2MHRA

Structure of myohemerythrin in the azidomet state at 1.7(slash)1.3 angstroms resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWLVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of myohemerythrin in the azidomet state at 1.7/1.3 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen binding
molecule keywords MYOHEMERYTHRIN
total genus 49
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1987-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2mhrA00
1A7DA 3WHNA 1HMDA 3AGTA 1HMOA 1I4YA 1A7EA 2MHRA 4XPYA 2AVKA 3AGUA 2AWYA 4XQ1A 4XPXA 4XPWA 1I4ZA 3WAQA 2HMZA 2HMQA 2AWCA
chains in the Genus database with same CATH superfamily
3JYYA 2R03A 3W8HA 1LM3B 1OW8A 3EGXB 4CIHA 1FMVA 2QY9A 3G50A 5B1BC 3U5SA 3ZTMA 5KYWB 2PX3A 3DAFA 2JD3A 4IARA 1TWCA 4IRUA 4GEHA 2HKVA 1MNDA 1HMOA 3M79A 5HV9A 1V55C 5DLJA 2AWYA 4G0HA 3WAQA 4O7GA 4LACB 2X0CA 4U5HA 3ZSUA 1SMYF 5A6JA 3ZQYA 3EZIA 1S7ZA 3C7JA 3RH3A 2XLDA 3EG9B 3N0TA 2CYDA 3JCUQ 1A0BA 5CIVA 2JPUA 1VTMP 4HE8D 1JPJA 1TQGA 1VYKA 3K1IA 4WGZA 4DXWA 5K0IA 5L0HA 2OG2A 2Q7RA 1OQCA 2BC5A 3WHNA 3ECSA 4Q4ZF 3PDMP 2XS8A 2A1DD 2ZXWC 1A7VA 2AP3A 2J9BA 2LSEA 3QTHA 4YL0A 3U2LA 1L3PA 4W8KA 1OR2A 4KI2A 2R7UA 1FFTC 4EBBA 3LEOA 1ORJA 1TR2A 3A9CA 2PFDA 4J30B 4J7TA 1K05A 1VYIA 3R7CA 4AK9A 3V5XA 4DVYP 1V4AA 4LERA 3RQEA 2IXOA 3NMIA 2CCYA 3KYIA 4XPWA 1D0YA 5AC5A 1UG7A 2R25A 2OCCC 3M15A 4E18A 2G3VA 1T01A 4YWQA 4U5EE 3L8IA 2QNLA 5DS4A 3L8JA 3NMKA 3EH2A 3QVZA 2P61A 2EINC 3U8VA 5KYXA 3L0IA 4HEAJ 3IEEA 2NG1A 5KYYA 1SZIA 2DYSC 5JP7A 2J45A 3DE8A 5AGFA 5TJ5E 3HNJA 5JLIA 3POVA 3U3FA 3VYWA 2QTVA 3X1OA 1HMDA 2ZXRA 3IPMO 1NG1A 4YJWA 1I5NA 1D0XA 2C04A 2VH3A 4WGYA 2YL1A 2W4MA 1HW1A 3AG1C 3NYMA 1OCRC 2VB6A 4I44A 2EPOA 4IWBA 1YYXA 1Q0MA 3ZG1A 3B0VC 2XL6A 4J32B 4NTBA 4OD4A 2IXNA 4BJ5A 3FOPA 2KSFA 3ASNC 4IJJA 4MQ9F 4A2NB 3LEVA 2LFDA 2XS1A 2FFHA 1LIHA 3IHUA 4U9EA 4BEJA 3JSEO 5KYNA 4XWJA 1OCZC 1E2XA 3CZ6A 3CSKA 3SXYA 3RQGA 3N24A 5T1DB 2TMVP 3NDBB 4N06A 3W2VA 1D1BA 4MVMA 4RBNA 4XLPF 2CNWA 3UMHA 4CS9A 2IOQA 4MW3A 2WZLA 1RKEB 1TWGA 3MLGA 4IGGA 2R7QA 1WASA 1RJ9B 2V26A 3ZDLA 2HZ8A 4MTFA 4P6IC 2NUPA 3M4BA 1QVXA 3S84A 4C3BA 1LE4A 4CJOA 4G7OF 3MYIA 1WOLA 1N1CA 2XL8A 3E9VA 2YL7A 1G4US 3CQZA 1Q0DA 3TQOA 1QLEC 1HE9A 1VOMA 1RXQA 2W9YA 4P9FA 4YL1A 4OIRF 2PF4E 3M1CB 1T6QA 3DJUB 3RW0A 5HSWA 2Q3TA 4EBJA 1T5OA 5F5HA 4BJ1A 1HW2A 1Q0FA 4ONSA 4AE4B 4CDYA 1FMWA 4O79A 3U9MA 4CS9C 5EGYA 1LE2A 1D1AA 