2MIBA

The structure of murine interleukin-1 beta at 2.8 angstroms resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
IRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of murine interleukin-1 beta at 2.8 A resolution.
pubmed doi rcsb
molecule keywords INTERLEUKIN-1 BETA
molecule tags Cytokine
source organism Mus musculus
total genus 21
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 1993-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2mibA00
4I4UA 1RY7A 2KH2A 4LO1A 4ISRA 1W3FA 3O4OA 3VT1A 8I1BA 3VT2A 4OUJA 1MC9A 1DJSB 1V6UA 3WO2A 4EB2B 1RMLA 4G9MA 3I29B 2RG9B 4IY8A 4I1BA 1M2TB 1JT7A 3MPPG 1T9FA 3NJ5A 5F8SA 3CRHA 2VSEA 4I4VA 1V6WA 4JAWA 3NBCA 5G00A 1FWUA 2K43A 1Z4SA 4KEIA 3JRRA 1XG6A 1Q1UA 1DQOA 1TOOA 4FVVA 4QD2B 3SNVA 5DUYA 1YBIA 1FWVA 9ILBA 1IT0A 2DRZA 4IYBA 1HCDA 4JPZA 3HBWA 4GOYA 4I4RA 2Z48A 1AVWB 4H9WA 4I6IA 3VWCA 2BEAA 3FJJA 3BRDA 4ENDA 5BXPA 4ZKTB 2D7IA 3CA4A 4X38A 1KNMA 4J2YA 5F8YA 4HJJA 3HSMA 3Q7WA 5EC5A 2AQZA 3BX1C 4I2SA 4LO0C 2ERMA 2LIQA 4XFTA 1IOBA 3BAQA 4XKIA 4X39A 3UD9A 2P23A 3V0BA 4ZLBB 1BFFA 4G6MA 4IHZA 3IM6A 4EEEB 1CE7B 3V79C 2XOAA 4DEPA 1E0OA 2NP0A 4OW4A 2RSTA 4I4YA 1BASA 4OEEA 4H04A 1DLLA 4KEJA 3RMXA 2NTDA 4ZFYB 1EV2A 4EFRA 2FFVA 1G82A 3PUBA 2HW9A 1TP0A 3ZX7A 4D0ZA 3LTQA 1I1EA 5D62A 1AVUA 1TTUA 1JLYA 1FN0A 3K1XA 1DFCA 3P53A 6I1BA 4LO7C 4USPA 4IONA 4EKXB 3ZXDA 2VLCA 5BXSA 4QBVA 2GO2A 3CU1B 1PUUB 3A21A 3HOMA 1Z0HA 4QBCA 1PC8B 2K4AB 2K8RA 3EF2A 4KBBA 2P39A 5JLVA 2FDBM 3CAHA 4QC4A 4F34A 3I2XA 3CA1A 1BARA 2D20A 5GAQA 3Q7YA 5FNXA 3WMVA 3NBNA 4G6JA 1BFGA 1K5VA 2HZ9A 4QKSA 3NBDA 2KLLA 1JY0A 1TWEA 4PC4A 1AXMA 3H6SE 1HWPB 1ILR1 1PZZA 3FFZA 4J2SA 3OBTA 3POKA 5D61A 1G9BA 3PHZA 3T8SA 3FJHA 2BFHA 4USOA 4I96A 3BAVA 1HCEA 3AKGA 4LO3C 1R8NA 1L2HA 4FGFA 4OEFA 5BXTA 