C3BA 1BBHA 2WVNA 5B1BC 1FFHA 3T9OA 3N2ZB 5DS4A 3NYMA 5JRAA 2J0XA 2KYHA 1GGQA 2J7PA 3JYHA 1BR1A 3DWWA 5B1AC 4PACA 4ULWA 3EGDB 5EGYA 2PX0A 2XXAB 2YLGA 3TOMA 1Z5ZA 1M2VB 1TKNA 5TJ5E 4EHPA 5DVWA 4OIOF 1CGNA 2CYDA 4CIHA 2B0JA 1OW7A 4OIRF 3RQFA 4Q7CA 3ZVRA 5KYWB 2FGYA 4PJMA 5EHHA 3AGTA 1T6UA 1YZCA 2X51A 3C8GD 4N6HA 1E2XA 2Y39A 3FAJA 2QTVA 4JCHA 3O10A 3SZRA 3EPVA 4C3DA 5JT4A 3EGXA 4X0RA 3I4UA 1TFOB 4YT4A 4IAQA 4J7YA 3NMKA 4OD4A 1S7ZA 2J8WA 2HZ8A 4R32A 2G3KA 3R7CA 2GA0A 4C7OA 3TULA 2R05A 4U9EA 1A41A 2J0WA 2R7UA 4BJ5A 4BJ6C 1G4US 2A68F 4MVSA 3S27A 4KNVA 1C17M 3DI5A 4O6MA 4CS7A 4IAOA 4FESA 5DQTA 3FVYA 5BQHA 4CDYA 2A0UA 4WGYA 5KYNA 1YLMA 1R4TA 2PP4A 4PFPA 1ZHXA 2ZXRA 2VASA 4K0DA 1RCPA 2BL2A 3ZDLA 5A6JA 3B71A 1Q0GA 4NTAA 2Q7RA 1A7EA 3GWLA 3T6GB 1NZEA 1YA7O 1LI7A 3DE8A 3K1HA 4BJ6A 1H6GA 5F5FA 2CDQA 2F22A 2XLHA 4Q5SF 3G4XA 1D0XA 4NY3A 1UFBA 4BG0A 3FXHA 1MMDA 1TWAA 4XEKA 2CNWA 3EFOA 3KMIA 1O5HA 2OG2A 3K1IC 3NRHA 4JJGA 1M56C 3K6BA 1PCXA 4IJJA 3EH1A 4AK9A 4EKWA 5L3VA 3C63A 4ONSA 5E2QA 3V5XA 5L0DA 5EK0A 3U9JA 4AL0A 2C03A 4MTGA 3U3BA 1K04A 3CZ6A 3CSKA 1M2OA 3ABLC 3C7JA 2EPMX 1J8MF 3K7DA 4I1MA 1Y4CA 3C8ZA 3EGXB 4DXWA 2DYRC 4E7SA 5KYXA 2AVKA 3K1IA 2W4BA 4P9TA 3W8IA 5L0IA 3L0IA 2J9BA 1SR2A 3KYIA 3SXMA 3NYLA 2NUPB 4H54A 5DQZA 4A4AA 2EPOA 3DJNB 4MTFA 4ER9A 2O9XA 3JZ0A 2Y3GA 5IY5C 2FFHA 2YKZA 1W2WA 1FMWA 1G4WR 1T01A 1ZHWA 2LCHA 2P61A 2YHSA 4FAPB 1FR0A 1WWPA 2FAPB 3L8JA 3NKDA 3NMIA 4PJNA 4DJ9A 3RF3A 1TWGA 2AWCA 2WVQA 1LE2A 2IXOA 2L6FA 3QW0A 2R7VA 3WG7C 4YWQA 3RYLA 3EZIA 1BR2A 2R02A 2VC9A 3Q6NA 1JAFA 1OCOC 3HNLA 4QI0A 1MMAA 2DYSC 2Q00A 3KYJA 3SYNA 2XLWA 1DOVA 3GM3A 4JE9A 3Q7GA 2EIMC 4E7ZA 1EA8A 5DS6A 4BEMJ 2R9RB 2AWYA 4DOZA 1O3UA 3TJ5A 2V3CC 1KTMA 3H2UA 3QMKA 3FOOA 3O55A 1WOLA 1KU2A 1HMOA 3AQBA 4IARA 2RSEB 2MHRA 1OXKA 1EKYA 5HSWA 1VB5A 4JEBA 2H8AA 1D0ZA 3V7OA 3IPMO 1V55C 5FCLA 2YL0A 3LLKA 3QVYA 5K0IA 4MS2A 4NTBA 1VTMP 2L6GA 1QQ3A 2A6HF 1J8YF 2XLDA 3M4CA 3K66A 3DJUB 5COFA 5JLIA 3OA1A 4WJ0A 1LE4A 4CJGA 5KYUB 3V5YA 1RMVA 2XM4A 1JMWA 1WGWA 