2YLDA 2AWCA 1ZHWA 3HKKA 2H8AA 3Q6NA 4JKVA 4O6NA 1OCCC 4QI0A 4W8PA 2EIJC 3U3BA 1OXKA 4BJ6A 3EPVA 2KW3C 2XLHA 4ER9A 5DS5A 2VCBA 3EFOA 1YDIA 4NQFA 4PJMA 4MTGA 4A4AA 2I8BA 4CJGA 3DKAA 3HNKA 3OA1A 2R7VA 4DVZA 4BEMJ 3FDQA 3DM5A 1ZU4A 3AJMA 1Q0KA 3F46A 3MBGA 4U5GA 5IY5C 1A7DA 1MQVA 1VMAA 3MX3A 3LLKA 2FAPB 2ZXPA 4CX9A 4MVUA 3VF0A 2HSQA 1FNTc 2J7PA 3FAJA 3Q7LA 1RJ9A 1B68A 4FESA 4JJGA 4Q7CA 3KKBA 4F4BA 2QE9A 2VCAA 4YT2A 1CGME 1QPUA 1NSGB 2HFIA 2PX0A 3U2MA 2DI3A 5A69A 1VK5A 4LLEA 3GM1A 4ZLCA 4XPXA 1APCA 4MVSA 4D4NA 2J9UA 2WZFA 2WVOA 2P6VA 3LESA 4LDKA 4MS2A 1NZEA 3K6BA 3KL4A 1ZVZA 1RMVA 1A7EA 1TWHA 2QUPA 1W2WA 2EILC 2HJMA 2J0XA 2L6GA 2UUIA 4HFKB 2R7XA 4CS8A 4MTOA 1M57C 5EK0A 2JX0A 4JEBA 5COGA 2PNOA 4CDVA 5L0GA 1YA9A 2P1AA 4I1MA 5DQZA 1FFHA 3IQ6A 4KBLA 2YWAA 2OOCA 3GEIA 2HJ3A 5GPGB 5E33A 2J8WA 1O3UA 3EGDA 4U9DA 1DOVA 4CSAA 1H6GA 4ZLDA 5D91A 2MHRA 2ICWG 1D1CA 2OKUA 2XXAA 1TFKB 1M56C 1C17M 2F22A 2V3CC 2A69F 3SNHA 3G4XA 3JRTA 1TFOB 3N2ZB 1QQ3A 1YLMA 2Q00A 2A68F 2NPUA 3QVYA 1DOWA 4FX5A 4X0RA 4YK5A 3ZTZA 3KPHA 4RDAA 5B3SC 256BA 2YEVA 1KTMA 5FCLA 3GWLA 3CEXA 1OCOC 5E2QA 4AL1A 3LJBA 3LNRA 2QLAA 5A6AA 3DZAA 4G78A 5BUOA 3S9OA 4DOZA 3SP1A 1YA7O 2Y3BA 1BBHA 4PK4A 2Q9BA 1ORSC 4KNWA 4RD9A 3UGPA 3BEHA 1K04A 2AVKA 2D4UA 3TK0A 4E7SA 2W45A 2YZSA 2E87A 2HMQA 1F1MA 4N4WA 3UMKA 4AL0A 2R9RB 2MYSA 1EA8A 2KK1A 4E7ZA 4YT4A 3FXHA 3AGUA 4U5FE 2LIGA 4OINF 1OKKA 1FR0A 3HNIA 3JYHA 3C18A 1TKNA 1AVOB 1QKRA 3TOMA 5E3CA 1Z63A 1WGWA 3JT1A 3RKOF 3KMIA 2YRFA 2VC9A 3DXJF 5L0JA 4ULVA 3TJ6A 4LDRA 1V74B 3KH2A 3QMKA 4LLCA 3WG7C 4AX2A 4C3EA 3CAXA 3HJCA 5CI9A 5JSLA 2KJGA 2G3KA 1JRAA 2H7VC 2WVQA 3LUTB 2GA0A 2RD9A 3F47A 4GYTA 4AE4A 4OD5A 4KC9A 2YLIA 1NBBA 4B6IA 3O6XA 4CBEA 4U5DE 2ASRA 3SXZA 1PD1A 2Y3GA 1UFBA 4JEAA 4PJNA 1PV3A 3ZVRA 4Q5SF 4NTFA 3NMJA 3C8GD 2J7PD 3GEHA 5KYUA 1C03A 3FVYA 3JRMO 3PHF2 4JVSA 3QZCA 1T6IA 3WODF 1L7CA 1YZAA 4JC7A 3K1IC 4NCQA 1G5ZA 2GAQA 1J8MF 1SYQA 2XLOA 3I5QA 3T9OA 2R05A 2H7OA 3M4CA 1I4ZA 1ZW2A 2HMZA 2XLMA 2LD6A 1WATA 4PACA 2I15A 3Q6MA 4JE9A 3V7OA 3TULA 3J06A 1M2OA 4PFPA 1M6TA 1LVKA 5A6KA 1BR1A 2CDQA 1ZHTA 1Z7Qc 3T6GB 1S05A 2BE5F 1ZHXA 4FAPB 4CIPA 2HS5A 4DRIB 2CGEA 2XXAB 2Y69C 1KU2A 3EHMA 4N6HA 4OIOF 3AGTA 1GS9A 2YVKA 2ZPAA 4H4KC 1YYJA 4D4XA 1NU9C 1FAPB 3C8GA 2XM4A 3V5ZA 1YJGA 5COMA 4E0HA 1WWPA 3GANA 3GODA 1ZW3A 3DD7A 3AG3C 3C62A 3JTLO 4CS7A 2HUJA 3RYLA 3O10A 3I5PA 5JS5A 4O6YA 1KNYA 1E86A 2EPKX 3L34A 3HTKC 