4QO3A 3CA3A 4ZBVB 4KC3A 1P63A 1FQ9A 1S0DA 2MC2A 1DIWA 4A7YA 3OBRA 3W9TA 2UUSA 4DCKC 1QXMA 1G9AA 1EPWA 3CRGA 21BIA 4OWKA 3P6IA 2VSAA 2FGFA 4GAFA 1G9DA 4CJMA 3V0AB 5E24E 3IAGC 4I4XA 1MD6A 1RG8A 4II0A 3BB2A 3IM7A 2Y9WC 4P6AA 4I4SA 3V0BB 4ZFUB 4P0LA 3CA5A 3N7MA 5BOWA 1PUMB 4Z9WB 5HPZA 3AJ5A 3BA5A 4A7KA 5BVPI 1BLDA 1WBAA 4WBCA 3V0AA 4I1EA 3VT0A 1QQKA 2BEBA 3BAHA 2I1BA 3NBEA 2Z49A 3HN1A 2KKIA 4R6UB 4JRAA 5FNWA 2DREA 1XHBA 4AN7B 1ITBA 3IM5A 4GAIA 4J2KA 1Q03A 1Z2VA 2MIBA 5DVHA 2WRYA 3FJBA 2ESUA 3N7LA 3OJ2A 3RMYA 1R8OA 4IZEA 1W3GA 1WD4A 2X2TA 4P0JA 3O49A 5BQUC 4LO0A 1T4QA 3R4UA 3H6QA 3FJ8A 1NUNA 4P0KA 2RQ9A 1DZDA 4HA2A 5BP5C 1FMMS 3O4BA 4LO7B 3FJ9A 5FZYA 4ZFWB 3VUOA 3AH1A 3F62B 1AFCA 1S0BA 3AZVA 1J0SA 3BAGA 1JTCA 2MLLB 3BAUA 2NZ9A 4ZOTA 3A22A 3I2AA 2AFGA 3HMYA 3UD7A 1Q04A 1W3AA 3KMVA 4L4HA 1YXWA 3BTAA 1YYNA 2D7RA 3WO3A 3E8LC 1HIBA 2J3PA 3JUTA 4QALA 3PMEA 4I3NA 1SR4C 1TWMA 1WD3A 3FJKA 1TIEA 3C9ZA 3BADA 4ZA3B 1ISWA 3RTIB 5BP5A 3BA7A 1ISZA 3FGMA 1S0CA 2F2FC 1FV2A 1JT3A 3AKHA 3TC2A 4F83A 3FJFA 1A8DA 3ZXGA 2D1ZA 1ABRB 1HWMB 3O3QA 4KEKA 2DS0A 2X2SA 2Y9GA 1PWAA 1I1BA 4QKRA 3A23A 4LO1C 2D24A 3QYDA 3O4AA 1SR4A 2YUGA 1EVTA 2E4MC 4TLPA 4J2XA 2ZR1B 2KI6B 1FGAA 3AKFA 4I4PA 3FUOA 2M49A 31BIA 1RZOB 5I1BA 4I37A 3AKIA 2QYIB 2VUAA 2ZQOA 1JT4A 1JQZA 3OJVA 3N7JA 2WBCA 5F90A 3AJ6A 2Q9XA 41BIA 2IWTB 3AZWA 1IHKA 5FZUA 4Q9PA 2AAIB 1D0HA 3N7KA 2GZBA 2NYYA 2L5XA 4J23B 1V6VA 2E4MA 4OEGA 4X37A 1VCLA 1K5UA 3WA1A 3FUQA 4LO2C 1II4A 2D44A 1GGPB 3D7WB 1IRPA 4JP0A 1YTOA 1V6XA 3RSJA 4Q9GA 4LO3A 3ILAA 3VEQA 2LIEA 1JLXA 3H6RA 2D22A 2HWMA 4DENA 1DFQA 3RTJB 3OJMA 3R4SA 3ZC9A 1G9CA 2QN4A 1SZ6B 3AH4A 1S0GA 5DZUA 4I4QA 1S0EA 3CRIA 4YOLA 2NVHA 4LO2A 4ZGRB 1XZZA 4X3AA 4QD2C 3B9UA 1OQLB 4I8MA 1QQLA 3BA4A 3VSZA 2FFUA 4EFQA 2VXTI 3BRFA 4G9NA 