4K1OA 4YL3A 3VF0A 2CGEA 5COMA 3S9OA 1QLEC 2W9YA 3GM2A 2R7OA 3FOPA 4CS9C 3G50A 1GS9A 1OCCC 3CAXA 3Q6MA 4H4KC 1E84A 3EHMA 4EWCA 2YRFA 1YDIA 1QPUA 2OJQA 3KPHA 2R7SA 3U2LA 3VAYA 4EIYA 1V54C 1Z23A 2H7OA 2J46A 1KNYA 3ITFA 1LS4A 3O39A 3AQCA 5A6BA 2ICWG 1AEPA 3L34A 2BE5F 4IRUA 2KJGA 1ZU4A 1SMYF 2KNHA 2KQ9A 2OEXA 4J30B 4YT2A 2YEVA 3GWNA 1OW8A 4LACB 1Z3IX 4UDVA 4ZLCA 4C7OB 4MVQA 3BEHA 3TK0A 5L0CA 1NLXA 3UGOA 1WATA 2YVKA 3S90A 2C04A 3CQZA 3W4YA 2WZLA 1PV3A 2XSEA 2PX3A 5L0JA 4OIQF 4BJTA 2YZSA 4F4BA 2J9UA 2PFDA 2JPUA 2A69F 2Y69C 4MQ9F 1QKRA 1YJGA 4EUKB 2ZD9A 3QVZA 4OD5A 1FAPB 1JRAA 1MNDA 1TWCA 1I5NA 1H7IA 2W45A 3W2VA 3DAGA 4BJ5C 3H2VA 1XZQA 5L0HA 2IM8A 2IYLD 2XRHA 3JYYA 3LEOA 3NMJA 4WABA 1MQVA 2XL4A 3OEOA 1IZMA 4XPXA 3AJMA 1Q0FA 4G7OF 3LS0A 1YVIA 3W8HA 1C03A 4J32B 5B3IA 4D4XA 5FZTA 4IB4A 3PHF2 1EI7A 3WAQA 3DMDA 1OKKD 3SXYA 4XEVA 2YLIA 3E70C 4XQ1A 4W8KA 1RJ9B 1CPQA 3F46A 2LIGA 2MWQA 3EJNA 4JKVA 5KYYA 4O6NA 1UG7A 1QZXA 1N1CA 1T6IA 1TFKB 1JR8A 4PK4A 3T6JA 2I15A 4ANJA 1OCRC 2QE9A 1LM3B 2DI3A 3AOUA 4P6IC 2OCCC 3LNRA 1K05A 2A1DD 2Z15A 3HTKC 4MVZA 2NUTA 3UMKA 4LERA 2YL1A 4CJOA 3JRTA 4BEJA 4I3MA 2VCCA 2J9VA 1BZ4A 1YA9A 4K7BA 5BUOA 2DB4A 5HV9A 3U8VA 3HNJA 2L7AA 2EILC 3RH3A 2BC5A 4MVMA 3T6BA 3ABKC 1QVXA 4LLCA 1SF8A 3EHNA 3RW0A 2PBEA 1M6TA 5CI9A 4YK5A 1ZZPA 1RKCA 2J9WA 3BRJA 1ZW2A 3X1OA 2HSBA 4HFFB 3U8PA 1HE9A 2P0NA 1OCZC 3JCUQ 1HW1A 2XLOA 3JRMO 2D4UA 3ASNC 5JP7A 5DLJA 4E17A 1E85A 3DXJF 2LSEA 3GANA 3HNKA 5AC4A 1OR2A 5JVEA 4I44A 1MMNA 1NSGB 2ETSA 3C18A 2IOQA 4D4NA 4G7HF 3FDQA 1D0YA 3M15A 1I4YA 3AG1C 1EQ1A 4BPMA 1H9TA 4DBRA 4PJLA 1TQGA 2YLDA 2XS8A 4JEAA 2WVOA 2TMVP 2HKVA 4FX5A 4LDRA 4JJFA 4MNDA 4EBKA 3SXKA 1NBBA 3C8GA 1YZAA 4XPWA 2R7XA 2CW0F 3UR3C 3ZG1A 4U9DA 2NPUA 2RD9A 5KYYB 3LEVA 2AP3A 2ZXOA 2W4MA 4CS8A 2D5RB 4BJ1A 4IWBA 3LESA 4QI2A 5CIVA 3UGPA 1FTSA 2NUTB 4CDVA 3RVYA 4E18A 3GODA 3EG9A 4XLNF 3ZIBA 4HFKB 4G7ZF 1BDJB 1ORSC 1ORYA 1LI5A 2HJMA 2OEVA 3IHUA 3EFOB 4Z9HA 1PD1A 3L8IA 2AU5A 2YQYA 1Y6DA 4HEAJ 2KW3C 1AVOB 1Q0MA 4JTCB 2OOCA 4JRZA 