1O5HA 1BR4A 5D92A 1OW7A 2KQ9A 3US6A 1O87A 4MVQA 2R7WA 3RFYA 4FWVA 5A6BA 4JIOA 5BQIA 2EIMC 2Q4FA 2D5RB 4IAQA 3T6BA 1GGQA 3EGXA 3SXKA 1GM5A 4KNVA 1Z3IX 4CSAC 3AQCA 2HV6A 2L6FA 2B0JA 4I1OB 5F5FA 1ZHYA 4MVOA 1LPEA 1C02A 1T9KA 4G7ZF 4JJFA 4BG0A 2A0UA 1OR3A 2Y3HA 2IM8A 1YAUO 1LKXA 1T6UA 3JSZA 4GQHA 5B3IA 3ASOC 3NKDA 4U5BE 3FOOA 3K1HA 4Z9HA 1GQAA 1MMNA 2YLGA 4YL3A 2OEVA 1ORYA 3ZC4A 2YHSA 4XLNF 5L0FA 3B71A 1Z6AA 2GDCA 5DVWA 1MMGA 5L0IA 3U0CA 5KYWA 4JURI 3T6JA 2P7VA 1CGOA 3B9QA 2NSGA 4JRZA 3GM2A 2KGOA 2XRHA 3SXMA 4PJLA 1K40A 1NFNA 2EPLX 2OEXA 2PP4A 4JCHA 2LCHA 4XEKA 5JT4A 5T3WA 3L1MA 1ST6A 1I4YA 2R7OA 3EFOB 3K66A 4PJJA 2OU6A 3B0UX 3DM9B 1OKKD 4UDVA 3JZ0A 3DI5A 1ZZPA 4IB4A 2OQMA 2ZXOA 3B0PA 4DRJB 2CNWD 3IQ5A 4EHPA 5JVEA 1SR2A 1LS4A 1Y4CA 1RKCA 2YQYA 2MWQA 3S29A 1HY5A 3AOUA 1SF8A 2WL8A 4EKWA 2BL2A 5DQTA 4J7YA 4YT8A 4QI2A 3H2UA 5KYXB 1LI7A 1NU7D 1WTYA 2PBEA 2WVNA 4I3MA 3ITFA 1AEPA 4BJTA 3OEOA 4Z9IA 1V54C 4XEFA 2GWWA 4L6RA 2DYRC 3C8GB 2G62A 2XSEA 3H65A 1MMAA 4YN0B 5E3AA 1EQ1A 2WB7A 1Q0GA 1G4WR 1RCPA 2L81A 4WABA 1E85A 4QDLA 2XLVA 4DJ9A 4XQ1A 2O9XA 2XL4A 2XM0A 3C63A 3HLZA 4EBKA 3RIPA 4K1OA 1H9TA 1LS1A 3GEEA 1ZYRF 2IXPA 2NUTB 3EHNA 1U6HA 1OW6A 5L0DA 3NKEA 5FZTA 2B0HA 3T4RA 2NUPB 4MNDA 2DGJA 3EQLF 3W4YA 2J0WA 4C3DA 4CDAA 4NY3A 4DBQA 5BQHA 3S90A 4DBRA 3OWTA 1EKYA 3BRJA 4BPMA 1R5ID 5DS6A 5CI8A 4N6CA 1BR2A 2CW0F 3X2QC 4E17A 2M4EA 2YL3A 1JAFA 1PCXA 4R32A 2L9JA 1Z5ZA 2C03A 4H54A 1AUEA 2IBFA 2EPNA 2L6HA 3I4UA 1RKEA 1CPQA 3EGDB 2HV7A 3UGOA 3W8IA 4MVZA 3RF3A 4OIPF 3B29A 3VRCA 3TD7A 4JZAA 3O55A 4JTCB 2R7RA 1A41A 1YVIA 2H7BA 2OJED 2YKZA 3S28A 3ZWIA 5EHHA 4C7OA 1ZU5A 2W4BA 4NC3A 3TJ5A 2LK4A 1EI7A 2A6HF 1QSPA 3FAPB 3PCVA 4LDQA 3LS0A 2KNHA 1U0BB 1LI5A 3MYFA 1IZMA 5BQGA 1M2VA 2L7AA 4U5CE 1H7IA 5L3QA 5KYYB 4OIQF 3IQTA 1D0ZA 2R7TA 1Z23A 3A11A 1XZPA 2ETSA 2NSFA 3ATPA 4NTAA 3S27A 4PR9A 4G7HF 4ANJA 1BZ4A 2WZGA 3S0XA 1VB5A 1TWAA 3LNMB 3UNGC 2HSBA 1OXBA 3K33A 3RVZA 4EWCA 3ABMC 4YT5A 1NFOA 1QZXA 2J9VA 2LP4A 3GM3A 1Y6DA 4C7OB 2IYLD 3DAGA 4HFFB 4IAOA 3ABKC 4Z9JA 3U8PA 1R4TA 4MVRA 1VLSA 3HNLA 3EG9A 5B1AC 4BJ5C 2R7SA 1BDJB 3MFNA 3TOLA 1E84A 3ZIBA 1M2VB 1JPNA 3FHDA 2LFFA 5A6BD 3AG2C 3SZRA 4DRHB 2RSEB 3H2VA 1YARO 3O39A 2ZD9A 4ULWA 3EH1A 3V5YA 2XLWA 2VASA 1G8XA 1VLTA 2FGYA 2YL0A 3DWWA 4XPYA 3EZHA 2EIKC 1U89A 2Y39A 4XTKA 3G4ZA 3AQBA 3NRHA 2Q9CA 3R2PA 2A6EF 3FMSA 1JMWA 3QW1A 3GORA 3Q7GA 5T3TA 2AU5A 2A0BA 2UUHA 3SEOA 5KYUB 1E83A 