3A07A 1IILA 2F8XC 3AH2A 4Z8SB 2DRYA 1BFCA 1IRAX 1CVSA 4I7IA 4D0TA 5D63A 4IQPA 1YF8B 3UD8A 5B2HA 4IZXA 4EFPA 3O5WB 4Q91A 3CA0A 3FJCA 2ET2A 1FMZA 1S0FA 1EYLA 1BFBA 4I4OA 3UDAA 3MALA 5JMCA 1WBCA 4GOVA 3FJIA 4JQ0A 3WINC 1M16A 2D43A 3HALA 3IIRA 4ISQA 1JT5A 1NZKA 1BLAA 2Y9XE 3O4DA 2FO1A 5EG6C 3P6JA 2VXRA 1UPSA 3OGFA 3FJDA 3Q7XA 3O44A 2AXMA 4AN6A 4L4IA 3WMUA 3QR5A 2IHOA 3CQAA 4JKXB 2NM1A 4OWJA 5BXRA 1DZCA 4IY9A 5BQUA 3PG0A 1N4KA 3O4CA 2VU9A 3F1RA 3ZC8A 1ONKB 1F31A 5DSSB 1IJTA 1ISXA 4GP3A 5EHAA 1AVXB 3WINA 4D8HA 1BA7A 1DQGA 2ZQNA 3S8JA 4A7ZA 1S0LA 4OWLA 3LLPA 4I0YA 5F8WA 1ISVA 3N0KA 1AVAC 1XYFA 3BRGC 5FZZA 3OGGA 1FV3A 1AF9A 3FJAA 3FJEA 4LO8B 3CA6A 3UJ0A 1HWNB 4HR6C 3H6RB 3WO4A 3UJ4A 2F2FA 1ISYA 1HWOB 3BAOA 2Y9FA 2R9KB 2D23A 4G1RA 3VSFA 4JKQA 4XFSA 1TFMB 2HWAA 2KI4A 4XFUA 2Q3NB 4GP0A 1HKNA 7I1BA 3S8KA
chains in the Genus database with same CATH superfamily
4I4UA 1RY7A 2KH2A 4LO1A 4ISRA 1W3FA 3O4OA 3VT1A 8I1BA 3VT2A 4OUJA 1MC9A 1DJSB 1V6UA 3WO2A 4EB2B 1RMLA 4G9MA 3I29B 2RG9B 4IY8A 4I1BA 1M2TB 1JT7A 3MPPG 1T9FA 3NJ5A 5F8SA 3CRHA 2VSEA 4I4VA 1V6WA 4JAWA 3NBCA 5G00A 1FWUA 2K43A 1Z4SA 4KEIA 3JRRA 1XG6A 1Q1UA 1DQOA 1TOOA 4FVVA 4QD2B 3SNVA 5DUYA 1YBIA 1FWVA 9ILBA 1IT0A 2DRZA 4IYBA 1HCDA 4JPZA 3HBWA 4MZFB 4GOYA 4I4RA 2Z48A 1AVWB 4H9WA 4I6IA 3VWCA 2BEAA 3FJJA 3BRDA 4ENDA 5BXPA 4ZKTB 2D7IA 3CA4A 4X38A 1KNMA 4J2YA 5F8YA 4HJJA 3HSMA 3Q7WA 5EC5A 2AQZA 3BX1C 4I2SA 4LO0C 2ERMA 2LIQA 4XFTA 1IOBA 3BAQA 4XKIA 4X39A 3UD9A 2P23A 3V0BA 4ZLBB 1BFFA 4G6MA 4IHZA 3IM6A 4EEEB 1CE7B 3V79C 2XOAA 4DEPA 1E0OA 2NP0A 4OW4A 2RSTA 4I4YA 1BASA 4OEEA 4H04A 1DLLA 4KEJA 3RMXA 2NTDA 4ZFYB 1EV2A 4EFRA 2FFVA 1G82A 3PUBA 2HW9A 1TP0A 3ZX7A 4D0ZA 3LTQA 1I1EA 5D62A 1AVUA 1TTUA 1JLYA 1FN0A 3K1XA 1DFCA 3P53A 6I1BA 4LO7C 4USPA 4IONA 4EKXB 3ZXDA 