2MI6A

Solution structure of the carboxy terminal domain of nusg from mycobacterium tuberculosis
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
GRPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIFGRETPVELTFGQVSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription termination/antitermination protein NusG
publication title Solution structure of the carboxy terminal domain of NusG from mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mi6A00
1KC8U 3CCUT 1YHQT 3PIPA 3J81E 3CCVA 3J80E 1VQKA 2E70A 3CXCS 3CMAA 2JNGA 2XHCA 3CCEA 1VQOA 1NPRA 3CC4T 1Q7YU 1VQMT 1VQ5T 2DO3A 3CCQT 1NPPA 1YI2A 2JVVA 3OW2A 2MWPA 1Q81U 5DM7R 1YJWA 1VQKT 5IT9E 1KHIA 3CCSA 1YBYA 2QA4A 3CPWS 1YJNA 1K73C 3CMAT 1VQPA 1W2BS 1VQOT 3CCET 5DLQE 1YITA 1QVGS 1YIJT 3CC2T 2JOYA 1VQLA 3LGLA 3A5ZB 3PIOA 3CCJA 3DB3A 1YJWT 2OTLA 1JJ2A 1VQ8A 1Q7YC 3CCMA 1K8AU 1KQSS 1M90U 3DLLA 2G3RA 1Q82U 1QVFA 3G4SA 4X34A 1VQNT 2OTJT 1UEBA 1VQ7A 3LGFA 1Q81C 1VQLT 3OYYA 3P8BB 3G71A 3I56A 3CCVT 3TREA 2EIFA 3CC7A 3CD6A 2KVQG 1XNIA 3CPFA 1N8RC 1VQ8T 4QQDA 1VQ9A 5HY6A 1N8RU 4ZN3A 1NZ9A 3G4ST 5IAYA 1S72A 1VQ7T 3G6EA 1Q86U 1YI2T 2JUFA 3CMEA 1M1KU 3OW2S 2L3RA 3ER0A 1K8AC 3CC7T 1VQ6A 1M90C 2IG0A 1Q82C 2MI6A 3CCST 1YJNT 3CCLA 2QA4T 1IZ6A 1XTDA 1VQ9T 1VQPT 1BKBA 2LQ8A 4YTLA 2CKKA 1YITT 1S72T 3DB4A 1YJ9A 1SSFA 3CXCA 3HKSA 3CMET 3CCJT 3CCRA 1VQ6T 4ZN1A 2OTLT 1JJ2S 3CCMT 3CCQA 1QVFS 1Q86C 1M1GA 1VQ4A 1YJ9T 5J3BA 1M1KC 1RL2A 1KD1C 3KBGA 1K9MC 3CPWA 3G71T 3I56T 1W2BA 2KDSA 3CCRT 1KD1U 3CD6T 1K9MU 2MWOA 1QVGA 5J26A 3I55A 2QEXA 1YIJA 3CC2A 5FLXE 2LVMA 1EIFA 4TVRA 3CCUA 1YHQA 5A2QE 1VQ4T 2E6ZA 3LH0A 3G6ET 3J7AF 1KQSA 4RG2A 3JAME 1NJIC 1X6OA 3CC4A 4CRIA 1K73U 1VQMA 5LL6S 1KC8C 2QEXT 3I55T 3CCLT 1VQ5A 1VQNA 1NJIU 2OTJA 2LCLA
chains in the Genus database with same CATH superfamily
2RHYA 1TUGB 1VQKA 2RI2A 2EYZA 2PUKB 3CXCS 3RKXA 2HQXA 4DBFA 3LWIA 2YUNA 2ABLA 1X43A 5GAOq 5GMKl 2HEQA 2X4WA 4C8QF 1MNDA 2QDLA 3OW2A 1GRIA 1IB8A 3M54A 1UGVA 2C0IA 2KRSA 4E7HA 4C0FA 1YIJT 4A4FA 3M0PA 4HCKA 5HKCA 3UWNA 4M78E 3VV0A 5FU6B 3E19A 1YFNA 2RQTA 1M90U 4LD9K 1GFCA 1IHWA 1JXMA 3G4SA 3SHWA 1V1CA 2DBMA 2LT1A 3CCVT 1PC0A 4NL2A 3N5BB 1QKXA 2GTOA 4NL3A 1BK2A 4FM4B 1BI1A 3CC2Q 4C92C 2BTTA 2EYQA 3G6EA 1M8VA 7AT1B 3ULRB 2DILA 5LJ5h 2IPOB 2L8DA 1ZBJA 1Q82C 2JW4A 2DD4A 1TSFA 4ZTJA 2NWMA 1WQ7A 3QBYA 2X9HA 3JCMd 3LW5E 2X4JA 4HXJA 5GAMh 2HSPA 4MZPA 1K8AR 1OPLA 2R5MA 3NTHA 3FDRA 2EYXA 2FZCB 1B34B 1Q86C 1M1GA 1ZA1B 1SPKA 1VQ7Q 1F1BB 4OB0B 1PRLC 3JCMW 4HVVA 5IXBA 3JB9I 5FLXE 2LVMA 4RTVA 4M7AG 5C6SA 3NPFA 3M57A 5LL6S 3VJPA 2LCLA 1OU8A 1YHQT 5L8RE 2LC4A 3VS5A 4FYXB 5FWBA 1UHFA 2CSIA 4M75G 5LJ3e 4RCCA 1WHKA 1WXTA 4C5EA 2MAMA 5EG2A 3BE3A 3A8OB 1UG1A 5LJ5d 1KG1A 2AT1B 2LQNA 3CPWS 4M75B 1WHMA 1OOTA 1AOJA 2K4YA 2R57A 2XD0A 2XK0A 1AHJB 2AHJB 2OAWA 2B86A 2K3YA 1LCKA 3NMZC 2EQUA 4AFQC 2RPNA 1X01A 1QVFA 4OMNA 2P0KA 4DEYA 2LCSA 4KGVB 4JDSA 1WHHA 3G71A 3TREA 4J9EA 2LQKA 5GAN3 2J6OA 3SB2A 3ZEHA 2MPXC 5HK0A 2COZA 1K8AC 2PQWA 2QGFB 3OYKA 4C0ZA 3F70A 4XK8E 4ELZC 2EWNA 1VQ5Q 1A0NB 2RJCA 1SSFA 2NUPA 3I5SA 4J9DA 3M0UA 4ME7A 1VQ6T 1EZZB 1KK7A 1M90R 1J3TA 1C1AA 2HKNA 1E6GA 1PNJA 2F2WA 3I56T 1NBEB 3JCMg 5IH2A 1M9SA 1VQPQ 1YIJA 1VQ9Q 2EGCA 3FLGA 2E41A 4QVZA 2OJ2A 3H0FA 1QVGP 2DJZA 2R58A 2HD0A 5CKFA 5GANf 3X28B 2RHIA 3FC3A 3CCVA 3LX7A 4N4GA 4ZNXA 2JNGA 3NGPA 3CCEA 1VQOA 4M7AF 2WSEE 2RNAA 2J7IA 3A1PA 3OYBA 1PKSA 2DIGA 1M1FA 1R77A 1OEBA 3E9FA 1W70A 2A36A 1CSKA 4M75F 4AT1B 2DXCA 2DEQA 3QSUA 1RLPC 3OS1A 1Z9ZA 1D1AA 3TVTA 5LJ5g 1WHJA 4OB2B 1JXOA 2KAFA 4IKFA 3S3OA 2OTJT 1VQLT 2V8JA 5GANj 3REBB 2EIFA 2X3WD 4PJOC 2M1HA 3RR6A 2WSCE 2K9GA 2PU9B 5IAYA 2D8JA 5GAN8 4XTZA 1HYOA 2KYMA 4C92D 2ECZA 1BCOA 1X6BA 1M90C 2DF6A 1XTDA 3WVDB 2V1RA 1UDLA 2CKKA 2CP7A 4XTVA 5I2MA 3OYFA 3VS3A 2GFAA 1G83A 3EG9A 4DBRA 2AK5A 4PJOA 2DL4A 3U23A 1V29B 2M02A 1YN8A 3MEWA 3HP9A 4X9CA 5D6YA 4LN2A 3JB9G 2EYYA 2FZKB 3OY9A 1QCNA 2G6FX 2CREA 4DOWA 1BBZA 4II1A 3CCRT 1YNZA 5FROA 2HSEB 2QEXA 3C0CA 4M78A 3HPWA 3FJPA 1G2BA 1G3SA 4IUPA 4E6RA 4C8QC 4X9DA 3HSBA 3IQLA 5A0DA 1X6OA 4DQ2A 1HD3A 1PWTA 4AFUC 5KYUB 1GCQC 4HA8A 5D7UA 3GP8A 4J9GA 2E70A 2DD5A 3R6OA 2ZPIB 1XOVA 1NPRA 1WZOA 2DO3A 3CCQT 3G6EQ 2PUOB 1RI9A 1W2BP 4OP0A 3KXTA 1BIAA 1AWWA 1WJSA 1RAGB 2EQMA 1ZX6A 3QWXX 2DYBA 1CKBA 3CCUQ 1I81A 2NLUA 3OW2P 5D6XA 2XDPA 2HDAA 3DB3A 2NUTB 3L2WA 1JJ2A 2CP5A 2ENMA 4BACA 2CZ6B 2CP6A 2P4RA 3I35A 2KMTA 1UEBA 1VQ7A 4C5IA 3OYYA 2DKGA 3I56A 2JM8A 1M2VA 1PG5B 1W1FA 3QPHA 4C92E 1XNIA 2RQWA 2D6FA 3QG1A 4C5HA 1NZ9A 4OMOA 4M77B 1D1BA 3H0IA 5LJ3h 2M0YA 2X4XA 2Y4YA 1N9SA 1GBQA 3ER0A 1Y07A 2IIMA 1YJNT 1UTIA 5KCHA 1PD1A 2COYA 5FU7C 4RG8A 3VS0A 3OS2A 1S72T 3CQTA 4JJCA 1H8KA 2LTOA 4Z8AA 1VIEA 3CCMT 1W6XA 3FRNA 1UJ0A 2EKHA 2EPDA 4FT2A 1K9MC 2BE7D 2EW3A 3EG2A 2YUQA 4RTZA 1X27A 4PFPA 3H9NA 3JB9F 1VQ4T 1JB0E 1T3SA 2DL5A 2VYTA 4GLMA 2DNUA 2VUBA 5KYYA 1D3BA 3PTAA 4CRIA 1K73U 1KC8C 3A8GB 2OTJA 1I5LA 1JO8A 3KUFA 4A54A 4OMMA 2CH4A 1TH7A 2JTFA 2Y90A 4M77D 3WVEB 3G71Q 3QXEB 3EHQA 4F14A 5FU6C 4M7DG 3CC4T 2EAYA 4E7IA 2F5TX 1B07A 2DA9A 5HCKA 3OMCA 3VS2A 1VOMA 1QLYA 2HL3A 5KCOA 3G7ZA 4M78G 2DFUA 4M7DB 4CC7A 2JOYA 3PE0A 4HCCA 2O9VA 2J6FA 2FPEA 4J8OA 2RJEA 2RK2A 4JUVA 3OYDA 1LVKA 4MMKA 1B7TA 3A98A 4QVCA 1BI3A 4X34A 1C0MA 2KXDA 2ATCB 1BYMA 1U8RA 1VQ8T 2FO0A 1VQ9A 3NFCA 4E7KA 5GMKe 1YIJQ 1NYFA 4C0GA 2XKOC 1U1SA 1YI2T 2HL5C 4LUDA 4J9IA 2LQWA 1ABOA 3CCST 1OV3A 1BKBA 2RHZA 1KFZA 4FIBA 2ZCFB 1NEBA 3CMET 3CCVQ 2YT6A 4XQ3A 4DBHA 5GAOr 2YUOA 3MO8A 1ZSZB 2ZPBB 3CCQA 4RUGA 4F7UE 1B34A 2KY9A 1UHCA 2L3SA 2GF7A 4R55A 2ED1A 2X35A 3GF5A 3META 4DA4A 1MMGA 2L3PA 1N9RA 2HKQB 2MK5A 2GCXA 3E1SA 1S1NA 3EHRA 3SWNB 1AZGB 3SDZA 3CMAA 4WTOB 1BB9A 4PJMA 4J7IA 4B6MA 3C12A 3HHTB 1RACB 4KT0E 4ZTFA 1Q86R 2ESWA 3QJYA 4KUIA 1YJNA 1IGUA 4J7FA 1W2BS 2R5AA 2KSSA 2HBPA 2Y4XA 2RQRA 2O4XA 4RCBA 1RAAB 4M7DF 1H3ZA 3EGXB 5GAOm 3L2UA 4OGEA 2X3XD 2DXTA 2JS0A 3CCMA 3UA6A 1KQSS 4M78F 2GNCA 3HTRA 4A4EA 4BE1A 1VQNT 4PJOE 2DE0X 1EFNA 3I5RA 1GFDA 1TWBA 1N8RC 1GL5A 8AT1B 3OA6A 4Q5WA 4B9WA 2QEXQ 2AZSA 3A8MB 2CZ1B 1M1KU 1M27C 3LH5A 3JCMQ 2YSQA 2QI2A 3OSVA 4F17A 5I21A 5A0LA 3CEYA 2LX9A 1WFWA 4IIMA 3CXCA 2YHTA 1KHCA 2DTHA 2FVUA 3EH2A 3A8LB 2OTLT 1NE8A 4DOVA 4IIOA 4HKEA 3GBQA 1LOJA 3MEAA 5GANh 2D0NA 1YJ9T 2B8AA 5J3BA 1RL2A 1U1TA 2RM4A 2M16A 4J83A 1VYUA 3VRZA 4C8QE 1MUZA 5J26A 3I55A 3CCUA 2E6ZA 2KNBB 4RTYA 1D1CA 2BZ8A 1PD0A 4JRPA 2K79A 4C92A 4QQ6A 3DLMA 1FXXA 4E7ZA 3JB9H 3I56Q 2LJ3A 2XHCA 1SRMA 2D0QB 4CC4B 2EJFA 4XU2A 2RJDA 3E9GA 1NPPA 2LMJA 1YI2A 1AWOA 