4KNWA 4YT5A 1T5OA 4GYTA 3Q7LA 1NFNA 2LQGA 3MFNA 4KC9A 4NTFA 4NC3A 2J7PD 2G3VA 1OXBA 1Q0DA 3LS1A 4Z9IA 5KYXB 4CS9A 5GPGB 1OW6A 4J7TA 1LIHA 3WODF 5T1DB 3U3FA 1AUEA 3ZQYA 3M1CB 2XS1A 3M4BA 2V26A 1LS1A 3B9QA 2A0BA 1ZHTA 3M79A 5CI8A 3S29A 2KGOA 3ZTMA 2HV7A 3FHDA 4DRHB 4XEFA 5T3WA 1O87A 1A7DA 2IXMA 4CIPA 1YAUO 2XLMA 2XXAA 4U5EE 3KH2A 3SXZA 5D92A 3ZQVA 5KYWA 4CX9A 2WL8A 3B29A 3IQ6A 5E3AA 3S0XA 2YWAA 1LVKA 1PD0A 1XWJA 1JPNA 1VYKA 2LD6A 1ZVZA 3DM9B 5D91A 3U5SA 4CBEA 4XLPF 3UMHA 2GWWA 2L9JA 4G0HA 4E0HA 4JVSA 3DZAA 1U89A 4E0IA 5A6AA 2Q9BA 3L1MA 3ZTZA 1FMVA 2R03A 4XTKA 3RIPA 2HJ3A 1I4ZA 2Q4FA 1NU9C 3HNIA 2Q9CA 2A6EF 4DRJB
chains in the Genus database with same CATH topology
1A7DA 3AGTA 4XPYA 1A7EA 1HMOA 2HMQA 1I4YA 2MHRA 2HMZA 2AWCA 4XPXA 4XPWA 3AGUA 1HMDA 3WAQA 3WHNA 4XQ1A 1I4ZA 2AVKA 2AWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7D A;  3AGT A;  4XPY A;  1A7E A;  1HMO A;  2HMQ A;  1I4Y A;  2MHR A;  2HMZ A;  2AWC A;  4XPX A;  4XPW A;  3AGU A;  1HMD A;  3WAQ A;  3WHN A;  4XQ1 A;  1I4Z A;  2AVK A;  2AWY A; 
#chains in the Genus database with same CATH topology
 2WB7 A;  1E83 A;  1OQC A;  3A9C A;  2H7V C;  2L6H A;  2P1A A;  2CNW D;  3POV A;  4JUR I;  4EBJ A;  2QNL A;  2Y3H A;  5L0G A;  1ZYR F;  2LK4 A;  4LDK A;  1GM5 A;  3R2P A;  2WZF A;  3MYI A;  2I8B A;  2L81 A;  2VH3 A;  3GOR A;  3IEE A;  1NFO A;  2ZPA A;  3V5Z A;  3K33 A;  1LKX A;  3TQO A;  4RBN A;  1A7V A;  5B3S C;  2Y3B A;  4JTD B;  4GEH A;  1VOM A;  2XL6 A;  3TD7 A;  4AX2 A;  1C02 A;  2EIK C;  5AC5 A;  2R7Q A;  5E33 A;  1HY5 A;  2KSF A;  3SNH A;  4U5H A;  3UNG C;  4LDQ A;  4I1O B;  3RQE A;  3X2Q C;  4N4W A;  1OR3 A;  3HJC A;  3N24 A;  2NSG A;  4CSA C;  2ASR A;  1HE1 A;  4PR9 A;  4XPY A;  2XLV A;  3N0T A;  4RDA A;  1D1B A;  2IXN A;  1YAR O;  4JZA A;  1HW2 A;  3FAP B;  1RXQ A;  256B A;  4MVR A;  2NG1 A;  5BQI A;  3A11 A;  2NUP A;  3RVZ A;  3S84 A;  4DVY P;  1T6Q A;  3ABM C;  4PJJ A;  4YL0 A;  1F1M A;  4CSA A;  3JSE O;  3QTH A;  4RD9 A;  5AGF A;  1ST6 A;  3C62 