4JCZA 3EJNA 2Z15A 1XWJA 1WN0A 4JTAB 3VAYA 2X51A 3LLIA 1NLXA 1J8YF 1YZCA 2IXMA 5F28E 1PD0A 1CGNA 2J9WA 5L3VA 2KYHA 3ABLC 4PFOA 2EPMX 4K7BA 2NUTA 2Q9AA 5COFA 3DE9A 4E0IA 2M64A 3AG4C 2OJQA 5JRAA 3ZQVA 5AC4A 1HE1A 2P0NA 3GWNA 1JOGA 2R02A 2XLEA 3KYJA 1XZQA 1H9GA 3U9JA 4MW8A 3UR3C 5JUAA 2J46A 3IQCA 5L0CA 4M63A 1IW7F 3PMRA 3SYNA 3RQFA 3DMDA 3RVYA 2DB4A 3QW0A 3DJNB 3UMIA 3NYJA 3K7DA 1CPRA 3LS1A 4CS8C 3E70C 4JW1A 1JR8A 3C8ZA 3NYLA 1MMDA 1FTSA 2GFHA 2LQGA 3NG1A 2KC3A 4EIYA 4JTDB 4P9TA 4XEVA 3LAYA 3VM6A 4O6MA 4EUKB 1ZHZA 4K0DA 1MNEA 2VCCA 4WJ0A 3W2WA 4BJ6C 2Y3DA
chains in the Genus database with same CATH topology
1A7DA 3WHNA 1HMDA 3AGTA 1HMOA 1I4YA 1A7EA 2MHRA 4XPYA 2AVKA 3AGUA 2AWYA 4XQ1A 4XPXA 4XPWA 1I4ZA 3WAQA 2HMZA 2HMQA 2AWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7D A;  3WHN A;  1HMD A;  3AGT A;  1HMO A;  1I4Y A;  1A7E A;  2MHR A;  4XPY A;  2AVK A;  3AGU A;  2AWY A;  4XQ1 A;  4XPX A;  4XPW A;  1I4Z A;  3WAQ A;  2HMZ A;  2HMQ A;  2AWC A; 
#chains in the Genus database with same CATH topology
 3JYY A;  2R03 A;  3W8H A;  1LM3 B;  1OW8 A;  3EGX B;  4CIH A;  1FMV A;  2QY9 A;  3G50 A;  5B1B C;  3U5S A;  3ZTM A;  5KYW B;  2PX3 A;  3DAF A;  2JD3 A;  4IAR A;  1TWC A;  4IRU A;  4GEH A;  2HKV A;  1MND A;  1HMO A;  3M79 A;  5HV9 A;  1V55 C;  5DLJ A;  2AWY A;  4G0H A;  3WAQ A;  4O7G A;  4LAC B;  2X0C A;  4U5H A;  3ZSU A;  1SMY F;  5A6J A;  3ZQY A;  3EZI A;  1S7Z A;  3C7J A;  3RH3 A;  2XLD A;  3EG9 B;  3N0T A;  2CYD A;  3JCU Q;  1A0B A;  5CIV A;  2JPU A;  1VTM P;  4HE8 D;  1JPJ A;  1TQG A;  1VYK A;  3K1I A;  4WGZ A;  4DXW A;  5K0I A;  5L0H A;  2OG2 A;  2Q7R A;  1OQC A;  2BC5 A;  3WHN A;  3ECS A;  4Q4Z F;  3PDM P;  2XS8 A;  2A1D D;  2ZXW C;  1A7V A;  2AP3 A;  2J9B A;  2LSE A;  3QTH A;  4YL0 A;  3U2L A;  1L3P A;  4W8K A;  1OR2 A;  4KI2 A;  2R7U A;  1FFT C;  4EBB A;  3LEO A;  1ORJ A;  1TR2 A;  3A9C A;  2PFD A;  4J30 B;  4J7T A;  1K05 A;  1VYI A;  3R7C A;  4AK9 A;  3V5X A;  4DVY P;  1V4A A;  4LER A;  3RQE A;  2IXO A;  3NMI A;  2CCY A;  3KYI A;  4XPW A;  1D0Y A;  5AC5 A;  1UG7 A;  2R25 A;  2OCC C;  3M15 A;  4E18 A;  2G3V A;  1T01 A;  4YWQ A;  4U5E E;  3L8I A;  2QNL A;  5DS4 A;  3L8J A;  3NMK A;  3EH2 A;  3QVZ A;  2P61 A;  2EIN C;  3U8V A;  5KYX A;  3L0I A;  4HEA J;  3IEE A;  2NG1 A;  5KYY A;  1SZI A;  2DYS C;  5JP7 A;  2J45 A;  3DE8 A;  5AGF A;  5TJ5 E;  3HNJ A;  5JLI A;  3POV A;  3U3F A;  