2KRNA 4XTUA 3SFMA 2CZ7B 1YJWA 1Y7XA 2OX7A 2KT8A 3CCSA 4JRIA 1K73C 3MPUB 3RMQA 1PKTA 2DAQA 4E7SA 4L59A 2WSFE 1R0BG 3VYGA 1E7OA 4RMOA 4BB7A 4LNPA 1TUCA 2JMAA 3GNFB 1Y96A 4M7AB 5A0GA 2JM9A 2K6DA 1IXDA 1WLPB 3RMSA 2YUPA 3GIBA 2E5QA 3FJ5A 4J5YA 2P84A 1X75C 2DTIA 5HY6A 2EJ9A 4ORZA 4OF1A 1C6VX 4JJDA 4RTWA 2DYIA 3JCMJ 1QCFA 1TTHB 3RKYA 5GAMd 1VYTA 1QWEA 3EFOA 2QQBA 1VYVA 2IG0A 2MI6A 4C0DB 1ZUKA 2QA4T 5KYWB 2OTJQ 2KR3A 1TU0B 1TXQA 4JZ3A 3DB4A 3MP1A 3FB9A 4DBQA 1OPKA 2SEMA 4PL6A 4OMQA 5CO7A 4IUTA 4A4GA 2LZ6B 3ZL7C 3BY7A 1ZUUA 1V76A 1BU1A 1SKUB 4ZGJB 2RK1A 3G1JA 1JRIA 3CPWA 1MMAA 1H92A 2LRQA 1K9MU 4J9CA 1MHNA 4E7LA 1WXBA 3M4GA 2KGTA 2FL7A 1Y57A 3RDVA 4M7AD 5GAN2 1MMDA 4PJNA 1M1KR 5GMKh 1X6GA 4FW2A 2KT1A 1D0YA 2O31A 3OS0A 3VRYA 1NG2A 1WNLA 1VQNA 4BY6B 3JCMf 2RQUA 1KC8U 4M75D 1KSWA 2E3HA 3J80E 2FEIA 4HCBA 4JS4A 4IUUA 2CGHA 2ROTA 2JMCA 3M5AA 4MDXA 3PMTA 4K11A 2EBPA 2XICA 3D7SB 5J39A 1VQMT 2A0FB 2CP0A 1UGRB 3NTIA 5DM7R 1Q81U 4FYYB 3AT1B 1JBMA 1XQHA 2W10A 2F2XA 1IGQA 3GNGA 3VU3C 3M4YA 4HCZA 4M77C 2CS7A 2NUTA 4F7UA 2VKNA 2OTLA 2X51A 3VKIA 2EGAA 3CCQQ 3LWHA 2AIRB 2ZPFB 2EJGA 5GAOp 3O5ZA 2CT4A 2P4TA 1JQQA 4M77A 1RAIB 4OGCA 4ANJA 4FW1A 4PNOA 5LJ5f 3JCMb 4J6WA 2JUFA 2YXYA 2K2VA 4L5GA 2L3RA 3CC7T 2PVGB 3PFSA 4FSXA 4EMKC 1WI7A 2A08A 3JRZA 2A3LA 4QVDA 2ZPGB 2DRMA 4HVWA 2ZPHB 3CMAQ 5GAMg 2DX1A 3KFVA 1YWPA 2RH2A 3QYHB 1M1KC 2KXCA 4EMKA 2KDSA 3EAEA 2DLPA 1YJNQ 1Y71A 4BI4A 1TS9A 1YHQA 1S72Q 3QZ5B 3HFOA 4M75E 4PKCC 1QP3A 5CQYA 5LJ5j 2DMOA 3CCMQ 3CCLT 4Y28E 4KBMB 4OMPA 2I2LA 5KYNA 5GAMj 4MZTA 3MHXA 3RIRA 5GMKm 2H8HA 1ZHIA 1WIEA 2C0TA 4MDWA 2LT4A 1VQ5T 2DBKA 1VQ4Q 3R6NA 5IT9E 1YBYA 2QA4A 2CUBA 2YDLA 3ME9A 1K9MR 1I1JA 2EVRA 1XJWB 5DLQE 4J6XA 4RKUE 4EPCA 2PTKA 5CR2A 3M0SA 4A4KA 4KGZB 2K5LA 1SHGA 3M56A 1AD5A 1RADB 2O2OA 5EC7A 2DERA 3CC4Q 1I5OB 1WHGA 2BZYA 3MP8A 3QZ9B 2QYZA 4PJJA 5M9OA 1UUEA 1KC8R 2NUPB 4C8QA 4JLIA 4JRKA 5KYXA 2RI3A 3S3MA 1SEMA 1N8RU 3I55Q 1ZSZC 1GCQA 2VGNA 3M9QA 1WX6A 2DXBA 1Q81R 4L6V5 4X1VA 2M0OA 1VQ6A 2E12A 5GANe 2E4HA 1YCSB 1FYNA 1IO6A 1IZ6A 2PVOB 1HK9A 3EG1A 3VYHB 4JZ4A 3JB9D 2ZAEA 3CBOA 1O75A 3CXCP 4D6WA 2ZPEB 1YI2Q 2QG9B 2O01E 1YJWQ 1R8OB 2AKKA 2C06A 1ARKA 3CCSQ 2SRCA 3OYAA 4PK4A 1ABQA 5A2QE 1E6HA 3J7AF 2YRCA 1WA7A 2JTEA 3JAME 3VS7A 3M0RA 2I0NA 1NJIC 2CDTA 2RA2A 4EMHA 2F1LA 1WJQA 3EG0A 5AYFA 2EQKA 1G3TA 1KQ2A 2X4YA 1LPLA 1RAFB 1VQKT 2MIOA 3C4SA 1QVGS 3X25B 2D9TA 1ACMB 2DTOA 1VQLA 3M59A 4PJOG 3UPUA 2L5QA 5FRMA 2DZ9A 2ROLA 2DZCA 1UJYA 2J05A 3VS4A 5LJ3d 4KUDK 4ATOA 1PHTA 1Q81C 4D8DA 3UF4A 3OYMA 3M53A 1YWOA 1W4SA 4JRQA 3G4ST 3L1AA 2E5KA 4D8KA 3EFRA 1UE9A 4IUQA 1WYXA 1PCXA 3CCLA 1NLPC 4M78B 2HMAA 1VQNQ 2ED0A 3REAB 2GGRA 2JJ9A 1AT1B 1BCMA 3UA7A 2L0AA 3CCRA 5ECAA 3M58A 1QVFP 4F16A 3QKJA 4EMGA 4N4IA 3EGDB 1KD1C 3JV3A 5GAN7 2K5FA 1PSEA 4LDXA 2QQ9A 1QMCA 2JS2A 2QK0A 1N8RR 2FRWA 5GAOn 3JCMV 4TVRA 2J06A 3V8KA 4PLLA 1OULA 1K1ZA 4MMLA 2OTLQ 2CT3A 2CSQA 4GY5A 3QIIA 4WF2A 3MEVA 4J6YA 1X69A 2KK4A 4C5GA 1YJ9Q 3PIPA 4M7DD 3JSCA 5KE3A 4ELYC 3GPLA 4FL6A 4M7AC 3OYLA 4JJNK 2XDDA 1UFFA 4XTXA 4M78D 2L3QA 2KE9A 1U5SA 4M77E 1KHIA 2RO0A 1IHVA 2JXBA 4Z88A 4M75C 4J9FA 3OYJA 3URGA 4M4ZA 2V8IA 4XAXB 3UT1A 2JZ2A 4HVUA 2M51A 2VXFA 1SG5A 1X2KA 2G3RA 1M30A 1TG0A 1UECA 2A37A 2J6KA 3HRSA 5FW9A 1NLOC 4PJOF 2KVQG 5I22A 4J9BA 2PZ1A 4M75A 1MV0B 2KEAA 1S72A 4OMFB 4PJLA 1YHQQ 3RKWA 1BI2A 5LJ3g 3BW1A 3OW2S 2KYBA 1QW1A 1K73R 1M5Q1 2CP2A 2XDBA 3S6WA 4PLIA 4FU6A 3PNWC 3L2RA 3EH1A 1H3HA 1D3BB 2KQWA 3M55A 1MMNA 4QKUA 4CC3A 1P92A 4A63B 4BE0A 2E64A 1NYGA 4P5NA 4NOYA 2KRMA 1Q95G 4BDZA 2YRDA 1VQ4A 1IRXA 3JCMh 4BY6C 5CAIA 4KH1B 1WHLA 3H8ZA 2HBWA 1W2BA 1ZUYA 1H641 4E7JA 3CD6T 3Q1JA 5AT1B 2MWOA 2QA4Q 2K57A 5GJVB 3RERA 5LJ3j 3LH0A 2RF0A 1SHFA 4M7DE 1AWXA 1KQSA 3V7CA 3CC4A 3PMIA 2VXEA 5IXFA 2XMFA 4EDUA 2QQAA 4O5VA 3MKDA 2VV5A 2DK3A 3M0QA 1R0CB 1WDXA 1FMKA 3JCMc 2HCKA 2V8KA 1WXUA 4KGXB 5FRNA 2Z0WA 4Y92A 3RNJA 5KE2A 1ZSGA 2DL8A 5IHIA 3V7RA 3C95A 1VQ6Q 3CCET 1VQOT 4XTYA 5I2SA 2NYSA 4HT8A 2FZGB 4WCIA 1OZ2A 5CVIA 4JJBA 2H3EB 2KBTA 3QDFA 3JCMP 1WQWA 2VB6A 2L89A 1VQ8A 5DLOA 4RTXA 4HT9A 1LNXA 1VQMQ 4MZMA 5IN1A 1QP2A 3P8BB 1N5ZA 5CK9A 2LNHB 2MYSA 3CPFA 1PSFA 2DPPB 1QCOA 1M2OA 4NS5A 3MP6A 4LXCA 3X26B 1GCPA 2EQIA 4V2SA 1MGQA 3CMEA 3TU4K 2KROA 3OS5A 3QUIA 3NTKA 3GLXA 2OAUA 1YCYA 1OX9A 5GANd 1YITT 2XI9A 2E1HA 4OB1B 5CQXA 5GAN6 1AEYA 1D09B 1U06A 3CCJT 4KRTA 4PFOA 4ZN1A 1JJ2P 2HZYA 3QWYA 2FG0A 1AWJA 1QVFS 3L42A 4IUVA 1AVZC 5IHKA 3FIFA 2RB6A 3CC7Q 3HFNA 3I9QA 2K5IA 2FPDA 1UB4A 2E6NA 2OI3A 2QQSA 2MOXA 2HQEA 1VQLQ 5CKEA 1I4K1 1HXDA 1OQKA 1B3QA 3EG3A 1VIFA 2QEXT 2DVEA 2O4XB 1NJIU 2PVDB 4LDUA 2V26A 2EYWA 3P8DA 1KQ1A 4RTTA 4A53A 1M3AA 1TOVA 3OQ5A 2YLCA 2HQHA 2FYKA 1FMWA 3JCMX 4B9XA 2D1XA 2VC8A 2MWPA 3ZBDA 2DVJA 3CCLQ 1YP5A 5KYUA 3CC2T 5GMKi 3A5ZB 5GAN4 2EQJA 1FMVA 3PIOA 4RTUA 1VA7A 1DJ7B 4PFZA 2BIVA 3CCRQ 1SRLA 3DLLA 3MEUA 3VUBA 3QHSA 3LGFA 9ATCB 4GLKA 2HNIA 4UC4A 3CD6A 2L2PA 5FWCA 8ATCB 4CI0C 3CBMA 3HL8A 1PRMC 4QQDA 2QGGA 1RUWA 2DIQA 3ASKA 1VQ7T 2MF2A 1G8XA 3S3NA 1KJWA 1WJRA 1OZ3A 3PVLA 4C92G 2D8HA 4YTLA 3VS6A 2CH4W 3E2UA 2CP3A 2P0QA 5DY9A 3QO3A 1YJ9A 2QQRA 3OYHA 3HKSA 1N6AA 2A7YA 1SF9A 4XU1A 4O6JA 4C92B 4R56A 2HAXA 3THKA 1EX4A 3TQ7P 2BUDA 3KBGA 5GANg 4F04B 2BZXA 5CKBA 3T9NA 1KD1U 2RMOA 2CZ0B 4AFSC 3EFSA 5GAMf 5I11A 4XU0A 2DL3A 3OBWA 4FT4A 4R0KA 1ZLMA 3H41A 1I0CA 4BE2A 4OMLA 3AHUA 1VUBA 6AT1B 5C0MA 4N4HA 3P8HA 1FX7A 2E10A 3SEMA 4M7AE 2LP5A 3NHNA 4BI3A 4FCYA 3UATA 1Y96B 1Q7YU 4LDYA 1D0ZA 2XU8A 4AG1C 2DEUA 1PM3A 2CUDA 4FSSA 3PGGA 1QQJA 4LE9A 2MMPA 1YITA 2COWA 1RABB 4BDYA 3V8JA 4M7DC 3CCJA 2BKDN 3EFOB 1RAHB 5GAOl 3TEEA 1NJIR 4M78C 2M9UA 1VQKQ 1WPYA 1U3OA 1MNEA 2YRVA 1JU5C 4M7DA 2DXUA 1I8FA 4LUEA 2AKLA 2FRYA 1GXIE 1KIKA 2RD1A 1G3WA 3MJXA 2QDYB 2EKOA 1NEGA 2GQIA 2YLBA 2DJQA 3JCMe 2QAZA 1VQ9T 1VQPT 2JT4A 3OMGA 1K9AA 2DRKA 2F69A 2ZGWA 1OYXA 2BE9B 1HJDA 1JJ2S 1G3YA 4C92F 2FHDA 3G4SQ 2AZVA 2H3JA 3EGDA 3PT9A 3FEOA 5IHNA 3DKMA 1AZEA 2K7AA 2QXFA 3OB9A 5CIUA 3A8HB 3CC2A 1UGSB 2QASA 4AFZC 2V1QA 3SD4A 1EIFA 4Y91A 4F7UG 3LLRA 1QWFA 1ZQ1A 1VQ8Q 2LDMA 1VQMA 1ZSZA 1D0XA 3H0HA 1T0JA 3X20B 4CC2A 3J81E 1BI0A 3ZFJA 1M3CA 2DM1A 4F7UB 1KQSP 3SWNC 3OSSC 3M0TA 4M77G 5LJ5e 4VUBA 1X2QA 3WXMB 3L2QA 2JVVA 4LDWA 4ZGDB 4OB3B 3CMEQ 1MV3A 4LD6A 3L2VA 1KD1R 3CMAT 2GTJA 4E2FB 3HRUA 1NM7A 5GAMe 2FPFA 1GBRA 2QTVA 3TSZA 3SWNA 2MCNA 1FWZA 4E47A 3VS1A 5GMKj 2FB7A 3QYGB 4QT7A 4QQGA 1Q82U 2JN0A 2PNIA 4JPBW 5D6WA 3V8LA 3V7SA 2RQVA 3OBYA 3EGUA 2JTMA 3CC7A 1HSQA 1N27A 1Q7YR 2LNVA 1T0HA 4XU3A 3EGXA 1CKAA 1Q86U 2VGMA 