A;  1VYI A;  1VMA A;  2LP4 A;  2OKU A;  1WAS A;  3OWT A;  4MVU A;  4P9F A;  2X0C A;  3HKK A;  1QSP A;  1TR2 A;  4W8P A;  3PDM P;  1U0B B;  4JW1 A;  3DM5 A;  2HSQ A;  2UUI A;  4LLE A;  2DGJ A;  1U6H A;  1IW7 F;  2P7V A;  2EPK X;  1WTY A;  3GM1 A;  3IQT A;  3LJB A;  3QW1 A;  4XWJ A;  4YJW A;  2ZXP A;  3ECS A;  4OIN F;  4QDL A;  3VRC A;  2KC3 A;  3MLG A;  3ZWI A;  1RKE A;  1APC A;  4CS8 C;  1XZP A;  3LLI A;  2LFD A;  2EIJ C;  1NU7 D;  1V4A A;  3LNM B;  3EH2 A;  3J06 A;  4HE8 D;  5JUA A;  3RFY A;  1LPE A;  4PFO A;  5A69 A;  1ORJ A;  1ZW3 A;  2B0H A;  2QLA A;  3DAF A;  4O6Y A;  2QUP A;  2Y3D A;  3AG3 C;  3MBG A;  2WZG A;  2R7T A;  4G78 A;  4U5C E;  3VM6 A;  2EPL X;  3G4Z A;  3LAY A;  4YN0 B;  1NG1 A;  3ZC4 A;  1FNT c;  1M57 C;  1SZI A;  1TWH A;  3AG2 C;  2GAQ A;  3EQL F;  3US6 A;  4ZLD A;  3HLZ A;  1A0B A;  4YT8 A;  1B68 A;  4JIO A;  3SP1 A;  3AG4 C;  2HV6 A;  4MW3 A;  3W2W A;  4NCQ A;  3DKA A;  1MMG A;  4Z9J A;  3B0V C;  3TOL A;  4AE4 A;  3KKB A;  4B6I A;  4N6C A;  2OQM A;  4Q4Z F;  1OKK A;  3ZSU A;  2OJE D;  3FMS A;  5KYU A;  1G5Z A;  1YYX A;  2HS5 A;  3JSZ A;  1T9K A;  3E9V A;  5A6B D;  2E87 A;  3SEO A;  5COG A;  3NYJ A;  1SYQ A;  5A6K A;  3DE9 A;  4U5F E;  3I5P A;  3MX3 A;  2EIN C;  3I5Q A;  2GFH A;  2LFF A;  3GEE A;  2R7W A;  4FWV A;  3LUT B;  2J45 A;  2VB6 A;  4OIP F;  1MNE A;  1WN0 A;  3KL4 A;  1VLT A;  4JTA B;  3UMI A;  1CGM E;  3GEH A;  4O7G A;  1D1C A;  1RKE B;  3U9M A;  1HMD A;  5F5H A;  3TJ6 A;  1JOG A;  1JPJ A;  3NKE A;  4YL1 A;  1GQA A;  4ULV A;  1Q0K A;  3PCV A;  3RQG A;  1Z7Q c;  1V74 B;  2IBF A;  4EBB A;  3QZC A;  4U5B E;  4MVO A;  3GEI A;  2OU6 A;  1FFT C;  2G62 A;  2PF4 E;  3C8G B;  3U2M A;  1E86 A;  2HMQ A;  3NG1 A;  4DRI B;  3ASO C;  1VLS A;  3EGD A;  2XL8 A;  4JCZ A;  2CCY A;  4N06 A;  4U5G A;  1G8X A;  4CDA A;  1M2V A;  4KBL A;  1BR4 A;  4C3E A;  2Q9A A;  4O79 A;  1H9G A;  3EZH A;  1S05 A;  4MW8 A;  5L3Q A;  2IXP A;  2M64 A;  2EPN A;  4M63 A;  5E3C A;  4WGZ A;  3JT1 A;  1Z63 A;  4NQF A;  