2VLCA 5BXSA 4QBVA 2GO2A 3CU1B 1PUUB 3A21A 3HOMA 1Z0HA 4QBCA 1PC8B 2K4AB 2K8RA 3EF2A 4KBBA 2P39A 5JLVA 2FDBM 3CAHA 4QC4A 4F34A 3I2XA 3CA1A 1BARA 2D20A 5GAQA 3Q7YA 5FNXA 3WMVA 3NBNA 4G6JA 1BFGA 1K5VA 2HZ9A 4QKSA 3NBDA 2KLLA 1JY0A 1TWEA 4PC4A 1AXMA 3H6SE 1HWPB 1ILR1 1PZZA 3FFZA 4J2SA 3OBTA 3POKA 5D61A 1G9BA 3PHZA 4H75A 3FJHA 2BFHA 3T8SA 4USOA 4I96A 3BAVA 1HCEA 3AKGA 4LO3C 1R8NA 1L2HA 4FGFA 4OEFA 5BXTA 4QO3A 3CA3A 4ZBVB 4KC3A 1P63A 1FQ9A 1S0DA 2MC2A 1DIWA 4A7YA 3OBRA 3W9TA 2UUSA 4DCKC 1QXMA 1G9AA 1EPWA 3CRGA 21BIA 4OWKA 3P6IA 2VSAA 2FGFA 4GAFA 1G9DA 4CJMA 3V0AB 5E24E 3IAGC 4I4XA 1MD6A 1RG8A 2NS2A 3BB2A 4II0A 3IM7A 2Y9WC 4P6AA 4I4SA 3V0BB 4ZFUB 4P0LA 3CA5A 3N7MA 5BOWA 1PUMB 4Z9WB 5HPZA 3AJ5A 3BA5A 4A7KA 5BVPI 1BLDA 1WBAA 4WBCA 3V0AA 4I1EA 3VT0A 1QQKA 2BEBA 3BAHA 2I1BA 3NBEA 2Z49A 3HN1A 2KKIA 4R6UB 4JRAA 5FNWA 2DREA 1XHBA 4AN7B 1ITBA 3IM5A 4GAIA 4J2KA 1Q03A 1Z2VA 2MIBA 5DVHA 2WRYA 3FJBA 2ESUA 3N7LA 3OJ2A 3RMYA 1R8OA 4IZEA 1W3GA 1WD4A 2X2TA 4P0JA 3O49A 5BQUC 4LO0A 1T4QA 3R4UA 3H6QA 3FJ8A 1NUNA 4P0KA 2RQ9A 1DZDA 4HA2A 5BP5C 1FMMS 3O4BA 4LO7B 3FJ9A 5FZYA 4ZFWB 3VUOA 3AH1A 3F62B 1AFCA 1S0BA 3AZVA 1J0SA 3BAGA 1JTCA 2MLLB 3BAUA 2NZ9A 4ZOTA 3A22A 3I2AA 2AFGA 3HMYA 3UD7A 1Q04A 1W3AA 3KMVA 4L4HA 1YXWA 3BTAA 1YYNA 2D7RA 3WO3A 3E8LC 1HIBA 2J3PA 3JUTA 4QALA 3PMEA 4I3NA 1SR4C 1TWMA 1WD3A 3FJKA 1TIEA 3C9ZA 3BADA 4ZA3B 1ISWA 3RTIB 5BP5A 3BA7A 1ISZA 3FGMA 1S0CA 2F2FC 1FV2A 1JT3A 3AKHA 3TC2A 4F83A 3FJFA 1A8DA 3ZXGA 2D1ZA 1ABRB 1HWMB 3O3QA 4KEKA 2DS0A 2X2SA 2Y9GA 1PWAA 1I1BA 4QKRA 3A23A 4LO1C 2D24A 3QYDA 3O4AA 1SR4A 2YUGA 1EVTA 2E4MC 4TLPA 4J2XA 2ZR1B 2KI6B 1FGAA 3AKFA 4I4PA 3FUOA 2M49A 31BIA 1RZOB 5I1BA 4I37A 3AKIA 2QYIB 2VUAA 2ZQOA 1JT4A 1JQZA 3OJVA 3N7JA 2WBCA 5F90A 3AJ6A 2Q9XA 41BIA 2IWTB 3AZWA 1IHKA 5FZUA 4MZHA 