5CKDA 4AG2C 3RBBB 4EMKB 3TSWA 3HRTA 2LJ1A 3X24B 2K3BA 1TUDA 4N0AC 1T3LA 3OYIA 2GFUA 3EG9B 2C0OA 3QDRB 3QJ6A 4PJOB 4Z89A 2GQVA 1WGSA 4OVAA 4XTWA 3OYGA 2ZZDA 4LDVA 1QVPA 4ESRA 4A4HA 4KH0B 5KH6A 1QVGA 3BFMA 4N0AA 3OYNA 5GAN5 3H6ZA 5HK3A 3TCJA 1K0XA 3G6ET 1I07A 4ZGEB 1G5VA 3LYIA 1UGQB 1M4ZA 2O9SA 4JLGA 3I55T 1VQ5A 2VVKA 4C8QG 3CCUT 2P0PA 1JEGA 3GOXA 4F7UF 1SSHA 2EGEA 3RESA 2RI5A 3CD6Q 2RN8A 2XG8D 2VASA 4C8QB 5KYXB 1QKWA 3PVQA 3CPWP 3BDUA 4QW2A 3RUXA 1O9SA 1VQPA 4BUGA 3L2ZA 4J9HA 4M77F 4JS5A 4PJOD 1UGPB 2WACA 1M8MA 3LGLA 3MCAB 1OX8A 1ZA2B 2LX7A 1YJWT 1RAEB 2E65A 1Q7YC 1K8AU 1LJOA 2RJFA 2IVWA 4FYWB 1Y0MA 1M2VB 3CBPA 2F2VA 3CCEQ 1VQOQ 2F5KA 4ZN3A 2QTXA 2RHUA 2DL7A 1K76A 2YWWA 2K3XA 2EFIA 2NUZA 3OYEA 3C94A 1K0SA 4IURA 1M3BA 4GBQA 4BI8B 2O88A 2CYZB 5GJWB 2XIDA 4M7AA 1RLQC 4KULA 2LQ8A 4C0DC 2DETA 3BDLA 3UDCA 3O8VA 5CKHA 4C8QD 3JB9J 1Q82R 4Z02A 2E3IA 1RI0A 5LJ3f 2GBQA 5CCAA 1OI1A 1K4US 1OU9A 2LJ0A 1ZBXA 3VUZA 1IREB 3G71T 4BD3A 4AMCA 4EIKA 5FU7B 5KYWA 3OYCA 2LCCA 2K2MA 1YITQ 1Z9QA 5L23A 3INZA 3CCJQ 4DEXA 2KI7A 4RG2A 5KYYB 2VWFA 2W0ZA 4FYVB 2RHXA 2A28A 1BIBA
chains in the Genus database with same CATH topology
2RHYA 2I2LA 3KUFA 4LDUA 4A54A 1TH7A 1KQ1A 3P8DA 4A53A 2JTFA 1VQKA 2RI2A 2Y90A 4M77D 3WVEB 2PUKB 3CXCS 3RKXA 2HQXA 3OQ5A 3QXEB 4MZTA 2YLCA 3MHXA 3RIRA 5GMKm 5GAMj 3LWIA 5FU6C 4M7DG 3CC4T 1ZHIA 2EAYA 4E7IA 4MDWA 2FYKA 2LT4A 1VQ5T 3JCMX 5GAOq 4B9XA 5GMKl 2F5TX 2X4WA 2VC8A 4C8QF 3OW2A 2MWPA 3ZBDA 5IT9E 3OMCA 1YBYA 5KCOA 2QA4A 3G7ZA 3ME9A 3M54A 4M78G 4E7HA 5DLQE 4J6XA 4RKUE 4C0FA 4EPCA 4M7DB 1YIJT 3CC2T 5GMKi 2JOYA 4A4FA 5CR2A 3A5ZB 5GAN4 4HCCA 2EQJA 4A4KA 3PIOA 2K5LA 3M56A 5HKCA 3UWNA 1NJIU 4J8OA 2RJEA 2RK2A 1DJ7B 4JUVA 2BIVA 4M78E 5FU6B 3VV0A 4MMKA 3OYDA 3E19A 1M90U 4LD9K 3DLLA 3MP8A 3MEUA 3QZ9B 4QVCA 3VUBA 3G4SA 1BI3A 4X34A 5M9OA 3QHSA 3LGFA 4C8QA 4JLIA 4JRKA 1BYMA 4GLKA 2LT1A 2HNIA 3CCVT 4UC4A 3CD6A 2RI3A 1U8RA 4NL2A 3N5BB 4CI0C 1VQ8T 3CBMA 3HL8A 4NL3A 4QQDA 3S3MA 1VQ9A 3NFCA 1N8RU 4E7KA 2DIQA 5GMKe 4FM4B 1BI1A 3ASKA 4C0GA 2VGNA 3M9QA 4C92C 1VQ7T 2EYQA 3G6EA 1M8VA 2MF2A 2XKOC 1U1SA 1YI2T 2DXBA 3S3NA 5LJ5h 1WJRA 4L6V5 2M0OA 2L8DA 1OZ3A 1VQ6A 1Q82C 2DD4A 2E12A 5GANe 3CCST 4C92G 1IZ6A 2PVOB 4ZTJA 1BKBA 4YTLA 1WQ7A 1HK9A 2P0QA 5DY9A 2RHZA 3QBYA 3QO3A 1YJ9A 2QQRA 3JCMd 4FIBA 3LW5E 2ZCFB 3OYHA 2X4JA 3HKSA 1N6AA 3VYHB 5GAMh 3CMET 2A7YA 4XQ3A 4MZPA 4XU1A 3JB9D 5GAOr 3MO8A 2ZPBB 2R5MA 3NTHA 3CCQA 4O6JA 4C92B 3FDRA 4F7UE 1B34A 4R56A 3CBOA 2HAXA 1O75A 1B34B 1Q86C 1M1GA 2KY9A 4OB0B 4D6WA 2ZPEB 2GF7A 2BUDA 2O01E 3KBGA 5GANg 3T9NA 5CKBA 3JCMW 1KD1U 1R8OB 4R55A 2C06A 2CZ0B 2X35A 3JB9I 3OYAA 1H3ZA 3GF5A 3META 2LVMA 5FLXE 4DA4A 5A2QE 3EFSA 5GAMf 4XU0A 3J7AF 3OBWA 1N9RA 4FT4A 4M7AG 3JAME 4JJNK 4BE2A 1NJIC 5C6SA 3AHUA 1VUBA 3M57A 2GCXA 3E1SA 5LL6S 3VJPA 2RA2A 2LCLA 4EMHA 5C0MA 4N4HA 1YHQT 3P8HA 5L8RE 1WJQA 3SWNB 2LC4A 1FX7A 2E10A 4M7AE 3SDZA 4M75G 5LJ3e 3CMAA 5AYFA 4BI3A 2EQKA 4RCCA 1Y96B 1Q7YU 4C5EA 1G3TA 1KQ2A 2X4YA 2MAMA 4LDYA 4J7IA 3C12A 2XU8A 3HHTB 5EG2A 3A8OB 4KT0E 5LJ5d 1KG1A 4ZTFA 1VQKT 3PGGA 3QJYA 4KUIA 1YJNA 4J7FA 3CPWS 1W2BS 4M75B 2R5AA 2KSSA 2HBPA 2Y4XA 2MMPA 3C4SA 2O4XA 4RCBA 2K4YA 2R57A 3X25B 2XK0A 2D9TA 4BDYA 1YITA 2XD0A 1AHJB 2DTOA 1VQLA 2AHJB 5GAOm 3M59A 3V8JA 4M7DC 3CCJA 4PJOG 3UPUA 2L5QA 3L2UA 5FRMA 4OGEA 2BKDN 2DZ9A 2DXTA 2K3YA 5GAOl 3TEEA 2EQUA 3CCMA 4M7DF 1KQSS 1X01A 2DZCA 1QVFA 4M78F 2P0KA 4A4EA 4BE1A 5LJ3d 1VQNT 4KUDK 4PJOE 4ATOA 4JDSA 4M78C 1Q81C 2M9UA 3G71A 1WPYA 3TREA 3OYMA 3M53A 1N8RC 2YRVA 2LQKA 1W4SA 5GAN3 3OA6A 4JRQA 4Q5WA 4B9WA 4M7DA 3G4ST 2DXUA 1I8FA 3L1AA 1GXIE 3SB2A 3EFRA 4IUQA 3A8MB 2CZ1B 2RD1A 1M1KU 3ZEHA 5HK0A 1G3WA 1K8AC 2PQWA 2QDYB 2EKOA 3JCMQ 3OYKA 2YLBA 4C0ZA 3CCLA 2QI2A 3F70A 3OSVA 4XK8E 3JCMe 1VQ9T 3OYEA 4ELZC 1VQPT 2EWNA 5I21A 4M78B 5A0LA 3OMGA 3CEYA 2RJCA 1SSFA 2LX9A 3CXCA 2F69A 2YHTA 2ZGWA 1OYXA 3CCRA 1KHCA 2DTHA 2FVUA 4ME7A 1VQ6T 3A8LB 2OTLT 1NE8A 1JJ2S 4DOVA 3M58A 4HKEA 1G3YA 3QKJA 2FHDA 1LOJA 4C92F 4EMGA 2H3JA 3MEAA 5GANh 3PT9A 4N4IA 1YJ9T 2B8AA 5J3BA 1RL2A 1KD1C 3FEOA 1U1TA 5GAN7 2K5FA 3DKMA 1PSEA 2RM4A 3I56T 3JCMg 4LDXA 2M16A 2QXFA 3OB9A 5CIUA 3A8HB 4J83A 1M9SA 2QQ9A 4C8QE 5J26A 3I55A 1YIJA 3CC2A 1UGSB 5GAOn 3SD4A 3JCMV 1EIFA 4TVRA 3CCUA 3FLGA 4Y91A 2E41A 2E6ZA 3LLRA 4PLLA 4QVZA 3V8KA 4F7UG 4JRPA 1ZQ1A 4MMLA 2DJZA 2R58A 2LDMA 3QIIA 4GY5A 3MEVA 2HD0A 4J6YA 4WF2A 1VQMA 5CKFA 5GANf 3X28B 4C92A 2KK4A 4QQ6A 2RHIA 3DLMA 1FXXA 4C5GA 3FC3A 3X20B 3PIPA 3J81E 3CCVA 3LX7A 4N4GA 1BI0A 3ZFJA 3JB9H 4F7UB 4M7DD 3SWNC 2JNGA 3JSCA 2XHCA 5KE3A 3OSSC 4ELYC 3CCEA 1VQOA 4M7AF 4M77G 2D0QB 2WSEE 3GPLA 2EJFA 4FL6A 5LJ5e 4XU2A 4M7AC 4VUBA 2RJDA 3E9GA 1NPPA 3WXMB 2XDDA 3OYBA 3OYLA 2JVVA 3L2QA 2DIGA 4LDWA 1M1FA 4XTUA 4ZGDB 1YI2A 3E9FA 4OB3B 4XTXA 2CZ7B 3SFMA 4M78D 1YJWA 1Y7XA 4LD6A 3L2VA 4M77E 1KHIA 2RO0A 4JRIA 3CCSA 1K73C 3CMAT 3RMQA 4M75F 2DAQA 4L59A 3HRUA 5GAMe 2WSFE 4M75C 2DXCA 2DEQA 3QSUA 3OYJA 3SWNA 3VYGA 3URGA 1FWZA 3OS1A 2V8IA 4E47A 4RMOA 4BB7A 4XAXB 3UT1A 2JZ2A 3GNFB 5LJ5g 5GMKj 2FB7A 3QYGB 2VXFA 4QQGA 1Y96A 1Q82U 2G3RA 2JN0A 4M7AB 4OB2B 5A0GA 2KAFA 4IKFA 5D6WA 3S3OA 2OTJT 3HRSA 3V8LA 3V7SA 3OBYA 1VQLT 2V8JA 5GANj 2JTMA 4PJOF 3RMSA 2EIFA 3CC7A 2KVQG 3GIBA 2E5QA 1QVGS 4J5YA 4M75A 1N27A 1X75C 2DTIA 2M1HA 4PJOC 5HY6A 2LNVA 2EJ9A 2WSCE 2PU9B 5IAYA 4XU3A 4OF1A 1S72A 4OMFB 3JCMJ 5GAN8 4XTZA 3TU4K 1Q86U 3RKWA 2VGMA 1BI2A 3RKYA 3BW1A 5CKDA 5LJ3g 5GAMd 3OW2S 4C92D 4EMKB 1QW1A 1M90C 2QQBA 2IG0A 2MI6A 4C0DB 3HRTA 2QA4T 1XTDA 3WVDB 1M5Q1 2CKKA 4XTVA 5I2MA 3X24B 3DB4A 3MP1A 3OYFA 3FB9A 3S6WA 4FU6A 4PLIA 3PNWC 4N0AC 3L2RA 2XDBA 2GFAA 3OYIA 2GFUA 4PL6A 4PJOA 1D3BB 3QDRB 3QJ6A 2KQWA 4PJOB 3M55A 5CO7A 4IUTA 1P92A 1V29B 4A4GA 3MEWA 3HP9A 2E64A 2GQVA 4X9CA 5D6YA 3BY7A 4BE0A 1WGSA 4P5NA 4OVAA 3JB9G 4NOYA 3OY9A 4BDZA 1VQ4A 4XTWA 4DOWA 3JCMh 2ZZDA 4ZGJB 4BY6C 5CAIA 4II1A 2RK1A 3OYGA 4LDVA 1JRIA 3H8ZA 3CPWA 1QVPA 1W2BA 1H641 4E7JA 4A4HA 3CCRT 2LRQA 5FROA 1K9MU 3CD6T 3Q1JA 2MWOA 5KH6A 1MHNA 4E7LA 1QVGA 2QEXA 2K57A 3M4GA 3BFMA 2FL7A 4M78A 4N0AA 3OYNA 3HPWA 5GAN5 3RERA 3H6ZA 4M7AD 5LJ3j 3FJPA 3TCJA 5HK3A 3LH0A 5GAN2 1G3SA 4IUPA 5GMKh 4ZGEB 4C8QC 3G6ET 4M7DE 4X9DA 3HSBA 1KQSA 1G5VA 3LYIA 1UGQB 3V7CA 5A0DA 3OS0A 1X6OA 1M4ZA 3PMIA 2VXEA 1WNLA 4JLGA 4DQ2A 3CC4A 3I55T 1VQ5A 4EDUA 1VQNA 2QQAA 4O5VA 4BY6B 3JCMf 4C8QG 1KC8U 3CCUT 2VV5A 4HA8A 2P0PA 4M75D 2DK3A 3J80E 3GP8A 3GOXA 4F7UF 4JS4A 2E70A 4IUUA 4HCBA 2DD5A 3R6OA 2CGHA 3RESA 2RI5A 3M5AA 3JCMc 3PMTA 2ZPIB 4MDXA 1XOVA 2XICA 5J39A 1NPRA 1VQMT 2V8KA 2DO3A 