3PMR A;  4AE4 B;  4MTO A;  2HFI A;  2YL3 A;  4DVZ A;  1ZHY A;  2JD3 A;  3AGU A;  5F28 E;  3EG9 B;  1CPR A;  3DD7 A;  4DBQ A;  3WHN A;  3VYW A;  5L0F A;  2MYS A;  2Q3T A;  2QY9 A;  1ZHZ A;  3MYF A;  1CGO A;  2UUH A;  2R25 A;  3O6X A;  3B0P A;  4GQH A;  2M4E A;  3ATP A;  2R7R A;  1R5I D;  1Z6A A;  3S28 A;  3F47 A;  4U5D E;  4AL1 A;  1ZU5 A;  2HUJ A;  1L7C A;  2H7B A;  2NSF A;  3T4R A;  4L6R A;  1RJ9 A;  3U0C A;  2PNO A;  4A2N B;  3B0U X;  1D1A A;  2XM0 A;  5BQG A;  2GDC A;  1VK5 A;  2HMZ A;  1DOW A;  2YL7 A;  3IQ5 A;  5T3T A;  1L3P A;  2JX0 A;  4IGG A;  2VCA A;  5DS5 A;  3H65 A;  2XLE A;  3IQC A;  2P6V A;  3CEX A;  4JC7 A;  2KK1 A;  2ZXW C;  1YYJ A;  3JTL O;  5JSL A;  3RKO F;  4KI2 A;  3NDB B;  1K40 A;  5JS5 A;  2VCB A;  4C3B A;  1BBH A;  2WVN A;  5B1B C;  1FFH A;  3T9O A;  3N2Z B;  5DS4 A;  3NYM A;  5JRA A;  2J0X A;  2KYH A;  1GGQ A;  2J7P A;  3JYH A;  1BR1 A;  3DWW A;  5B1A C;  4PAC A;  4ULW A;  3EGD B;  5EGY A;  2PX0 A;  2XXA B;  2YLG A;  3TOM A;  1Z5Z A;  1M2V B;  1TKN A;  5TJ5 E;  4EHP A;  5DVW A;  4OIO F;  1CGN A;  2CYD A;  4CIH A;  2B0J A;  1OW7 A;  4OIR F;  3RQF A;  4Q7C A;  3ZVR A;  5KYW B;  2FGY A;  4PJM A;  5EHH A;  3AGT A;  1T6U A;  1YZC A;  2X51 A;  3C8G D;  4N6H A;  1E2X A;  2Y39 A;  3FAJ A;  2QTV A;  4JCH A;  3O10 A;  3SZR A;  3EPV A;  4C3D A;  5JT4 A;  3EGX A;  4X0R A;  3I4U A;  1TFO B;  4YT4 A;  4IAQ A;  4J7Y A;  3NMK A;  4OD4 A;  1S7Z A;  2J8W A;  2HZ8 A;  4R32 A;  2G3K A;  3R7C A;  2GA0 A;  4C7O A;  3TUL A;  2R05 A;  4U9E A;  1A41 A;  2J0W A;  2R7U A;  4BJ5 A;  4BJ6 C;  1G4U S;  2A68 F;  4MVS A;  3S27 A;  4KNV A;  1C17 M;  3DI5 A;  4O6M A;  4CS7 A;  4IAO A;  4FES A;  5DQT A;  3FVY A;  5BQH A;  4CDY A;  2A0U A;  4WGY A;  5KYN A;  1YLM A;  1R4T A;  2PP4 A;  4PFP A;  1ZHX A;  2ZXR A;  2VAS A;  4K0D A;  1RCP A;  2BL2 A;  3ZDL A;  5A6J A;  3B71 A;  1Q0G A;  4NTA A;  2Q7R A;  1A7E A;  3GWL A;  3T6G B;  1NZE A;  1YA7 O;  1LI7 A;  3DE8 A;  3K1H A;  4BJ6 A;  1H6G A;  5F5F A;  2CDQ A;  2F22 A;  2XLH A;  