4Q9PA 4MZGB 2AAIB 1D0HA 3N7KA 2GZBA 2NYYA 2L5XA 4J23B 1V6VA 2E4MA 4OEGA 4X37A 1VCLA 1K5UA 3WA1A 3FUQA 4LO2C 1II4A 2D44A 1GGPB 3D7WB 1IRPA 4JP0A 1YTOA 1V6XA 3RSJA 4Q9GA 4LO3A 3ILAA 3VEQA 2LIEA 1JLXA 3H6RA 2D22A 2HWMA 4DENA 1DFQA 3RTJB 3OJMA 3R4SA 3ZC9A 1G9CA 2QN4A 1SZ6B 3AH4A 1S0GA 5DZUA 4I4QA 1S0EA 3CRIA 4YOLA 2NVHA 4LO2A 4ZGRB 1XZZA 4X3AA 4QD2C 3B9UA 1OQLB 4I8MA 1QQLA 3BA4A 3VSZA 2FFUA 4EFQA 2VXTI 3BRFA 4G9NA 3A07A 1IILA 2F8XC 3AH2A 4Z8SB 2DRYA 1BFCA 1IRAX 1CVSA 4I7IA 4D0TA 5D63A 4IQPA 1YF8B 3UD8A 5B2HA 4IZXA 4EFPA 3O5WB 4Q91A 3CA0A 3FJCA 2ET2A 1FMZA 1S0FA 1EYLA 1BFBA 4I4OA 3UDAA 3MALA 5JMCA 1WBCA 4GOVA 3FJIA 4JQ0A 3WINC 1M16A 2D43A 3HALA 3IIRA 4ISQA 1JT5A 1NZKA 1BLAA 2Y9XE 3O4DA 2FO1A 5EG6C 3P6JA 2VXRA 1UPSA 3OGFA 3FJDA 3Q7XA 3O44A 2AXMA 4AN6A 4L4IA 3WMUA 3QR5A 2IHOA 3CQAA 4JKXB 2NM1A 4OWJA 5BXRA 1DZCA 4IY9A 5BQUA 3PG0A 1N4KA 3O4CA 2VU9A 3F1RA 3ZC8A 4UY4A 1ONKB 1F31A 5DSSB 1IJTA 1ISXA 4GP3A 5EHAA 1AVXB 3WINA 4D8HA 1BA7A 1DQGA 2ZQNA 3S8JA 4A7ZA 1S0LA 4OWLA 3LLPA 4I0YA 5F8WA 1ISVA 3N0KA 1AVAC 1XYFA 3BRGC 5FZZA 3OGGA 1FV3A 1AF9A 3FJAA 3FJEA 4LO8B 3CA6A 3UJ0A 1HWNB 4HR6C 3H6RB 3WO4A 3UJ4A 2F2FA 1ISYA 1HWOB 3BAOA 2Y9FA 2R9KB 2D23A 4G1RA 3VSFA 4JKQA 4XFSA 1TFMB 2HWAA 2KI4A 4XFUA 2Q3NB 4GP0A 1HKNA 7I1BA 3S8KA
chains in the Genus database with same CATH topology
4I4UA 1RY7A 2KH2A 4LO1A 4ISRA 1W3FA 3O4OA 3VT1A 8I1BA 3VT2A 4OUJA 1MC9A 1DJSB 1V6UA 3WO2A 4EB2B 1RMLA 4G9MA 3I29B 2RG9B 4IY8A 4I1BA 1M2TB 1JT7A 3MPPG 1T9FA 3NJ5A 5F8SA 3CRHA 2VSEA 4I4VA 1V6WA 4JAWA 3NBCA 5G00A 1FWUA 2K43A 1Z4SA 4KEIA 3JRRA 1XG6A 1Q1UA 1DQOA 1TOOA 4FVVA 4QD2B 3SNVA 5DUYA 1YBIA 1FWVA 9ILBA 1IT0A 2DRZA 4IYBA 1HCDA 4JPZA 3HBWA 4MZFB 4GOYA 4I4RA 2Z48A 1AVWB 4H9WA 4I6IA 3VWCA 2BEAA 3FJJA 3BRDA 4ENDA 5BXPA 4ZKTB 2D7IA 3CA4A 