2XG8D 5FRNA 3CCQT 4C8QB 1Q81U 1UGRB 3NTIA 5KE2A 5DM7R 2PUOB 3BDUA 4QW2A 3RUXA 1O9SA 3C95A 4OP0A 3V7RA 1JBMA 1BIAA 3KXTA 1VQPA 1XQHA 4BUGA 3L2ZA 1VQOT 1WJSA 4XTYA 3CCET 5I2SA 3GNGA 2EQMA 4HT8A 4M77F 4JS5A 3VU3C 1UGPB 4PJOD 2WACA 1OZ2A 3M4YA 5CVIA 1I81A 2NLUA 3LGLA 2CS7A 3MCAB 4HCZA 2XDPA 4M77C 5D6XA 3DB3A 1YJWT 4F7UA 2OTLA 3JCMP 1WQWA 2L89A 3L2WA 2E65A 5DLOA 1Q7YC 1JJ2A 1VQ8A 1K8AU 1LJOA 4HT9A 1LNXA 2RJFA 4BACA 3VKIA 2CZ6B 4MZMA 2KMTA 2IVWA 5IN1A 1UEBA 1VQ7A 4C5IA 3OYYA 1QP2A 2DKGA 3P8BB 3LWHA 2ZPFB 3I56A 2EJGA 5CK9A 3QPHA 4C92E 1XNIA 3CBPA 3CPFA 5GAOp 1PSFA 2DPPB 2D6FA 2F5KA 2P4TA 3QG1A 4NS5A 3MP6A 4C5HA 4M77A 1NZ9A 3X26B 2QTXA 4M77B 2RHUA 4OGCA 5LJ3h 4ZN3A 4PNOA 5LJ5f 4V2SA 2K3XA 2EFIA 1MGQA 2JUFA 4J6WA 3JCMb 2K2VA 3C94A 2X4XA 2Y4YA 3CMEA 1N9SA 3OS5A 4L5GA 2L3RA 1Y07A 3ER0A 3QUIA 3CC7T 3NTKA 4IURA 2PVGB 3GLXA 2OAUA 3PFSA 4BI8B 1YJNT 1YCYA 2CYZB 4FSXA 4EMKC 2XIDA 5KCHA 4M7AA 4KULA 2LQ8A 5FU7C 3JRZA 4C0DC 2A3LA 4RG8A 5GANd 3OS2A 1YITT 3BDLA 2XI9A 1S72T 4QVDA 2E1HA 4OB1B 5CQXA 5GAN6 3UDCA 2ZPGB 3O8VA 3CCJT 2LTOA 5CKHA 2ZPHB 4ZN1A 4C8QD 5GAMg 3JB9J 1VIEA 4Z02A 3CCMT 1RI0A 2RH2A 5LJ3f 3FRNA 3QYHB 1QVFS 3L42A 4IUVA 5CCAA 1OI1A 1M1KC 3FIFA 4FT2A 2RB6A 1K9MC 1ZBXA 3VUZA 1IREB 4EMKA 3G71T 4BD3A 3HFNA 2KDSA 3EAEA 2K5IA 1UB4A 5FU7B 2E6NA 1Y71A 4BI4A 2QQSA 3OYCA 2LCCA 1YHQA 3JB9F 2HQEA 3QZ5B 3HFOA 4M75E 1JB0E 4PKCC 1VQ4T 1QP3A 5CKEA 5CQYA 3INZA 2VYTA 1I4K1 1HXDA 2VUBA 1D3BA 4RG2A 5LJ5j 1VIFA 3PTAA 4CRIA 1K73U 2RHXA 1BIBA 3A8GB 2DVEA 4Y28E 2O4XB 2QEXT 3CCLT 1KC8C 4KBMB 2OTJA 2PVDB 1I5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 U;  3CCU T;  1YHQ T;  3PIP A;  3J81 E;  3CCV A;  3J80 E;  1VQK A;  2E70 A;  3CXC S;  3CMA A;  2JNG A;  2XHC A;  3CCE A;  1VQO A;  1NPR A;  3CC4 T;  1Q7Y U;  1VQM T;  1VQ5 T;  2DO3 A;  3CCQ T;  1NPP A;  1YI2 A;  2JVV A;  3OW2 A;  2MWP A;  1Q81 U;  5DM7 R;  1YJW A;  1VQK T;  5IT9 E;  1KHI A;  3CCS A;  1YBY A;  2QA4 A;  3CPW S;  1YJN A;  1K73 C;  3CMA T;  1VQP A;  1W2B S;  1VQO T;  3CCE T;  5DLQ E;  1YIT A;  1QVG S;  1YIJ T;  3CC2 T;  2JOY A;  1VQL A;  3LGL A;  3A5Z B;  3PIO A;  3CCJ A;  3DB3 A;  1YJW T;  2OTL A;  1JJ2 A;  1VQ8 A;  1Q7Y C;  3CCM A;  1K8A U;  1KQS S;  1M90 U;  3DLL A;  2G3R A;  1Q82 U;  1QVF A;  3G4S A;  4X34 A;  1VQN T;  2OTJ T;  1UEB A;  1VQ7 A;  3LGF A;  1Q81 C;  1VQL T;  3OYY A;  3P8B B;  3G71 A;  3I56 A;  3CCV T;  3TRE A;  2EIF A;  3CC7 A;  3CD6 A;  2KVQ G;  1XNI A;  3CPF A;  1N8R C;  1VQ8 T;  4QQD A;  1VQ9 A;  5HY6 A;  1N8R U;  4ZN3 A;  1NZ9 A;  3G4S T;  5IAY A;  1S72 A;  1VQ7 T;  3G6E A;  1Q86 U;  1YI2 T;  2JUF A;  3CME A;  1M1K U;  3OW2 S;  2L3R A;  3ER0 A;  1K8A C;  3CC7 T;  1VQ6 A;  1M90 C;  2IG0 A;  1Q82 C;  2MI6 A;  3CCS T;  1YJN T;  3CCL A;  2QA4 T;  1IZ6 A;  1XTD A;  1VQ9 T;  1VQP T;  1BKB A;  2LQ8 A;  4YTL A;  2CKK A;  1YIT T;  1S72 T;  3DB4 A;  1YJ9 A;  1SSF A;  3CXC A;  3HKS A;  3CME T;  3CCJ T;  3CCR A;  1VQ6 T;  4ZN1 A;  2OTL T;  1JJ2 S;  3CCM T;  3CCQ A;  1QVF S;  1Q86 C;  1M1G A;  1VQ4 A;  1YJ9 T;  5J3B A;  1M1K C;  1RL2 A;  1KD1 C;  3KBG A;  1K9M C;  3CPW A;  3G71 T;  3I56 T;  1W2B A;  2KDS A;  3CCR T;  1KD1 U;  3CD6 T;  1K9M U;  2MWO A;  1QVG A;  5J26 A;  3I55 A;  2QEX A;  1YIJ A;  3CC2 A;  5FLX E;  2LVM A;  1EIF A;  4TVR A;  3CCU A;  1YHQ A;  5A2Q E;  1VQ4 T;  2E6Z A;  3LH0 A;  3G6E T;  3J7A F;  1KQS A;  4RG2 A;  3JAM E;  1NJI C;  1X6O A;  3CC4 A;  4CRI A;  1K73 U;  1VQM A;  5LL6 S;  1KC8 C;  2QEX T;  3I55 T;  3CCL T;  1VQ5 A;  1VQN A;  1NJI U;  2OTJ A;  2LCL A; 
#chains in the Genus database with same CATH topology
 2RHY A;  1TUG B;  1VQK A;  2RI2 A;  2EYZ A;  2PUK B;  3CXC S;  3RKX A;  2HQX A;  4DBF A;  3LWI A;  2YUN A;  2ABL A;  1X43 A;  5GAO q;  5GMK l;  2HEQ A;  2X4W A;  4C8Q F;  1MND A;  2QDL A;  3OW2 A;  1GRI A;  1IB8 A;  3M54 A;  1UGV A;  2C0I A;  2KRS A;  4E7H A;  4C0F A;  1YIJ T;  4A4F A;  3M0P A;  4HCK A;  5HKC A;  3UWN A;  4M78 E;  3VV0 A;  5FU6 B;  3E19 A;  1YFN A;  2RQT A;  1M90 U;  4LD9 K;  1GFC A;  1IHW A;  1JXM A;  3G4S A;  3SHW A;  1V1C A;  2DBM A;  2LT1 A;  3CCV T;  1PC0 A;  4NL2 A;  3N5B B;  1QKX A;  2GTO A;  4NL3 A;  1BK2 A;  4FM4 B;  1BI1 A;  3CC2 Q;  4C92 C;  2BTT A;  2EYQ A;  3G6E A;  1M8V A;  7AT1 B;  3ULR B;  2DIL A;  5LJ5 h;  2IPO B;  2L8D A;  1ZBJ A;  1Q82 C;  2JW4 A;  2DD4 A;  1TSF A;  4ZTJ A;  2NWM A;  1WQ7 A;  3QBY A;  2X9H A;  3JCM d;  3LW5 E;  2X4J A;  4HXJ A;  5GAM h;  2HSP A;  4MZP A;  1K8A R;  1OPL A;  2R5M A;  3NTH A;  3FDR A;  2EYX A;  2FZC B;  1B34 B;  1Q86 C;  1M1G A;  1ZA1 B;  1SPK A;  1VQ7 Q;  1F1B B;  4OB0 B;  1PRL C;  3JCM W;  4HVV A;  5IXB A;  3JB9 I;  5FLX E;  2LVM A;  4RTV A;  4M7A G;  5C6S A;  3NPF A;  3M57 A;  5LL6 S;  3VJP A;  2LCL A;  1OU8 A;  1YHQ T;  5L8R E;  2LC4 A;  3VS5 A;  4FYX B;  5FWB A;  1UHF A;  2CSI A;  4M75 G;  5LJ3 e;  4RCC A;  1WHK A;  1WXT A;  4C5E A;  2MAM A;  5EG2 A;  3BE3 A;  3A8O B;  1UG1 A;  5LJ5 d;  1KG1 A;  2AT1 B;  2LQN A;  3CPW S;  4M75 B;  1WHM A;  1OOT A;  1AOJ A;  2K4Y A;  2R57 A;  2XD0 A;  2XK0 A;  1AHJ B;  2AHJ B;  2OAW A;  2B86 A;  2K3Y A;  1LCK A;  3NMZ C;  2EQU A;  4AFQ C;  2RPN A;  1X01 A;  1QVF A;  4OMN A;  2P0K A;  4DEY A;  2LCS A;  4KGV B;  4JDS A;  1WHH A;  3G71 A;  3TRE A;  4J9E A;  2LQK A;  5GAN 3;  2J6O A;  3SB2 A;  3ZEH A;  2MPX C;  5HK0 A;  2COZ A;  1K8A C;  2PQW A;  2QGF B;  3OYK A;  4C0Z A;  3F70 A;  4XK8 E;  4ELZ C;  2EWN A;  1VQ5 Q;  1A0N B;  2RJC A;  1SSF A;  2NUP A;  3I5S A;  4J9D A;  3M0U A;  4ME7 A;  1VQ6 T;  1EZZ B;  1KK7 A;  1M90 R;  1J3T A;  1C1A A;  2HKN A;  1E6G A;  1PNJ A;  2F2W A;  3I56 T;  1NBE B;  3JCM g;  5IH2 A;  1M9S A;  1VQP Q;  1YIJ A;  1VQ9 Q;  2EGC A;  3FLG A;  2E41 A;  4QVZ A;  2OJ2 A;  3H0F A;  1QVG P;  2DJZ A;  2R58 A;  2HD0 A;  5CKF A;  5GAN f;  3X28 B;  2RHI A;  3FC3 A;  3CCV A;  3LX7 A;  4N4G A;  4ZNX A;  2JNG A;  3NGP A;  3CCE A;  1VQO A;  4M7A F;  2WSE E;  2RNA A;  2J7I A;  3A1P A;  3OYB A;  1PKS A;  2DIG A;  1M1F A;  1R77 A;  1OEB A;  3E9F A;  1W70 A;  2A36 A;  1CSK A;  4M75 F;  4AT1 B;  2DXC A;  2DEQ A;  3QSU A;  1RLP C;  3OS1 A;  1Z9Z A;  1D1A A;  3TVT A;  5LJ5 g;  1WHJ A;  4OB2 B;  1JXO A;  2KAF A;  4IKF A;  3S3O A;  2OTJ T;  1VQL T;  2V8J A;  5GAN j;  3REB B;  2EIF A;  2X3W D;  4PJO C;  2M1H A;  3RR6 A;  2WSC E;  2K9G A;  2PU9 B;  5IAY A;  2D8J A;  5GAN 8;  4XTZ A;  1HYO A;  2KYM A;  4C92 D;  2ECZ A;  1BCO A;  1X6B A;  1M90 C;  2DF6 A;  1XTD A;  3WVD B;  2V1R A;  1UDL A;  2CKK A;  2CP7 A;  4XTV