4Q5S F;  3G4X A;  1D0X A;  4NY3 A;  1UFB A;  4BG0 A;  3FXH A;  1MMD A;  1TWA A;  4XEK A;  2CNW A;  3EFO A;  3KMI A;  1O5H A;  2OG2 A;  3K1I C;  3NRH A;  4JJG A;  1M56 C;  3K6B A;  1PCX A;  4IJJ A;  3EH1 A;  4AK9 A;  4EKW A;  5L3V A;  3C63 A;  4ONS A;  5E2Q A;  3V5X A;  5L0D A;  5EK0 A;  3U9J A;  4AL0 A;  2C03 A;  4MTG A;  3U3B A;  1K04 A;  3CZ6 A;  3CSK A;  1M2O A;  3ABL C;  3C7J A;  2EPM X;  1J8M F;  3K7D A;  4I1M A;  1Y4C A;  3C8Z A;  3EGX B;  4DXW A;  2DYR C;  4E7S A;  5KYX A;  2AVK A;  3K1I A;  2W4B A;  4P9T A;  3W8I A;  5L0I A;  3L0I A;  2J9B A;  1SR2 A;  3KYI A;  3SXM A;  3NYL A;  2NUP B;  4H54 A;  5DQZ A;  4A4A A;  2EPO A;  3DJN B;  4MTF A;  4ER9 A;  2O9X A;  3JZ0 A;  2Y3G A;  5IY5 C;  2FFH A;  2YKZ A;  1W2W A;  1FMW A;  1G4W R;  1T01 A;  1ZHW A;  2LCH A;  2P61 A;  2YHS A;  4FAP B;  1FR0 A;  1WWP A;  2FAP B;  3L8J A;  3NKD A;  3NMI A;  4PJN A;  4DJ9 A;  3RF3 A;  1TWG A;  2AWC A;  2WVQ A;  1LE2 A;  2IXO A;  2L6F A;  3QW0 A;  2R7V A;  3WG7 C;  4YWQ A;  3RYL A;  3EZI A;  1BR2 A;  2R02 A;  2VC9 A;  3Q6N A;  1JAF A;  1OCO C;  3HNL A;  4QI0 A;  1MMA A;  2DYS C;  2Q00 A;  3KYJ A;  3SYN A;  2XLW A;  1DOV A;  3GM3 A;  4JE9 A;  3Q7G A;  2EIM C;  4E7Z A;  1EA8 A;  5DS6 A;  4BEM J;  2R9R B;  2AWY A;  4DOZ A;  1O3U A;  3TJ5 A;  2V3C C;  1KTM A;  3H2U A;  3QMK A;  3FOO A;  3O55 A;  1WOL A;  1KU2 A;  1HMO A;  3AQB A;  4IAR A;  2RSE B;  2MHR A;  1OXK A;  1EKY A;  5HSW A;  1VB5 A;  4JEB A;  2H8A A;  1D0Z A;  3V7O A;  3IPM O;  1V55 C;  5FCL A;  2YL0 A;  3LLK A;  3QVY A;  5K0I A;  4MS2 A;  4NTB A;  1VTM P;  2L6G A;  1QQ3 A;  2A6H F;  1J8Y F;  2XLD A;  3M4C A;  3K66 A;  3DJU B;  5COF A;  5JLI A;  3OA1 A;  4WJ0 A;  1LE4 A;  4CJG A;  5KYU B;  3V5Y A;  1RMV A;  2XM4 A;  1JMW A;  1WGW A;  4K1O A;  4YL3 A;  3VF0 A;  2CGE A;  5COM A;  3S9O A;  1QLE C;  2W9Y A;  3GM2 A;  2R7O A;  3FOP A;  4CS9 C;  3G50 A;  1GS9 A;  1OCC C;  3CAX A;  3Q6M A;  4H4K C;  1E84 A;  3EHM A;  4EWC A;  2YRF A;  1YDI A;  1QPU A;  2OJQ A;  3KPH A;  2R7S A;  