4X38A 1KNMA 4J2YA 5F8YA 4HJJA 3HSMA 3Q7WA 5EC5A 2AQZA 3BX1C 4I2SA 4LO0C 2ERMA 2LIQA 4XFTA 1IOBA 3BAQA 4XKIA 4X39A 3UD9A 2P23A 3V0BA 4ZLBB 1BFFA 4G6MA 4IHZA 3IM6A 4EEEB 1CE7B 3V79C 2XOAA 4DEPA 1E0OA 2NP0A 4OW4A 2RSTA 4I4YA 1BASA 4OEEA 4H04A 1DLLA 4KEJA 3RMXA 2NTDA 4ZFYB 1EV2A 4EFRA 2FFVA 1G82A 3PUBA 2HW9A 1TP0A 3ZX7A 4D0ZA 3LTQA 1I1EA 5D62A 1AVUA 1TTUA 1JLYA 1FN0A 3K1XA 1DFCA 3P53A 6I1BA 4LO7C 4USPA 4IONA 4EKXB 3ZXDA 2VLCA 5BXSA 4QBVA 2GO2A 3CU1B 1PUUB 3A21A 3HOMA 1Z0HA 4QBCA 1PC8B 2K4AB 2K8RA 3EF2A 4KBBA 2P39A 5JLVA 2FDBM 3CAHA 4QC4A 4F34A 3I2XA 3CA1A 1BARA 2D20A 5GAQA 3Q7YA 5FNXA 3WMVA 3NBNA 4G6JA 1BFGA 1K5VA 2HZ9A 4QKSA 3NBDA 2KLLA 1JY0A 1TWEA 4PC4A 1AXMA 3H6SE 1HWPB 1ILR1 1PZZA 3FFZA 4J2SA 3OBTA 3POKA 5D61A 1G9BA 3PHZA 4H75A 3FJHA 2BFHA 3T8SA 4USOA 4I96A 3BAVA 1HCEA 3AKGA 4LO3C 1R8NA 1L2HA 4FGFA 4OEFA 5BXTA 4QO3A 3CA3A 4ZBVB 4KC3A 1P63A 1FQ9A 1S0DA 2MC2A 1DIWA 4A7YA 3OBRA 3W9TA 2UUSA 4DCKC 1QXMA 1G9AA 1EPWA 3CRGA 21BIA 4OWKA 3P6IA 2VSAA 2FGFA 4GAFA 1G9DA 4CJMA 3V0AB 5E24E 3IAGC 4I4XA 1MD6A 1RG8A 2NS2A 3BB2A 4II0A 3IM7A 2Y9WC 4P6AA 4I4SA 3V0BB 4ZFUB 4P0LA 3CA5A 3N7MA 5BOWA 1PUMB 4Z9WB 5HPZA 3AJ5A 3BA5A 4A7KA 5BVPI 1BLDA 1WBAA 4WBCA 3V0AA 4I1EA 3VT0A 1QQKA 2BEBA 3BAHA 2I1BA 3NBEA 2Z49A 3HN1A 2KKIA 4R6UB 4JRAA 5FNWA 2DREA 1XHBA 4AN7B 1ITBA 3IM5A 4GAIA 4J2KA 1Q03A 1Z2VA 2MIBA 5DVHA 2WRYA 3FJBA 2ESUA 3N7LA 3OJ2A 3RMYA 1R8OA 4IZEA 1W3GA 1WD4A 2X2TA 4P0JA 3O49A 5BQUC 4LO0A 1T4QA 3R4UA 3H6QA 3FJ8A 1NUNA 4P0KA 2RQ9A 1DZDA 4HA2A 5BP5C 1FMMS 3O4BA 4LO7B 3FJ9A 5FZYA 4ZFWB 3VUOA 3AH1A 3F62B 1AFCA 1S0BA 3AZVA 1J0SA 3BAGA 1JTCA 2MLLB 3BAUA 2NZ9A 4ZOTA 3A22A 3I2AA 2AFGA 3HMYA 3UD7A 1Q04A 1W3AA 3KMVA 4L4HA 1YXWA 3BTAA 1YYNA 2D7RA 3WO3A 3E8LC 1HIBA 2J3PA 3JUTA 4QALA 3PMEA 4I3NA 1SR4C 1TWMA 1WD3A 3FJKA 