A;  5I2M A;  3OYF A;  3VS3 A;  2GFA A;  1G83 A;  3EG9 A;  4DBR A;  2AK5 A;  4PJO A;  2DL4 A;  3U23 A;  1V29 B;  2M02 A;  1YN8 A;  3MEW A;  3HP9 A;  4X9C A;  5D6Y A;  4LN2 A;  3JB9 G;  2EYY A;  2FZK B;  3OY9 A;  1QCN A;  2G6F X;  2CRE A;  4DOW A;  1BBZ A;  4II1 A;  3CCR T;  1YNZ A;  5FRO A;  2HSE B;  2QEX A;  3C0C A;  4M78 A;  3HPW A;  3FJP A;  1G2B A;  1G3S A;  4IUP A;  4E6R A;  4C8Q C;  4X9D A;  3HSB A;  3IQL A;  5A0D A;  1X6O A;  4DQ2 A;  1HD3 A;  1PWT A;  4AFU C;  5KYU B;  1GCQ C;  4HA8 A;  5D7U A;  3GP8 A;  4J9G A;  2E70 A;  2DD5 A;  3R6O A;  2ZPI B;  1XOV A;  1NPR A;  1WZO A;  2DO3 A;  3CCQ T;  3G6E Q;  2PUO B;  1RI9 A;  1W2B P;  4OP0 A;  3KXT A;  1BIA A;  1AWW A;  1WJS A;  1RAG B;  2EQM A;  1ZX6 A;  3QWX X;  2DYB A;  1CKB A;  3CCU Q;  1I81 A;  2NLU A;  3OW2 P;  5D6X A;  2XDP A;  2HDA A;  3DB3 A;  2NUT B;  3L2W A;  1JJ2 A;  2CP5 A;  2ENM A;  4BAC A;  2CZ6 B;  2CP6 A;  2P4R A;  3I35 A;  2KMT A;  1UEB A;  1VQ7 A;  4C5I A;  3OYY A;  2DKG A;  3I56 A;  2JM8 A;  1M2V A;  1PG5 B;  1W1F A;  3QPH A;  4C92 E;  1XNI A;  2RQW A;  2D6F A;  3QG1 A;  4C5H A;  1NZ9 A;  4OMO A;  4M77 B;  1D1B A;  3H0I A;  5LJ3 h;  2M0Y A;  2X4X A;  2Y4Y A;  1N9S A;  1GBQ A;  3ER0 A;  1Y07 A;  2IIM A;  1YJN T;  1UTI A;  5KCH A;  1PD1 A;  2COY A;  5FU7 C;  4RG8 A;  3VS0 A;  3OS2 A;  1S72 T;  3CQT A;  4JJC A;  1H8K A;  2LTO A;  4Z8A A;  1VIE A;  3CCM T;  1W6X A;  3FRN A;  1UJ0 A;  2EKH A;  2EPD A;  4FT2 A;  1K9M C;  2BE7 D;  2EW3 A;  3EG2 A;  2YUQ A;  4RTZ A;  1X27 A;  4PFP A;  3H9N A;  3JB9 F;  1VQ4 T;  1JB0 E;  1T3S A;  2DL5 A;  2VYT A;  4GLM A;  2DNU A;  2VUB A;  5KYY A;  1D3B A;  3PTA A;  4CRI A;  1K73 U;  1KC8 C;  3A8G B;  2OTJ A;  1I5L A;  1JO8 A;  3KUF A;  4A54 A;  4OMM A;  2CH4 A;  1TH7 A;  2JTF A;  2Y90 A;  4M77 D;  3WVE B;  3G71 Q;  3QXE B;  3EHQ A;  4F14 A;  5FU6 C;  4M7D G;  3CC4 T;  2EAY A;  4E7I A;  2F5T X;  1B07 A;  2DA9 A;  5HCK A;  3OMC A;  3VS2 A;  1VOM A;  1QLY A;  2HL3 A;  5KCO A;  3G7Z A;  4M78 G;  2DFU A;  4M7D B;  4CC7 A;  2JOY A;  3PE0 A;  4HCC A;  2O9V A;  2J6F A;  2FPE A;  4J8O A;  2RJE A;  2RK2 A;  4JUV A;  3OYD A;  1LVK A;  4MMK A;  1B7T A;  3A98 A;  4QVC A;  1BI3 A;  4X34 A;  1C0M A;  2KXD A;  2ATC B;  1BYM A;  1U8R A;  1VQ8 T;  2FO0 A;  1VQ9 A;  3NFC A;  4E7K A;  5GMK e;  1YIJ Q;  1NYF A;  4C0G A;  2XKO C;  1U1S A;  1YI2 T;  2HL5 C;  4LUD A;  4J9I A;  2LQW A;  1ABO A;  3CCS T;  1OV3 A;  1BKB A;  2RHZ A;  1KFZ A;  4FIB A;  2ZCF B;  1NEB A;  3CME T;  3CCV Q;  2YT6 A;  4XQ3 A;  4DBH A;  5GAO r;  2YUO A;  3MO8 A;  1ZSZ B;  2ZPB B;  3CCQ A;  4RUG A;  4F7U E;  1B34 A;  2KY9 A;  1UHC A;  2L3S A;  2GF7 A;  4R55 A;  2ED1 A;  2X35 A;  3GF5 A;  3MET A;  4DA4 A;  1MMG A;  2L3P A;  1N9R A;  2HKQ B;  2MK5 A;  2GCX A;  3E1S A;  1S1N A;  3EHR A;  3SWN B;  1AZG B;  3SDZ A;  3CMA A;  4WTO B;  1BB9 A;  4PJM A;  4J7I A;  4B6M A;  3C12 A;  3HHT B;  1RAC B;  4KT0 E;  4ZTF A;  1Q86 R;  2ESW A;  3QJY A;  4KUI A;  1YJN A;  1IGU A;  4J7F A;  1W2B S;  2R5A A;  2KSS A;  2HBP A;  2Y4X A;  2RQR A;  2O4X A;  4RCB A;  1RAA B;  4M7D F;  1H3Z A;  3EGX B;  5GAO m;  3L2U A;  4OGE A;  2X3X D;  2DXT A;  2JS0 A;  3CCM A;  3UA6 A;  1KQS S;  4M78 F;  2GNC A;  3HTR A;  4A4E A;  4BE1 A;  1VQN T;  4PJO E;  2DE0 X;  1EFN A;  3I5R A;  1GFD A;  1TWB A;  1N8R C;  1GL5 A;  8AT1 B;  3OA6 A;  4Q5W A;  4B9W A;  2QEX Q;  2AZS A;  3A8M B;  2CZ1 B;  1M1K U;  1M27 C;  3LH5 A;  3JCM Q;  2YSQ A;  2QI2 A;  3OSV A;  4F17 A;  5I21 A;  5A0L A;  3CEY A;  2LX9 A;  1WFW A;  4IIM A;  3CXC A;  2YHT A;  1KHC A;  2DTH A;  2FVU A;  3EH2 A;  3A8L B;  2OTL T;  1NE8 A;  4DOV A;  4IIO A;  4HKE A;  3GBQ A;  1LOJ A;  3MEA A;  5GAN h;  2D0N A;  1YJ9 T;  2B8A A;  5J3B A;  1RL2 A;  1U1T A;  2RM4 A;  2M16 A;  4J83 A;  1VYU A;  3VRZ A;  4C8Q E;  1MUZ A;  5J26 A;  3I55 A;  3CCU A;  2E6Z A;  2KNB B;  4RTY A;  1D1C A;  2BZ8 A;  1PD0 A;  4JRP A;  2K79 A;  4C92 A;  4QQ6 A;  3DLM A;  1FXX A;  4E7Z A;  3JB9 H;  3I56 Q;  2LJ3 A;  2XHC A;  1SRM A;  2D0Q B;  4CC4 B;  2EJF A;  4XU2 A;  2RJD A;  3E9G A;  1NPP A;  2LMJ A;  1YI2 A;  1AWO A;  2KRN A;  4XTU A;  3SFM A;  2CZ7 B;  1YJW A;  1Y7X A;  2OX7 A;  2KT8 A;  3CCS A;  4JRI A;  1K73 C;  3MPU B;  3RMQ A;  1PKT A;  2DAQ A;  4E7S A;  4L59 A;  2WSF E;  1R0B G;  3VYG A;  1E7O A;  4RMO A;  4BB7 A;  4LNP A;  1TUC A;  2JMA A;  3GNF B;  1Y96 A;  4M7A B;  5A0G A;  2JM9 A;  2K6D A;  1IXD A;  1WLP B;  3RMS A;  2YUP A;  3GIB A;  2E5Q A;  3FJ5 A;  4J5Y A;  2P84 A;  1X75 C;  2DTI A;  5HY6 A;  2EJ9 A;  4ORZ A;  4OF1 A;  1C6V X;  4JJD A;  4RTW A;  2DYI A;  3JCM J;  1QCF A;  1TTH B;  3RKY A;  5GAM d;  1VYT A;  1QWE A;  3EFO A;  2QQB A;  1VYV A;  2IG0 A;  2MI6 A;  4C0D B;  1ZUK A;  2QA4 T;  5KYW B;  2OTJ Q;  2KR3 A;  1TU0 B;  1TXQ A;  4JZ3 A;  3DB4 A;  3MP1 A;  3FB9 A;  4DBQ A;  1OPK A;  2SEM A;  4PL6 A;  4OMQ A;  5CO7 A;  4IUT A;  4A4G A;  2LZ6 B;  3ZL7 C;  3BY7 A;  1ZUU A;  1V76 A;  1BU1 A;  1SKU B;  4ZGJ B;  2RK1 A;  3G1J A;  1JRI A;  3CPW A;  1MMA A;  1H92 A;  2LRQ A;  1K9M U;  4J9C A;  1MHN A;  4E7L A;  1WXB A;  3M4G A;  2KGT A;  2FL7 A;  1Y57 A;  3RDV A;  4M7A D;  5GAN 2;  1MMD A;  4PJN A;  1M1K R;  5GMK h;  1X6G A;  4FW2 A;  2KT1 A;  1D0Y A;  2O31 A;  3OS0 A;  3VRY A;  1NG2 A;  1WNL A;  1VQN A;  4BY6 B;  3JCM f;  2RQU A;  1KC8 U;  4M75 D;  1KSW A;  2E3H A;  3J80 E;  2FEI A;  4HCB A;  4JS4 A;  4IUU A;  2CGH A;  2ROT A;  2JMC A;  3M5A A;  4MDX A;  3PMT A;  4K11 A;  2EBP A;  2XIC A;  3D7S B;  5J39 A;  1VQM T;  2A0F B;  2CP0 A;  1UGR B;  3NTI A;  5DM7 R;  1Q81 U;  4FYY B;  3AT1 B;  1JBM A;  1XQH A;  2W10 A;  2F2X A;  1IGQ A;  3GNG A;  3VU3 C;  3M4Y A;  4HCZ A;  4M77 C;  2CS7 A;  2NUT A;  4F7U A;  2VKN A;  2OTL A;  2X51 A;  3VKI A;  2EGA A;  3CCQ Q;  3LWH A;  2AIR B;  2ZPF B;  2EJG A;  5GAO p;  3O5Z A;  2CT4 A;  2P4T A;  1JQQ A;  4M77 A;  1RAI B;  4OGC A;  4ANJ A;  4FW1 A;  4PNO A;  5LJ5 f;  3JCM b;  4J6W A;  2JUF A;  2YXY A;  2K2V A;  4L5G A;  2L3R A;  3CC7 T;  2PVG B;  3PFS A;  4FSX A;  4EMK C;  1WI7 A;  2A08 A;  3JRZ A;  2A3L A;  4QVD A;  2ZPG B;  2DRM A;  4HVW A;  2ZPH B;  3CMA Q;  5GAM g;  2DX1 A;  3KFV A;  1YWP A;  2RH2 A;  3QYH B;  1M1K C;  2KXC A;  4EMK A;  2KDS A;  3EAE A;  2DLP A;  1YJN Q;  1Y71 A;  4BI4 A;  1TS9 A;  1YHQ A;  1S72 Q;  3QZ5 B;  3HFO A;  4M75 E;  4PKC C;  1QP3 A;  5CQY A;  5LJ5 j;  2DMO A;  3CCM Q;  3CCL T;  4Y28 E;  4KBM B;  4OMP A;  2I2L A;  5KYN A;  5GAM j;  4MZT A;  3MHX A;  3RIR A;  5GMK m;  2H8H A;  1ZHI A;  