3VYW A;  2QTV A;  3X1O A;  1HMD A;  2ZXR A;  3IPM O;  1NG1 A;  4YJW A;  1I5N A;  1D0X A;  2C04 A;  2VH3 A;  4WGY A;  2YL1 A;  2W4M A;  1HW1 A;  3AG1 C;  3NYM A;  1OCR C;  2VB6 A;  4I44 A;  2EPO A;  4IWB A;  1YYX A;  1Q0M A;  3ZG1 A;  3B0V C;  2XL6 A;  4J32 B;  4NTB A;  4OD4 A;  2IXN A;  4BJ5 A;  3FOP A;  2KSF A;  3ASN C;  4IJJ A;  4MQ9 F;  4A2N B;  3LEV A;  2LFD A;  2XS1 A;  2FFH A;  1LIH A;  3IHU A;  4U9E A;  4BEJ A;  3JSE O;  5KYN A;  4XWJ A;  1OCZ C;  1E2X A;  3CZ6 A;  3CSK A;  3SXY A;  3RQG A;  3N24 A;  5T1D B;  2TMV P;  3NDB B;  4N06 A;  3W2V A;  1D1B A;  4MVM A;  4RBN A;  4XLP F;  2CNW A;  3UMH A;  4CS9 A;  2IOQ A;  4MW3 A;  2WZL A;  1RKE B;  1TWG A;  3MLG A;  4IGG A;  2R7Q A;  1WAS A;  1RJ9 B;  2V26 A;  3ZDL A;  2HZ8 A;  4MTF A;  4P6I C;  2NUP A;  3M4B A;  1QVX A;  3S84 A;  4C3B A;  1LE4 A;  4CJO A;  4G7O F;  3MYI A;  1WOL A;  1N1C A;  2XL8 A;  3E9V A;  2YL7 A;  1G4U S;  3CQZ A;  1Q0D A;  3TQO A;  1QLE C;  1HE9 A;  1VOM A;  1RXQ A;  2W9Y A;  4P9F A;  4YL1 A;  4OIR F;  2PF4 E;  3M1C B;  1T6Q A;  3DJU B;  3RW0 A;  5HSW A;  2Q3T A;  4EBJ A;  1T5O A;  5F5H A;  4BJ1 A;  1HW2 A;  1Q0F A;  4ONS A;  4AE4 B;  4CDY A;  1FMW A;  4O79 A;  3U9M A;  4CS9 C;  5EGY A;  1LE2 A;  1D1A A;  2YLD A;  2AWC A;  1ZHW A;  3HKK A;  2H8A A;  3Q6N A;  4JKV A;  4O6N A;  1OCC C;  4QI0 A;  4W8P A;  2EIJ C;  3U3B A;  1OXK A;  4BJ6 A;  3EPV A;  2KW3 C;  2XLH A;  4ER9 A;  5DS5 A;  2VCB A;  3EFO A;  1YDI A;  4NQF A;  4PJM A;  4MTG A;  4A4A A;  2I8B A;  4CJG A;  3DKA A;  3HNK A;  3OA1 A;  2R7V A;  4DVZ A;  4BEM J;  3FDQ A;  3DM5 A;  1ZU4 A;  3AJM A;  1Q0K A;  3F46 A;  3MBG A;  4U5G A;  5IY5 C;  1A7D A;  1MQV A;  1VMA A;  3MX3 A;  3LLK A;  2FAP B;  2ZXP A;  4CX9 A;  4MVU A;  3VF0 A;  2HSQ A;  1FNT c;  2J7P A;  3FAJ A;  3Q7L A;  1RJ9 A;  1B68 A;  4FES A;  4JJG A;  4Q7C A;  3KKB A;  4F4B A;  2QE9 A;  2VCA A;  4YT2 A;  1CGM E;  1QPU A;  1NSG B;  2HFI A;  2PX0 A;  3U2M A;  2DI3 A;  5A69 A;  1VK5 A;  4LLE A;  3GM1 A;  4ZLC A;  4XPX A;  1APC A;  4MVS A;  4D4N A;  2J9U A;  2WZF A;  2WVO A;  2P6V A;  3LES A;  4LDK A;  4MS2 A;  1NZE A;  3K6B A;  3KL4 A;  1ZVZ A;  1RMV A;  1A7E A;  1TWH A;  2QUP A;  1W2W A;  2EIL C;  2HJM A;  2J0X A;  2L6G A;  2UUI A;  4HFK B;  2R7X A;  4CS8 A;  4MTO A;  1M57 C;  5EK0 A;  2JX0 A;  4JEB A;  5COG A;  2PNO A;  4CDV A;  5L0G A;  1YA9 A;  2P1A A;  4I1M A;  5DQZ A;  1FFH A;  3IQ6 A;  4KBL