1TIEA 3C9ZA 3BADA 4ZA3B 1ISWA 3RTIB 5BP5A 3BA7A 1ISZA 3FGMA 1S0CA 2F2FC 1FV2A 1JT3A 3AKHA 3TC2A 4F83A 3FJFA 1A8DA 3ZXGA 2D1ZA 1ABRB 1HWMB 3O3QA 4KEKA 2DS0A 2X2SA 2Y9GA 1PWAA 1I1BA 4QKRA 3A23A 4LO1C 2D24A 3QYDA 3O4AA 1SR4A 2YUGA 1EVTA 2E4MC 4TLPA 4J2XA 2ZR1B 2KI6B 1FGAA 3AKFA 4I4PA 3FUOA 2M49A 31BIA 1RZOB 5I1BA 4I37A 3AKIA 2QYIB 2VUAA 2ZQOA 1JT4A 1JQZA 3OJVA 3N7JA 2WBCA 5F90A 3AJ6A 2Q9XA 41BIA 2IWTB 3AZWA 1IHKA 5FZUA 4MZHA 4Q9PA 4MZGB 2AAIB 1D0HA 3N7KA 2GZBA 2NYYA 2L5XA 4J23B 1V6VA 2E4MA 4OEGA 4X37A 1VCLA 1K5UA 3WA1A 3FUQA 4LO2C 1II4A 2D44A 1GGPB 3D7WB 1IRPA 4JP0A 1YTOA 1V6XA 3RSJA 4Q9GA 4LO3A 3ILAA 3VEQA 2LIEA 1JLXA 3H6RA 2D22A 2HWMA 4DENA 1DFQA 3RTJB 3OJMA 3R4SA 3ZC9A 1G9CA 2QN4A 1SZ6B 3AH4A 1S0GA 5DZUA 4I4QA 1S0EA 3CRIA 4YOLA 2NVHA 4LO2A 4ZGRB 1XZZA 4X3AA 4QD2C 3B9UA 1OQLB 4I8MA 1QQLA 3BA4A 3VSZA 2FFUA 4EFQA 2VXTI 3BRFA 4G9NA 3A07A 1IILA 2F8XC 3AH2A 4Z8SB 2DRYA 1BFCA 1IRAX 1CVSA 4I7IA 4D0TA 5D63A 4IQPA 1YF8B 3UD8A 5B2HA 4IZXA 4EFPA 3O5WB 4Q91A 3CA0A 3FJCA 2ET2A 1FMZA 1S0FA 1EYLA 1BFBA 4I4OA 3UDAA 3MALA 5JMCA 1WBCA 4GOVA 3FJIA 4JQ0A 3WINC 1M16A 2D43A 3HALA 3IIRA 4ISQA 1JT5A 1NZKA 1BLAA 2Y9XE 3O4DA 2FO1A 5EG6C 3P6JA 2VXRA 1UPSA 3OGFA 3FJDA 3Q7XA 3O44A 2AXMA 4AN6A 4L4IA 3WMUA 3QR5A 2IHOA 3CQAA 4JKXB 2NM1A 4OWJA 5BXRA 1DZCA 4IY9A 5BQUA 3PG0A 1N4KA 3O4CA 2VU9A 3F1RA 3ZC8A 4UY4A 1ONKB 1F31A 5DSSB 1IJTA 1ISXA 4GP3A 5EHAA 1AVXB 3WINA 4D8HA 1BA7A 1DQGA 2ZQNA 3S8JA 4A7ZA 1S0LA 4OWLA 3LLPA 4I0YA 5F8WA 1ISVA 3N0KA 1AVAC 1XYFA 3BRGC 5FZZA 3OGGA 1FV3A 1AF9A 3FJAA 3FJEA 4LO8B 3CA6A 3UJ0A 1HWNB 4HR6C 3H6RB 3WO4A 3UJ4A 2F2FA 1ISYA 1HWOB 3BAOA 2Y9FA 2R9KB 2D23A 4G1RA 3VSFA 4JKQA 4XFSA 1TFMB 2HWAA 2KI4A 4XFUA 2Q3NB 4GP0A 1HKNA 7I1BA 3S8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4U A;  1RY7 A;  2KH2 