1WIE A;  2C0T A;  4MDW A;  2LT4 A;  1VQ5 T;  2DBK A;  1VQ4 Q;  3R6N A;  5IT9 E;  1YBY A;  2QA4 A;  2CUB A;  2YDL A;  3ME9 A;  1K9M R;  1I1J A;  2EVR A;  1XJW B;  5DLQ E;  4J6X A;  4RKU E;  4EPC A;  2PTK A;  5CR2 A;  3M0S A;  4A4K A;  4KGZ B;  2K5L A;  1SHG A;  3M56 A;  1AD5 A;  1RAD B;  2O2O A;  5EC7 A;  2DER A;  3CC4 Q;  1I5O B;  1WHG A;  2BZY A;  3MP8 A;  3QZ9 B;  2QYZ A;  4PJJ A;  5M9O A;  1UUE A;  1KC8 R;  2NUP B;  4C8Q A;  4JLI A;  4JRK A;  5KYX A;  2RI3 A;  3S3M A;  1SEM A;  1N8R U;  3I55 Q;  1ZSZ C;  1GCQ A;  2VGN A;  3M9Q A;  1WX6 A;  2DXB A;  1Q81 R;  4L6V 5;  4X1V A;  2M0O A;  1VQ6 A;  2E12 A;  5GAN e;  2E4H A;  1YCS B;  1FYN A;  1IO6 A;  1IZ6 A;  2PVO B;  1HK9 A;  3EG1 A;  3VYH B;  4JZ4 A;  3JB9 D;  2ZAE A;  3CBO A;  1O75 A;  3CXC P;  4D6W A;  2ZPE B;  1YI2 Q;  2QG9 B;  2O01 E;  1YJW Q;  1R8O B;  2AKK A;  2C06 A;  1ARK A;  3CCS Q;  2SRC A;  3OYA A;  4PK4 A;  1ABQ A;  5A2Q E;  1E6H A;  3J7A F;  2YRC A;  1WA7 A;  2JTE A;  3JAM E;  3VS7 A;  3M0R A;  2I0N A;  1NJI C;  2CDT A;  2RA2 A;  4EMH A;  2F1L A;  1WJQ A;  3EG0 A;  5AYF A;  2EQK A;  1G3T A;  1KQ2 A;  2X4Y A;  1LPL A;  1RAF B;  1VQK T;  2MIO A;  3C4S A;  1QVG S;  3X25 B;  2D9T A;  1ACM B;  2DTO A;  1VQL A;  3M59 A;  4PJO G;  3UPU A;  2L5Q A;  5FRM A;  2DZ9 A;  2ROL A;  2DZC A;  1UJY A;  2J05 A;  3VS4 A;  5LJ3 d;  4KUD K;  4ATO A;  1PHT A;  1Q81 C;  4D8D A;  3UF4 A;  3OYM A;  3M53 A;  1YWO A;  1W4S A;  4JRQ A;  3G4S T;  3L1A A;  2E5K A;  4D8K A;  3EFR A;  1UE9 A;  4IUQ A;  1WYX A;  1PCX A;  3CCL A;  1NLP C;  4M78 B;  2HMA A;  1VQN Q;  2ED0 A;  3REA B;  2GGR A;  2JJ9 A;  1AT1 B;  1BCM A;  3UA7 A;  2L0A A;  3CCR A;  5ECA A;  3M58 A;  1QVF P;  4F16 A;  3QKJ A;  4EMG A;  4N4I A;  3EGD B;  1KD1 C;  3JV3 A;  5GAN 7;  2K5F A;  1PSE A;  4LDX A;  2QQ9 A;  1QMC A;  2JS2 A;  2QK0 A;  1N8R R;  2FRW A;  5GAO n;  3JCM V;  4TVR A;  2J06 A;  3V8K A;  4PLL A;  1OUL A;  1K1Z A;  4MML A;  2OTL Q;  2CT3 A;  2CSQ A;  4GY5 A;  3QII A;  4WF2 A;  3MEV A;  4J6Y A;  1X69 A;  2KK4 A;  4C5G A;  1YJ9 Q;  3PIP A;  4M7D D;  3JSC A;  5KE3 A;  4ELY C;  3GPL A;  4FL6 A;  4M7A C;  3OYL A;  4JJN K;  2XDD A;  1UFF A;  4XTX A;  4M78 D;  2L3Q A;  2KE9 A;  1U5S A;  4M77 E;  1KHI A;  2RO0 A;  1IHV A;  2JXB A;  4Z88 A;  4M75 C;  4J9F A;  3OYJ A;  3URG A;  4M4Z A;  2V8I A;  4XAX B;  3UT1 A;  2JZ2 A;  4HVU A;  2M51 A;  2VXF A;  1SG5 A;  1X2K A;  2G3R A;  1M30 A;  1TG0 A;  1UEC A;  2A37 A;  2J6K A;  3HRS A;  5FW9 A;  1NLO C;  4PJO F;  2KVQ G;  5I22 A;  4J9B A;  2PZ1 A;  4M75 A;  1MV0 B;  2KEA A;  1S72 A;  4OMF B;  4PJL A;  1YHQ Q;  3RKW A;  1BI2 A;  5LJ3 g;  3BW1 A;  3OW2 S;  2KYB A;  1QW1 A;  1K73 R;  1M5Q 1;  2CP2 A;  2XDB A;  3S6W A;  4PLI A;  4FU6 A;  3PNW C;  3L2R A;  3EH1 A;  1H3H A;  1D3B B;  2KQW A;  3M55 A;  1MMN A;  4QKU A;  4CC3 A;  1P92 A;  4A63 B;  4BE0 A;  2E64 A;  1NYG A;  4P5N A;  4NOY A;  2KRM A;  1Q95 G;  4BDZ A;  2YRD A;  1VQ4 A;  1IRX A;  3JCM h;  4BY6 C;  5CAI A;  4KH1 B;  1WHL A;  3H8Z A;  2HBW A;  1W2B A;  1ZUY A;  1H64 1;  4E7J A;  3CD6 T;  3Q1J A;  5AT1 B;  2MWO A;  2QA4 Q;  2K57 A;  5GJV B;  3RER A;  5LJ3 j;  3LH0 A;  2RF0 A;  1SHF A;  4M7D E;  1AWX A;  1KQS A;  3V7C A;  3CC4 A;  3PMI A;  2VXE A;  5IXF A;  2XMF A;  4EDU A;  2QQA A;  4O5V A;  3MKD A;  2VV5 A;  2DK3 A;  3M0Q A;  1R0C B;  1WDX A;  1FMK A;  3JCM c;  2HCK A;  2V8K A;  1WXU A;  4KGX B;  5FRN A;  2Z0W A;  4Y92 A;  3RNJ A;  5KE2 A;  1ZSG A;  2DL8 A;  5IHI A;  3V7R A;  3C95 A;  1VQ6 Q;  3CCE T;  1VQO T;  4XTY A;  5I2S A;  2NYS A;  4HT8 A;  2FZG B;  4WCI A;  1OZ2 A;  5CVI A;  4JJB A;  2H3E B;  2KBT A;  3QDF A;  3JCM P;  1WQW A;  2VB6 A;  2L89 A;  1VQ8 A;  5DLO A;  4RTX A;  4HT9 A;  1LNX A;  1VQM Q;  4MZM A;  5IN1 A;  1QP2 A;  3P8B B;  1N5Z A;  5CK9 A;  2LNH B;  2MYS A;  3CPF A;  1PSF A;  2DPP B;  1QCO A;  1M2O A;  4NS5 A;  3MP6 A;  4LXC A;  3X26 B;  1GCP A;  2EQI A;  4V2S A;  1MGQ A;  3CME A;  3TU4 K;  2KRO A;  3OS5 A;  3QUI A;  3NTK A;  3GLX A;  2OAU A;  1YCY A;  1OX9 A;  5GAN d;  1YIT T;  2XI9 A;  2E1H A;  4OB1 B;  5CQX A;  5GAN 6;  1AEY A;  1D09 B;  1U06 A;  3CCJ T;  4KRT A;  4PFO A;  4ZN1 A;  1JJ2 P;  2HZY A;  3QWY A;  2FG0 A;  1AWJ A;  1QVF S;  3L42 A;  4IUV A;  1AVZ C;  5IHK A;  3FIF A;  2RB6 A;  3CC7 Q;  3HFN A;  3I9Q A;  2K5I A;  2FPD A;  1UB4 A;  2E6N A;  2OI3 A;  2QQS A;  2MOX A;  2HQE A;  1VQL Q;  5CKE A;  1I4K 1;  1HXD A;  1OQK A;  1B3Q A;  3EG3 A;  1VIF A;  2QEX T;  2DVE A;  2O4X B;  1NJI U;  2PVD B;  4LDU A;  2V26 A;  2EYW A;  3P8D A;  1KQ1 A;  4RTT A;  4A53 A;  1M3A A;  1TOV A;  3OQ5 A;  2YLC A;  2HQH A;  2FYK A;  1FMW A;  3JCM X;  4B9X A;  2D1X A;  2VC8 A;  2MWP A;  3ZBD A;  2DVJ A;  3CCL Q;  1YP5 A;  5KYU A;  3CC2 T;  5GMK i;  3A5Z B;  5GAN 4;  2EQJ A;  1FMV A;  3PIO A;  4RTU A;  1VA7 A;  1DJ7 B;  4PFZ A;  2BIV A;  3CCR Q;  1SRL A;  3DLL A;  3MEU A;  3VUB A;  3QHS A;  3LGF A;  9ATC B;  4GLK A;  2HNI A;  4UC4 A;  3CD6 A;  2L2P A;  5FWC A;  8ATC B;  4CI0 C;  3CBM A;  3HL8 A;  1PRM C;  4QQD A;  2QGG A;  1RUW A;  2DIQ A;  3ASK A;  1VQ7 T;  2MF2 A;  1G8X A;  3S3N A;  1KJW A;  1WJR A;  1OZ3 A;  3PVL A;  4C92 G;  2D8H A;  4YTL A;  3VS6 A;  2CH4 W;  3E2U A;  2CP3 A;  2P0Q A;  5DY9 A;  3QO3 A;  1YJ9 A;  2QQR A;  3OYH A;  3HKS A;  1N6A A;  2A7Y A;  1SF9 A;  4XU1 A;  4O6J A;  4C92 B;  4R56 A;  2HAX A;  3THK A;  1EX4 A;  3TQ7 P;  2BUD A;  3KBG A;  5GAN g;  4F04 B;  2BZX A;  5CKB A;  3T9N A;  1KD1 U;  2RMO A;  2CZ0 B;  4AFS C;  3EFS A;  5GAM f;  5I11 A;  4XU0 A;  2DL3 A;  3OBW A;  4FT4 A;  4R0K A;  1ZLM A;  3H41 A;  1I0C A;  4BE2 A;  4OML A;  3AHU A;  1VUB A;  6AT1 B;  5C0M A;  4N4H A;  3P8H A;  1FX7 A;  2E10 A;  3SEM A;  4M7A E;  2LP5 A;  3NHN A;  4BI3 A;  4FCY A;  3UAT A;  1Y96 B;  1Q7Y U;  4LDY A;  1D0Z A;  2XU8 A;  4AG1 C;  2DEU A;  1PM3 A;  2CUD A;  4FSS A;  3PGG A;  1QQJ A;  4LE9 A;  2MMP A;  1YIT A;  2COW A;  1RAB B;  4BDY A;  3V8J A;  4M7D C;  3CCJ A;  2BKD N;  3EFO B;  1RAH B;  5GAO l;  3TEE A;  1NJI R;  4M78 C;  2M9U A;  1VQK Q;  1WPY A;  1U3O A;  1MNE A;  2YRV A;  1JU5 C;  4M7D A;  2DXU A;  1I8F A;  4LUE A;  2AKL A;  2FRY A;  1GXI E;  1KIK A;  2RD1 A;  1G3W A;  3MJX A;  2QDY B;  2EKO A;  1NEG A;  2GQI A;  2YLB A;  2DJQ A;  3JCM e;  2QAZ A;  1VQ9 T;  1VQP T;  2JT4 A;  3OMG A;  1K9A A;  2DRK A;  2F69 A;  2ZGW A;  1OYX A;  2BE9 B;  1HJD A;  1JJ2 S;  1G3Y A;  4C92 F;  2FHD A;  3G4S Q;  2AZV A;  2H3J A;  3EGD A;  3PT9 A;  3FEO A;  5IHN A;  3DKM A;  1AZE A;  2K7A A;  2QXF