A;  2YWA A;  2OOC A;  3GEI A;  2HJ3 A;  5GPG B;  5E33 A;  2J8W A;  1O3U A;  3EGD A;  4U9D A;  1DOV A;  4CSA A;  1H6G A;  4ZLD A;  5D91 A;  2MHR A;  2ICW G;  1D1C A;  2OKU A;  2XXA A;  1TFK B;  1M56 C;  1C17 M;  2F22 A;  2V3C C;  2A69 F;  3SNH A;  3G4X A;  3JRT A;  1TFO B;  3N2Z B;  1QQ3 A;  1YLM A;  2Q00 A;  2A68 F;  2NPU A;  3QVY A;  1DOW A;  4FX5 A;  4X0R A;  4YK5 A;  3ZTZ A;  3KPH A;  4RDA A;  5B3S C;  256B A;  2YEV A;  1KTM A;  5FCL A;  3GWL A;  3CEX A;  1OCO C;  5E2Q A;  4AL1 A;  3LJB A;  3LNR A;  2QLA A;  5A6A A;  3DZA A;  4G78 A;  5BUO A;  3S9O A;  4DOZ A;  3SP1 A;  1YA7 O;  2Y3B A;  1BBH A;  4PK4 A;  2Q9B A;  1ORS C;  4KNW A;  4RD9 A;  3UGP A;  3BEH A;  1K04 A;  2AVK A;  2D4U A;  3TK0 A;  4E7S A;  2W45 A;  2YZS A;  2E87 A;  2HMQ A;  1F1M A;  4N4W A;  3UMK A;  4AL0 A;  2R9R B;  2MYS A;  1EA8 A;  2KK1 A;  4E7Z A;  4YT4 A;  3FXH A;  3AGU A;  4U5F E;  2LIG A;  4OIN F;  1OKK A;  1FR0 A;  3HNI A;  3JYH A;  3C18 A;  1TKN A;  1AVO B;  1QKR A;  3TOM A;  5E3C A;  1Z63 A;  1WGW A;  3JT1 A;  3RKO F;  3KMI A;  2YRF A;  2VC9 A;  3DXJ F;  5L0J A;  4ULV A;  3TJ6 A;  4LDR A;  1V74 B;  3KH2 A;  3QMK A;  4LLC A;  3WG7 C;  4AX2 A;  4C3E A;  3CAX A;  3HJC A;  5CI9 A;  5JSL A;  2KJG A;  2G3K A;  1JRA A;  2H7V C;  2WVQ A;  3LUT B;  2GA0 A;  2RD9 A;  3F47 A;  4GYT A;  4AE4 A;  4OD5 A;  4KC9 A;  2YLI A;  1NBB A;  4B6I A;  3O6X A;  4CBE A;  4U5D E;  2ASR A;  3SXZ A;  1PD1 A;  2Y3G A;  1UFB A;  4JEA A;  4PJN A;  1PV3 A;  3ZVR A;  4Q5S F;  4NTF A;  3NMJ A;  3C8G D;  2J7P D;  3GEH A;  5KYU A;  1C03 A;  3FVY A;  3JRM O;  3PHF 2;  4JVS A;  3QZC A;  1T6I A;  3WOD F;  1L7C A;  1YZA A;  4JC7 A;  3K1I C;  4NCQ A;  1G5Z A;  2GAQ A;  1J8M F;  1SYQ A;  2XLO A;  3I5Q A;  3T9O A;  2R05 A;  2H7O A;  3M4C A;  1I4Z A;  1ZW2 A;  2HMZ A;  2XLM A;  2LD6 A;  1WAT A;  4PAC A;  2I15 A;  3Q6M A;  4JE9 A;  3V7O A;  3TUL A;  3J06 A;  1M2O A;  4PFP A;  1M6T A;  1LVK A;  5A6K A;  1BR1 A;  2CDQ A;  1ZHT A;  1Z7Q c;  3T6G B;  1S05 A;  2BE5 F;  1ZHX A;  4FAP B;  4CIP A;  2HS5 A;  4DRI B;  2CGE A;  2XXA B;  2Y69 C;  1KU2 A;  3EHM A;  4N6H A;  4OIO F;  3AGT A;  1GS9 A;  2YVK A;  2ZPA A;  4H4K C;  1YYJ A;  4D4X A;  1NU9 C;  1FAP B;  3C8G A;  2XM4 A;  3V5Z A;  1YJG A;  5COM A;  4E0H A;  1WWP A;  3GAN A;  3GOD A;  1ZW3 A;  3DD7 A;  3AG3 C;  3C62 A;  3JTL O;  4CS7 A;  2HUJ A;  3RYL A;  3O10 A;  3I5P A;  5JS5 A;  4O6Y A;  1KNY A;  