3U2L A;  3VAY A;  4EIY A;  1V54 C;  1Z23 A;  2H7O A;  2J46 A;  1KNY A;  3ITF A;  1LS4 A;  3O39 A;  3AQC A;  5A6B A;  2ICW G;  1AEP A;  3L34 A;  2BE5 F;  4IRU A;  2KJG A;  1ZU4 A;  1SMY F;  2KNH A;  2KQ9 A;  2OEX A;  4J30 B;  4YT2 A;  2YEV A;  3GWN A;  1OW8 A;  4LAC B;  1Z3I X;  4UDV A;  4ZLC A;  4C7O B;  4MVQ A;  3BEH A;  3TK0 A;  5L0C A;  1NLX A;  3UGO A;  1WAT A;  2YVK A;  3S90 A;  2C04 A;  3CQZ A;  3W4Y A;  2WZL A;  1PV3 A;  2XSE A;  2PX3 A;  5L0J A;  4OIQ F;  4BJT A;  2YZS A;  4F4B A;  2J9U A;  2PFD A;  2JPU A;  2A69 F;  2Y69 C;  4MQ9 F;  1QKR A;  1YJG A;  4EUK B;  2ZD9 A;  3QVZ A;  4OD5 A;  1FAP B;  1JRA A;  1MND A;  1TWC A;  1I5N A;  1H7I A;  2W45 A;  3W2V A;  3DAG A;  4BJ5 C;  3H2V A;  1XZQ A;  5L0H A;  2IM8 A;  2IYL D;  2XRH A;  3JYY A;  3LEO A;  3NMJ A;  4WAB A;  1MQV A;  2XL4 A;  3OEO A;  1IZM A;  4XPX A;  3AJM A;  1Q0F A;  4G7O F;  3LS0 A;  1YVI A;  3W8H A;  1C03 A;  4J32 B;  5B3I A;  4D4X A;  5FZT A;  4IB4 A;  3PHF 2;  1EI7 A;  3WAQ A;  3DMD A;  1OKK D;  3SXY A;  4XEV A;  2YLI A;  3E70 C;  4XQ1 A;  4W8K A;  1RJ9 B;  1CPQ A;  3F46 A;  2LIG A;  2MWQ A;  3EJN A;  4JKV A;  5KYY A;  4O6N A;  1UG7 A;  1QZX A;  1N1C A;  1T6I A;  1TFK B;  1JR8 A;  4PK4 A;  3T6J A;  2I15 A;  4ANJ A;  1OCR C;  2QE9 A;  1LM3 B;  2DI3 A;  3AOU A;  4P6I C;  2OCC C;  3LNR A;  1K05 A;  2A1D D;  2Z15 A;  3HTK C;  4MVZ A;  2NUT A;  3UMK A;  4LER A;  2YL1 A;  4CJO A;  3JRT A;  4BEJ A;  4I3M A;  2VCC A;  2J9V A;  1BZ4 A;  1YA9 A;  4K7B A;  5BUO A;  2DB4 A;  5HV9 A;  3U8V A;  3HNJ A;  2L7A A;  2EIL C;  3RH3 A;  2BC5 A;  4MVM A;  3T6B A;  3ABK C;  1QVX A;  4LLC A;  1SF8 A;  3EHN A;  3RW0 A;  2PBE A;  1M6T A;  5CI9 A;  4YK5 A;  1ZZP A;  1RKC A;  2J9W A;  3BRJ A;  1ZW2 A;  3X1O A;  2HSB A;  4HFF B;  3U8P A;  1HE9 A;  2P0N A;  1OCZ C;  3JCU Q;  1HW1 A;  2XLO A;  3JRM O;  2D4U A;  3ASN C;  5JP7 A;  5DLJ A;  4E17 A;  1E85 A;  3DXJ F;  2LSE A;  3GAN A;  3HNK A;  5AC4 A;  1OR2 A;  5JVE A;  4I44 A;  1MMN A;  1NSG B;  2ETS A;  3C18 A;  2IOQ A;  