A;  3OB9 A;  5CIU A;  3A8H B;  3CC2 A;  1UGS B;  2QAS A;  4AFZ C;  2V1Q A;  3SD4 A;  1EIF A;  4Y91 A;  4F7U G;  3LLR A;  1QWF A;  1ZQ1 A;  1VQ8 Q;  2LDM A;  1VQM A;  1ZSZ A;  1D0X A;  3H0H A;  1T0J A;  3X20 B;  4CC2 A;  3J81 E;  1BI0 A;  3ZFJ A;  1M3C A;  2DM1 A;  4F7U B;  1KQS P;  3SWN C;  3OSS C;  3M0T A;  4M77 G;  5LJ5 e;  4VUB A;  1X2Q A;  3WXM B;  3L2Q A;  2JVV A;  4LDW A;  4ZGD B;  4OB3 B;  3CME Q;  1MV3 A;  4LD6 A;  3L2V A;  1KD1 R;  3CMA T;  2GTJ A;  4E2F B;  3HRU A;  1NM7 A;  5GAM e;  2FPF A;  1GBR A;  2QTV A;  3TSZ A;  3SWN A;  2MCN A;  1FWZ A;  4E47 A;  3VS1 A;  5GMK j;  2FB7 A;  3QYG B;  4QT7 A;  4QQG A;  1Q82 U;  2JN0 A;  2PNI A;  4JPB W;  5D6W A;  3V8L A;  3V7S A;  2RQV A;  3OBY A;  3EGU A;  2JTM A;  3CC7 A;  1HSQ A;  1N27 A;  1Q7Y R;  2LNV A;  1T0H A;  4XU3 A;  3EGX A;  1CKA A;  1Q86 U;  2VGM A;  5CKD A;  4AG2 C;  3RBB B;  4EMK B;  3TSW A;  3HRT A;  2LJ1 A;  3X24 B;  2K3B A;  1TUD A;  4N0A C;  1T3L A;  3OYI A;  2GFU A;  3EG9 B;  2C0O A;  3QDR B;  3QJ6 A;  4PJO B;  4Z89 A;  2GQV A;  1WGS A;  4OVA A;  4XTW A;  3OYG A;  2ZZD A;  4LDV A;  1QVP A;  4ESR A;  4A4H A;  4KH0 B;  5KH6 A;  1QVG A;  3BFM A;  4N0A A;  3OYN A;  5GAN 5;  3H6Z A;  5HK3 A;  3TCJ A;  1K0X A;  3G6E T;  1I07 A;  4ZGE B;  1G5V A;  3LYI A;  1UGQ B;  1M4Z A;  2O9S A;  4JLG A;  3I55 T;  1VQ5 A;  2VVK A;  4C8Q G;  3CCU T;  2P0P A;  1JEG A;  3GOX A;  4F7U F;  1SSH A;  2EGE A;  3RES A;  2RI5 A;  3CD6 Q;  2RN8 A;  2XG8 D;  2VAS A;  4C8Q B;  5KYX B;  1QKW A;  3PVQ A;  3CPW P;  3BDU A;  4QW2 A;  3RUX A;  1O9S A;  1VQP A;  4BUG A;  3L2Z A;  4J9H A;  4M77 F;  4JS5 A;  4PJO D;  1UGP B;  2WAC A;  1M8M A;  3LGL A;  3MCA B;  1OX8 A;  1ZA2 B;  2LX7 A;  1YJW T;  1RAE B;  2E65 A;  1Q7Y C;  1K8A U;  1LJO A;  2RJF A;  2IVW A;  4FYW B;  1Y0M A;  1M2V B;  3CBP A;  2F2V A;  3CCE Q;  1VQO Q;  2F5K A;  4ZN3 A;  2QTX A;  2RHU A;  2DL7 A;  1K76 A;  2YWW A;  2K3X A;  2EFI A;  2NUZ A;  3OYE A;  3C94 A;  1K0S A;  4IUR A;  1M3B A;  4GBQ A;  4BI8 B;  2O88 A;  2CYZ B;  5GJW B;  2XID A;  4M7A A;  1RLQ C;  4KUL A;  2LQ8 A;  4C0D C;  2DET A;  3BDL A;  3UDC A;  3O8V A;  5CKH A;  4C8Q D;  3JB9 J;  1Q82 R;  4Z02 A;  2E3I A;  1RI0 A;  5LJ3 f;  2GBQ A;  5CCA A;  1OI1 A;  1K4U S;  1OU9 A;  2LJ0 A;  1ZBX A;  3VUZ A;  1IRE B;  3G71 T;  4BD3 A;  4AMC A;  4EIK A;  5FU7 B;  5KYW A;  3OYC A;  2LCC A;  2K2M A;  1YIT Q;  1Z9Q A;  5L23 A;  3INZ A;  3CCJ Q;  4DEX A;  2KI7 A;  4RG2 A;  5KYY B;  2VWF A;  2W0Z A;  4FYV B;  2RHX A;  2A28 A;  1BIB A; 
#chains in the Genus database with same CATH homology
 2RHY A;  2I2L A;  3KUF A;  4LDU A;  4A54 A;  1TH7 A;  1KQ1 A;  3P8D A;  4A53 A;  2JTF A;  1VQK A;  2RI2 A;  2Y90 A;  4M77 D;  3WVE B;  2PUK B;  3CXC S;  3RKX A;  2HQX A;  3OQ5 A;  3QXE B;  4MZT A;  2YLC A;  3MHX A;  3RIR A;  5GMK m;  5GAM j;  3LWI A;  5FU6 C;  4M7D G;  3CC4 T;  1ZHI A;  2EAY A;  4E7I A;  4MDW A;  2FYK A;  2LT4 A;  1VQ5 T;  3JCM X;  5GAO q;  4B9X A;  5GMK l;  2F5T X;  2X4W A;  2VC8 A;  4C8Q F;  3OW2 A;  2MWP A;  3ZBD A;  5IT9 E;  3OMC A;  1YBY A;  5KCO A;  2QA4 A;  3G7Z A;  3ME9 A;  3M54 A;  4M78 G;  4E7H A;  5DLQ E;  4J6X A;  4RKU E;  4C0F A;  4EPC A;  4M7D B;  1YIJ T;  3CC2 T;  5GMK i;  2JOY A;  4A4F A;  5CR2 A;  3A5Z B;  5GAN 4;  4HCC A;  2EQJ A;  4A4K A;  3PIO A;  2K5L A;  3M56 A;  5HKC A;  3UWN A;  1NJI U;  4J8O A;  2RJE A;  2RK2 A;  1DJ7 B;  4JUV A;  2BIV A;  4M78 E;  5FU6 B;  3VV0 A;  4MMK A;  3OYD A;  3E19 A;  1M90 U;  4LD9 K;  3DLL A;  3MP8 A;  3MEU A;  3QZ9 B;  4QVC A;  3VUB A;  3G4S A;  1BI3 A;  4X34 A;  5M9O A;  3QHS A;  3LGF A;  4C8Q A;  4JLI A;  4JRK A;  1BYM A;  4GLK A;  2LT1 A;  2HNI A;  3CCV T;  4UC4 A;  3CD6 A;  2RI3 A;  1U8R A;  4NL2 A;  3N5B B;  4CI0 C;  1VQ8 T;  3CBM A;  3HL8 A;  4NL3 A;  4QQD A;  3S3M A;  1VQ9 A;  3NFC A;  1N8R U;  4E7K A;  2DIQ A;  5GMK e;  4FM4 B;  1BI1 A;  3ASK A;  4C0G A;  2VGN A;  3M9Q A;  4C92 C;  1VQ7 T;  2EYQ A;  3G6E A;  1M8V A;  2MF2 A;  2XKO C;  1U1S A;  1YI2 T;  2DXB A;  3S3N A;  5LJ5 h;  1WJR A;  4L6V 5;  2M0O A;  2L8D A;  1OZ3 A;  1VQ6 A;  1Q82 C;  2DD4 A;  2E12 A;  5GAN e;  3CCS T;  4C92 G;  1IZ6 A;  2PVO B;  4ZTJ A;  1BKB A;  4YTL A;  1WQ7 A;  1HK9 A;  2P0Q A;  5DY9 A;  2RHZ A;  3QBY A;  3QO3 A;  1YJ9 A;  2QQR A;  3JCM d;  4FIB A;  3LW5 E;  2ZCF B;  3OYH A;  2X4J A;  3HKS A;  1N6A A;  3VYH B;  5GAM h;  3CME T;  2A7Y A;  4XQ3 A;  4MZP A;  4XU1 A;  3JB9 D;  5GAO r;  3MO8 A;  2ZPB B;  2R5M A;  3NTH A;  3CCQ A;  4O6J A;  4C92 B;  3FDR A;  4F7U E;  1B34 A;  4R56 A;  3CBO A;  2HAX A;  1O75 A;  1B34 B;  1Q86 C;  1M1G A;  2KY9 A;  4OB0 B;  4D6W A;  2ZPE B;  2GF7 A;  2BUD A;  2O01 E;  3KBG A;  5GAN g;  3T9N A;  5CKB A;  3JCM W;  1KD1 U;  1R8O B;  4R55 A;  2C06 A;  2CZ0 B;  2X35 A;  3JB9 I;  3OYA A;  1H3Z A;  3GF5 A;  3MET A;  2LVM A;  5FLX E;  4DA4 A;  5A2Q E;  3EFS A;  5GAM f;  4XU0 A;  3J7A F;  3OBW A;  1N9R A;  4FT4 A;  4M7A G;  3JAM E;  4JJN K;  4BE2 A;  1NJI C;  5C6S A;  3AHU A;  1VUB A;  3M57 A;  2GCX A;  3E1S A;  5LL6 S;  3VJP A;  2RA2 A;  2LCL A;  4EMH A;  5C0M A;  4N4H A;  1YHQ T;  3P8H A;  5L8R E;  1WJQ A;  3SWN B;  2LC4 A;  1FX7 A;  2E10 A;  4M7A E;  3SDZ A;  4M75 G;  5LJ3 e;  3CMA A;  5AYF A;  4BI3 A;  2EQK A;  4RCC A;  1Y96 B;  1Q7Y U;  4C5E A;  1G3T A;  1KQ2 A;  2X4Y A;  2MAM A;  4LDY A;  4J7I A;  3C12 A;  2XU8 A;  3HHT B;  5EG2 A;  3A8O B;  4KT0 E;  5LJ5 d;  1KG1 A;  4ZTF A;  1VQK T;  3PGG A;  3QJY A;  4KUI A;  1YJN A;  4J7F A;  3CPW S;  1W2B S;  4M75 B;  2R5A A;  2KSS A;  2HBP A;  2Y4X A;  2MMP A;  3C4S A;  2O4X A;  4RCB A;  2K4Y A;  2R57 A;  3X25 B;  2XK0 A;  2D9T A;  4BDY A;  1YIT A;  2XD0 A;  1AHJ B;  2DTO A;  1VQL A;  2AHJ B;  5GAO m;  3M59 A;  3V8J A;  4M7D C;  3CCJ A;  4PJO G;  3UPU A;  2L5Q A;  3L2U A;  5FRM A;  4OGE A;  2BKD N;  2DZ9 A;  2DXT A;  2K3Y A;  5GAO l;  3TEE A;  2EQU A;  3CCM A;  4M7D F;  1KQS S;  1X01 A;  2DZC A;  1QVF A;  4M78 F;  2P0K A;  4A4E A;  4BE1 A;  5LJ3 d;  1VQN T;  4KUD K;  4PJO E;  4ATO A;  4JDS A;  4M78 C;  1Q81 C;  2M9U A;  3G71 A;  1WPY A;  3TRE A;  3OYM A;  3M53 A;  1N8R C;  2YRV A;  2LQK A;  1W4S A;  5GAN 3;  3OA6 A;  4JRQ A;  4Q5W A;  4B9W A;  4M7D A;  3G4S T;  2DXU A;  1I8F A;  3L1A A;  1GXI E;  3SB2 A;  3EFR A;  4IUQ A;  3A8M B;  2CZ1 B;  2RD1 A;  1M1K U;  3ZEH A;  5HK0 A;  1G3W A;  1K8A C;  2PQW A;  2QDY B;  2EKO A;  3JCM Q;  3OYK A;  2YLB A;  4C0Z A;  3CCL A;  2QI2 A;  3F70 A;  3OSV A;  4XK8 E;  3JCM e;  1VQ9 T;  3OYE A;  4ELZ C;  1VQP T;  