1E86 A;  2EPK X;  3L34 A;  3HTK C;  1O5H A;  1BR4 A;  5D92 A;  1OW7 A;  2KQ9 A;  3US6 A;  1O87 A;  4MVQ A;  2R7W A;  3RFY A;  4FWV A;  5A6B A;  4JIO A;  5BQI A;  2EIM C;  2Q4F A;  2D5R B;  4IAQ A;  3T6B A;  1GGQ A;  3EGX A;  3SXK A;  1GM5 A;  4KNV A;  1Z3I X;  4CSA C;  3AQC A;  2HV6 A;  2L6F A;  2B0J A;  4I1O B;  5F5F A;  1ZHY A;  4MVO A;  1LPE A;  1C02 A;  1T9K A;  4G7Z F;  4JJF A;  4BG0 A;  2A0U A;  1OR3 A;  2Y3H A;  2IM8 A;  1YAU O;  1LKX A;  1T6U A;  3JSZ A;  4GQH A;  5B3I A;  3ASO C;  3NKD A;  4U5B E;  3FOO A;  3K1H A;  4Z9H A;  1GQA A;  1MMN A;  2YLG A;  4YL3 A;  2OEV A;  1ORY A;  3ZC4 A;  2YHS A;  4XLN F;  5L0F A;  3B71 A;  1Z6A A;  2GDC A;  5DVW A;  1MMG A;  5L0I A;  3U0C A;  5KYW A;  4JUR I;  3T6J A;  2P7V A;  1CGO A;  3B9Q A;  2NSG A;  4JRZ A;  3GM2 A;  2KGO A;  2XRH A;  3SXM A;  4PJL A;  1K40 A;  1NFN A;  2EPL X;  2OEX A;  2PP4 A;  4JCH A;  2LCH A;  4XEK A;  5JT4 A;  5T3W A;  3L1M A;  1ST6 A;  1I4Y A;  2R7O A;  3EFO B;  3K66 A;  4PJJ A;  2OU6 A;  3B0U X;  3DM9 B;  1OKK D;  4UDV A;  3JZ0 A;  3DI5 A;  1ZZP A;  4IB4 A;  2OQM A;  2ZXO A;  3B0P A;  4DRJ B;  2CNW D;  3IQ5 A;  4EHP A;  5JVE A;  1SR2 A;  1LS4 A;  1Y4C A;  1RKC A;  2YQY A;  2MWQ A;  3S29 A;  1HY5 A;  3AOU A;  1SF8 A;  2WL8 A;  4EKW A;  2BL2 A;  5DQT A;  4J7Y A;  4YT8 A;  4QI2 A;  3H2U A;  5KYX B;  1LI7 A;  1NU7 D;  1WTY A;  2PBE A;  2WVN A;  4I3M A;  3ITF A;  1AEP A;  4BJT A;  3OEO A;  4Z9I A;  1V54 C;  4XEF A;  2GWW A;  4L6R A;  2DYR C;  3C8G B;  2G62 A;  2XSE A;  3H65 A;  1MMA A;  4YN0 B;  5E3A A;  1EQ1 A;  2WB7 A;  1Q0G A;  1G4W R;  1RCP A;  2L81 A;  4WAB A;  1E85 A;  4QDL A;  2XLV A;  4DJ9 A;  4XQ1 A;  2O9X A;  2XL4 A;  2XM0 A;  3C63 A;  3HLZ A;  4EBK A;  3RIP A;  4K1O A;  1H9T A;  1LS1 A;  3GEE A;  1ZYR F;  2IXP A;  2NUT B;  3EHN A;  1U6H A;  1OW6 A;  5L0D A;  3NKE A;  5FZT A;  2B0H A;  3T4R A;  2NUP B;  4MND A;  2DGJ A;  3EQL F;  3W4Y A;  2J0W A;  4C3D A;  4CDA A;  4NY3 A;  4DBQ A;  5BQH A;  3S90 A;  4DBR A;  3OWT A;  1EKY A;  3BRJ A;  4BPM A;  1R5I D;  5DS6 A;  5CI8 A;  4N6C A;  1BR2 A;  2CW0 F;  3X2Q C;  4E17 A;  2M4E A;  2YL3 A;  1JAF A;  1PCX A;  4R32 A;  2L9J A;  1Z5Z A;  2C03 A;  4H54 A;  1AUE A;  2IBF A;  2EPN A;  2L6H A;  3I4U A;  1RKE A;  1CPQ A;  3EGD B;  2HV7 A;  3UGO A;  3W8I A;  4MVZ A;  3RF3 A;  4OIP F;  3B29 A;  3VRC A;  3TD7 A;  4JZA A;  3O55 A;  4JTC B;  2R7R A;  1A41 A;  1YVI A;  2H7B A;  