4D4N A;  4G7H F;  3FDQ A;  1D0Y A;  3M15 A;  1I4Y A;  3AG1 C;  1EQ1 A;  4BPM A;  1H9T A;  4DBR A;  4PJL A;  1TQG A;  2YLD A;  2XS8 A;  4JEA A;  2WVO A;  2TMV P;  2HKV A;  4FX5 A;  4LDR A;  4JJF A;  4MND A;  4EBK A;  3SXK A;  1NBB A;  3C8G A;  1YZA A;  4XPW A;  2R7X A;  2CW0 F;  3UR3 C;  3ZG1 A;  4U9D A;  2NPU A;  2RD9 A;  5KYY B;  3LEV A;  2AP3 A;  2ZXO A;  2W4M A;  4CS8 A;  2D5R B;  4BJ1 A;  4IWB A;  3LES A;  4QI2 A;  5CIV A;  3UGP A;  1FTS A;  2NUT B;  4CDV A;  3RVY A;  4E18 A;  3GOD A;  3EG9 A;  4XLN F;  3ZIB A;  4HFK B;  4G7Z F;  1BDJ B;  1ORS C;  1ORY A;  1LI5 A;  2HJM A;  2OEV A;  3IHU A;  3EFO B;  4Z9H A;  1PD1 A;  3L8I A;  2AU5 A;  2YQY A;  1Y6D A;  4HEA J;  2KW3 C;  1AVO B;  1Q0M A;  4JTC B;  2OOC A;  4JRZ A;  4KNW A;  4YT5 A;  1T5O A;  4GYT A;  3Q7L A;  1NFN A;  2LQG A;  3MFN A;  4KC9 A;  4NTF A;  4NC3 A;  2J7P D;  2G3V A;  1OXB A;  1Q0D A;  3LS1 A;  4Z9I A;  5KYX B;  4CS9 A;  5GPG B;  1OW6 A;  4J7T A;  1LIH A;  3WOD F;  5T1D B;  3U3F A;  1AUE A;  3ZQY A;  3M1C B;  2XS1 A;  3M4B A;  2V26 A;  1LS1 A;  3B9Q A;  2A0B A;  1ZHT A;  3M79 A;  5CI8 A;  3S29 A;  2KGO A;  3ZTM A;  2HV7 A;  3FHD A;  4DRH B;  4XEF A;  5T3W A;  1O87 A;  1A7D A;  2IXM A;  4CIP A;  1YAU O;  2XLM A;  2XXA A;  4U5E E;  3KH2 A;  3SXZ A;  5D92 A;  3ZQV A;  5KYW A;  4CX9 A;  2WL8 A;  3B29 A;  3IQ6 A;  5E3A A;  3S0X A;  2YWA A;  1LVK A;  1PD0 A;  1XWJ A;  1JPN A;  1VYK A;  2LD6 A;  1ZVZ A;  3DM9 B;  5D91 A;  3U5S A;  4CBE A;  4XLP F;  3UMH A;  2GWW A;  2L9J A;  4G0H A;  4E0H A;  4JVS A;  3DZA A;  1U89 A;  4E0I A;  5A6A A;  2Q9B A;  3L1M A;  3ZTZ A;  1FMV A;  2R03 A;  4XTK A;  3RIP A;  2HJ3 A;  1I4Z A;  2Q4F A;  1NU9 C;  3HNI A;  2Q9C A;  2A6E F;  4DRJ B; 
#chains in the Genus database with same CATH homology
 1A7D A;  3AGT A;  4XPY A;  1A7E A;  1HMO A;  2HMQ A;  1I4Y A;  2MHR A;  2HMZ A;  2AWC A;  4XPX A;  4XPW A;  3AGU A;  1HMD A;  3WAQ A;  3WHN A;  4XQ1 A;  1I4Z A;  2AVK A;  2AWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...