2EWN A;  5I21 A;  4M78 B;  5A0L A;  3OMG A;  3CEY A;  2RJC A;  1SSF A;  2LX9 A;  3CXC A;  2F69 A;  2YHT A;  2ZGW A;  1OYX A;  3CCR A;  1KHC A;  2DTH A;  2FVU A;  4ME7 A;  1VQ6 T;  3A8L B;  2OTL T;  1NE8 A;  1JJ2 S;  4DOV A;  3M58 A;  4HKE A;  1G3Y A;  3QKJ A;  2FHD A;  1LOJ A;  4C92 F;  4EMG A;  2H3J A;  3MEA A;  5GAN h;  3PT9 A;  4N4I A;  1YJ9 T;  2B8A A;  5J3B A;  1RL2 A;  1KD1 C;  3FEO A;  1U1T A;  5GAN 7;  2K5F A;  3DKM A;  1PSE A;  2RM4 A;  3I56 T;  3JCM g;  4LDX A;  2M16 A;  2QXF A;  3OB9 A;  5CIU A;  3A8H B;  4J83 A;  1M9S A;  2QQ9 A;  4C8Q E;  5J26 A;  3I55 A;  1YIJ A;  3CC2 A;  1UGS B;  5GAO n;  3SD4 A;  3JCM V;  1EIF A;  4TVR A;  3CCU A;  3FLG A;  4Y91 A;  2E41 A;  2E6Z A;  3LLR A;  4PLL A;  4QVZ A;  3V8K A;  4F7U G;  4JRP A;  1ZQ1 A;  4MML A;  2DJZ A;  2R58 A;  2LDM A;  3QII A;  4GY5 A;  3MEV A;  2HD0 A;  4J6Y A;  4WF2 A;  1VQM A;  5CKF A;  5GAN f;  3X28 B;  4C92 A;  2KK4 A;  4QQ6 A;  2RHI A;  3DLM A;  1FXX A;  4C5G A;  3FC3 A;  3X20 B;  3PIP A;  3J81 E;  3CCV A;  3LX7 A;  4N4G A;  1BI0 A;  3ZFJ A;  3JB9 H;  4F7U B;  4M7D D;  3SWN C;  2JNG A;  3JSC A;  2XHC A;  5KE3 A;  3OSS C;  4ELY C;  3CCE A;  1VQO A;  4M7A F;  4M77 G;  2D0Q B;  2WSE E;  3GPL A;  2EJF A;  4FL6 A;  5LJ5 e;  4XU2 A;  4M7A C;  4VUB A;  2RJD A;  3E9G A;  1NPP A;  3WXM B;  2XDD A;  3OYB A;  3OYL A;  2JVV A;  3L2Q A;  2DIG A;  4LDW A;  1M1F A;  4XTU A;  4ZGD B;  1YI2 A;  3E9F A;  4OB3 B;  4XTX A;  2CZ7 B;  3SFM A;  4M78 D;  1YJW A;  1Y7X A;  4LD6 A;  3L2V A;  4M77 E;  1KHI A;  2RO0 A;  4JRI A;  3CCS A;  1K73 C;  3CMA T;  3RMQ A;  4M75 F;  2DAQ A;  4L59 A;  3HRU A;  5GAM e;  2WSF E;  4M75 C;  2DXC A;  2DEQ A;  3QSU A;  3OYJ A;  3SWN A;  3VYG A;  3URG A;  1FWZ A;  3OS1 A;  2V8I A;  4E47 A;  4RMO A;  4BB7 A;  4XAX B;  3UT1 A;  2JZ2 A;  3GNF B;  5LJ5 g;  5GMK j;  2FB7 A;  3QYG B;  2VXF A;  4QQG A;  1Y96 A;  1Q82 U;  2G3R A;  2JN0 A;  4M7A B;  4OB2 B;  5A0G A;  2KAF A;  4IKF A;  5D6W A;  3S3O A;  2OTJ T;  3HRS A;  3V8L A;  3V7S A;  3OBY A;  1VQL T;  2V8J A;  5GAN j;  2JTM A;  4PJO F;  3RMS A;  2EIF A;  3CC7 A;  2KVQ G;  3GIB A;  2E5Q A;  1QVG S;  4J5Y A;  4M75 A;  1N27 A;  1X75 C;  2DTI A;  2M1H A;  4PJO C;  5HY6 A;  2LNV A;  2EJ9 A;  2WSC E;  2PU9 B;  5IAY A;  4XU3 A;  4OF1 A;  1S72 A;  4OMF B;  3JCM J;  5GAN 8;  4XTZ A;  3TU4 K;  1Q86 U;  3RKW A;  2VGM A;  1BI2 A;  3RKY A;  3BW1 A;  5CKD A;  5LJ3 g;  5GAM d;  3OW2 S;  4C92 D;  4EMK B;  1QW1 A;  1M90 C;  2QQB A;  2IG0 A;  2MI6 A;  4C0D B;  3HRT A;  2QA4 T;  1XTD A;  3WVD B;  1M5Q 1;  2CKK A;  4XTV A;  5I2M A;  3X24 B;  3DB4 A;  3MP1 A;  3OYF A;  3FB9 A;  3S6W A;  4FU6 A;  4PLI A;  3PNW C;  4N0A C;  3L2R A;  2XDB A;  2GFA A;  3OYI A;  2GFU A;  4PL6 A;  4PJO A;  1D3B B;  3QDR B;  3QJ6 A;  2KQW A;  4PJO B;  3M55 A;  5CO7 A;  4IUT A;  1P92 A;  1V29 B;  4A4G A;  3MEW A;  3HP9 A;  2E64 A;  2GQV A;  4X9C A;  5D6Y A;  3BY7 A;  4BE0 A;  1WGS A;  4P5N A;  4OVA A;  3JB9 G;  4NOY A;  3OY9 A;  4BDZ A;  1VQ4 A;  4XTW A;  4DOW A;  3JCM h;  2ZZD A;  4ZGJ B;  4BY6 C;  5CAI A;  4II1 A;  2RK1 A;  3OYG A;  4LDV A;  1JRI A;  3H8Z A;  3CPW A;  1QVP A;  1W2B A;  1H64 1;  4E7J A;  4A4H A;  3CCR T;  2LRQ A;  5FRO A;  1K9M U;  3CD6 T;  3Q1J A;  2MWO A;  5KH6 A;  1MHN A;  4E7L A;  1QVG A;  2QEX A;  2K57 A;  3M4G A;  3BFM A;  2FL7 A;  4M78 A;  4N0A A;  3OYN A;  3HPW A;  5GAN 5;  3RER A;  3H6Z A;  4M7A D;  5LJ3 j;  3FJP A;  3TCJ A;  5HK3 A;  3LH0 A;  5GAN 2;  1G3S A;  4IUP A;  5GMK h;  4ZGE B;  4C8Q C;  3G6E T;  4M7D E;  4X9D A;  3HSB A;  1KQS A;  1G5V A;  3LYI A;  1UGQ B;  3V7C A;  5A0D A;  3OS0 A;  1X6O A;  1M4Z A;  3PMI A;  2VXE A;  1WNL A;  4JLG A;  4DQ2 A;  3CC4 A;  3I55 T;  1VQ5 A;  4EDU A;  1VQN A;  2QQA A;  4O5V A;  4BY6 B;  3JCM f;  4C8Q G;  1KC8 U;  3CCU T;  2VV5 A;  4HA8 A;  2P0P A;  4M75 D;  2DK3 A;  3J80 E;  3GP8 A;  3GOX A;  4F7U F;  4JS4 A;  2E70 A;  4IUU A;  4HCB A;  2DD5 A;  3R6O A;  2CGH A;  3RES A;  2RI5 A;  3M5A A;  3JCM c;  3PMT A;  2ZPI B;  4MDX A;  1XOV A;  2XIC A;  5J39 A;  1NPR A;  1VQM T;  2V8K A;  2DO3 A;  2XG8 D;  5FRN A;  3CCQ T;  4C8Q B;  1Q81 U;  1UGR B;  3NTI A;  5KE2 A;  5DM7 R;  2PUO B;  3BDU A;  4QW2 A;  3RUX A;  1O9S A;  3C95 A;  4OP0 A;  3V7R A;  1JBM A;  1BIA A;  3KXT A;  1VQP A;  1XQH A;  4BUG A;  3L2Z A;  1VQO T;  1WJS A;  4XTY A;  3CCE T;  5I2S A;  3GNG A;  2EQM A;  4HT8 A;  4M77 F;  4JS5 A;  3VU3 C;  1UGP B;  4PJO D;  2WAC A;  1OZ2 A;  3M4Y A;  5CVI A;  1I81 A;  2NLU A;  3LGL A;  2CS7 A;  3MCA B;  4HCZ A;  2XDP A;  4M77 C;  5D6X A;  3DB3 A;  1YJW T;  4F7U A;  2OTL A;  3JCM P;  1WQW A;  2L89 A;  3L2W A;  2E65 A;  5DLO A;  1Q7Y C;  1JJ2 A;  1VQ8 A;  1K8A U;  1LJO A;  4HT9 A;  1LNX A;  2RJF A;  4BAC A;  3VKI A;  2CZ6 B;  4MZM A;  2KMT A;  2IVW A;  5IN1 A;  1UEB A;  1VQ7 A;  4C5I A;  3OYY A;  1QP2 A;  2DKG A;  3P8B B;  3LWH A;  2ZPF B;  3I56 A;  2EJG A;  5CK9 A;  3QPH A;  4C92 E;  1XNI A;  3CBP A;  3CPF A;  5GAO p;  1PSF A;  2DPP B;  2D6F A;  2F5K A;  2P4T A;  3QG1 A;  4NS5 A;  3MP6 A;  4C5H A;  4M77 A;  1NZ9 A;  3X26 B;  2QTX A;  4M77 B;  2RHU A;  4OGC A;  5LJ3 h;  4ZN3 A;  4PNO A;  5LJ5 f;  4V2S A;  2K3X A;  2EFI A;  1MGQ A;  2JUF A;  4J6W A;  3JCM b;  2K2V A;  3C94 A;  2X4X A;  2Y4Y A;  3CME A;  1N9S A;  3OS5 A;  4L5G A;  2L3R A;  1Y07 A;  3ER0 A;  3QUI A;  3CC7 T;  3NTK A;  4IUR A;  2PVG B;  3GLX A;  2OAU A;  3PFS A;  4BI8 B;  1YJN T;  1YCY A;  2CYZ B;  4FSX A;  4EMK C;  2XID A;  5KCH A;  4M7A A;  4KUL A;  2LQ8 A;  5FU7 C;  3JRZ A;  4C0D C;  2A3L A;  4RG8 A;  5GAN d;  3OS2 A;  1YIT T;  3BDL A;  2XI9 A;  1S72 T;  4QVD A;  2E1H A;  4OB1 B;  5CQX A;  5GAN 6;  3UDC A;  2ZPG B;  3O8V A;  3CCJ T;  2LTO A;  5CKH A;  2ZPH B;  4ZN1 A;  4C8Q D;  5GAM g;  3JB9 J;  1VIE A;  4Z02 A;  3CCM T;  1RI0 A;  2RH2 A;  5LJ3 f;  3FRN A;  3QYH B;  1QVF S;  3L42 A;  4IUV A;  5CCA A;  1OI1 A;  1M1K C;  3FIF A;  4FT2 A;  2RB6 A;  1K9M C;  1ZBX A;  3VUZ A;  1IRE B;  4EMK A;  3G71 T;  4BD3 A;  3HFN A;  2KDS A;  3EAE A;  2K5I A;  1UB4 A;  5FU7 B;  2E6N A;  1Y71 A;  4BI4 A;  2QQS A;  3OYC A;  2LCC A;  1YHQ A;  3JB9 F;  2HQE A;  3QZ5 B;  3HFO A;  4M75 E;  1JB0 E;  4PKC C;  1VQ4 T;  1QP3 A;  5CKE A;  5CQY A;  3INZ A;  2VYT A;  1I4K 1;  1HXD A;  2VUB A;  1D3B A;  4RG2 A;  5LJ5 j;  1VIF A;  3PTA A;  4CRI A;  1K73 U;  2RHX A;  1BIB A;  3A8G B;  2DVE A;  4Y28 E;  2O4X B;  2QEX T;  3CCL T;  1KC8 C;  4KBM B;  2OTJ A;  2PVD B;  1I5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...