2OJE D;  2YKZ A;  3S28 A;  3ZWI A;  5EHH A;  4C7O A;  1ZU5 A;  2W4B A;  4NC3 A;  3TJ5 A;  2LK4 A;  1EI7 A;  2A6H F;  1QSP A;  3FAP B;  3PCV A;  4LDQ A;  3LS0 A;  2KNH A;  1U0B B;  1LI5 A;  3MYF A;  1IZM A;  5BQG A;  1M2V A;  2L7A A;  4U5C E;  1H7I A;  5L3Q A;  5KYY B;  4OIQ F;  3IQT A;  1D0Z A;  2R7T A;  1Z23 A;  3A11 A;  1XZP A;  2ETS A;  2NSF A;  3ATP A;  4NTA A;  3S27 A;  4PR9 A;  4G7H F;  4ANJ A;  1BZ4 A;  2WZG A;  3S0X A;  1VB5 A;  1TWA A;  3LNM B;  3UNG C;  2HSB A;  1OXB A;  3K33 A;  3RVZ A;  4EWC A;  3ABM C;  4YT5 A;  1NFO A;  1QZX A;  2J9V A;  2LP4 A;  3GM3 A;  1Y6D A;  4C7O B;  2IYL D;  3DAG A;  4HFF B;  4IAO A;  3ABK C;  4Z9J A;  3U8P A;  1R4T A;  4MVR A;  1VLS A;  3HNL A;  3EG9 A;  5B1A C;  4BJ5 C;  2R7S A;  1BDJ B;  3MFN A;  3TOL A;  1E84 A;  3ZIB A;  1M2V B;  1JPN A;  3FHD A;  2LFF A;  5A6B D;  3AG2 C;  3SZR A;  4DRH B;  2RSE B;  3H2V A;  1YAR O;  3O39 A;  2ZD9 A;  4ULW A;  3EH1 A;  3V5Y A;  2XLW A;  2VAS A;  1G8X A;  1VLT A;  2FGY A;  2YL0 A;  3DWW A;  4XPY A;  3EZH A;  2EIK C;  1U89 A;  2Y39 A;  4XTK A;  3G4Z A;  3AQB A;  3NRH A;  2Q9C A;  3R2P A;  2A6E F;  3FMS A;  1JMW A;  3QW1 A;  3GOR A;  3Q7G A;  5T3T A;  2AU5 A;  2A0B A;  2UUH A;  3SEO A;  5KYU B;  1E83 A;  4JCZ A;  3EJN A;  2Z15 A;  1XWJ A;  1WN0 A;  4JTA B;  3VAY A;  2X51 A;  3LLI A;  1NLX A;  1J8Y F;  1YZC A;  2IXM A;  5F28 E;  1PD0 A;  1CGN A;  2J9W A;  5L3V A;  2KYH A;  3ABL C;  4PFO A;  2EPM X;  4K7B A;  2NUT A;  2Q9A A;  5COF A;  3DE9 A;  4E0I A;  2M64 A;  3AG4 C;  2OJQ A;  5JRA A;  3ZQV A;  5AC4 A;  1HE1 A;  2P0N A;  3GWN A;  1JOG A;  2R02 A;  2XLE A;  3KYJ A;  1XZQ A;  1H9G A;  3U9J A;  4MW8 A;  3UR3 C;  5JUA A;  2J46 A;  3IQC A;  5L0C A;  4M63 A;  1IW7 F;  3PMR A;  3SYN A;  3RQF A;  3DMD A;  3RVY A;  2DB4 A;  3QW0 A;  3DJN B;  3UMI A;  3NYJ A;  3K7D A;  1CPR A;  3LS1 A;  4CS8 C;  3E70 C;  4JW1 A;  1JR8 A;  3C8Z A;  3NYL A;  1MMD A;  1FTS A;  2GFH A;  2LQG A;  3NG1 A;  2KC3 A;  4EIY A;  4JTD B;  4P9T A;  4XEV A;  3LAY A;  3VM6 A;  4O6M A;  4EUK B;  1ZHZ A;  4K0D A;  1MNE A;  2VCC A;  4WJ0 A;  3W2W A;  4BJ6 C;  2Y3D A; 
#chains in the Genus database with same CATH homology
 1A7D A;  3WHN A;  1HMD A;  3AGT A;  1HMO A;  1I4Y A;  1A7E A;  2MHR A;  4XPY A;  2AVK A;  3AGU A;  2AWY A;  4XQ1 A;  4XPX A;  4XPW A;  1I4Z A;  3WAQ A;  2HMZ A;  2HMQ A;  2AWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...