A;  4LO1 A;  4ISR A;  1W3F A;  3O4O A;  3VT1 A;  8I1B A;  3VT2 A;  4OUJ A;  1MC9 A;  1DJS B;  1V6U A;  3WO2 A;  4EB2 B;  1RML A;  4G9M A;  3I29 B;  2RG9 B;  4IY8 A;  4I1B A;  1M2T B;  1JT7 A;  3MPP G;  1T9F A;  3NJ5 A;  5F8S A;  3CRH A;  2VSE A;  4I4V A;  1V6W A;  4JAW A;  3NBC A;  5G00 A;  1FWU A;  2K43 A;  1Z4S A;  4KEI A;  3JRR A;  1XG6 A;  1Q1U A;  1DQO A;  1TOO A;  4FVV A;  4QD2 B;  3SNV A;  5DUY A;  1YBI A;  1FWV A;  9ILB A;  1IT0 A;  2DRZ A;  4IYB A;  1HCD A;  4JPZ A;  3HBW A;  4GOY A;  4I4R A;  2Z48 A;  1AVW B;  4H9W A;  4I6I A;  3VWC A;  2BEA A;  3FJJ A;  3BRD A;  4END A;  5BXP A;  4ZKT B;  2D7I A;  3CA4 A;  4X38 A;  1KNM A;  4J2Y A;  5F8Y A;  4HJJ A;  3HSM A;  3Q7W A;  5EC5 A;  2AQZ A;  3BX1 C;  4I2S A;  4LO0 C;  2ERM A;  2LIQ A;  4XFT A;  1IOB A;  3BAQ A;  4XKI A;  4X39 A;  3UD9 A;  2P23 A;  3V0B A;  4ZLB B;  1BFF A;  4G6M A;  4IHZ A;  3IM6 A;  4EEE B;  1CE7 B;  3V79 C;  2XOA A;  4DEP A;  1E0O A;  2NP0 A;  4OW4 A;  2RST A;  4I4Y A;  1BAS A;  4OEE A;  4H04 A;  1DLL A;  4KEJ A;  3RMX A;  2NTD A;  4ZFY B;  1EV2 A;  4EFR A;  2FFV A;  1G82 A;  3PUB A;  2HW9 A;  1TP0 A;  3ZX7 A;  4D0Z A;  3LTQ A;  1I1E A;  5D62 A;  1AVU A;  1TTU A;  1JLY A;  1FN0 A;  3K1X A;  1DFC A;  3P53 A;  6I1B A;  4LO7 C;  4USP A;  4ION A;  4EKX B;  3ZXD A;  2VLC A;  5BXS A;  4QBV A;  2GO2 A;  3CU1 B;  1PUU B;  3A21 A;  3HOM A;  1Z0H A;  4QBC A;  1PC8 B;  2K4A B;  2K8R A;  3EF2 A;  4KBB A;  2P39 A;  5JLV A;  2FDB M;  3CAH A;  4QC4 A;  4F34 A;  3I2X A;  3CA1 A;  1BAR A;  2D20 A;  5GAQ A;  3Q7Y A;  5FNX A;  3WMV A;  3NBN A;  4G6J A;  1BFG A;  1K5V A;  2HZ9 A;  4QKS A;  3NBD A;  2KLL A;  1JY0 A;  1TWE A;  4PC4 A;  1AXM A;  3H6S E;  1HWP B;  1ILR 1;  1PZZ A;  3FFZ A;  4J2S A;  3OBT A;  3POK A;  5D61 A;  1G9B A;  3PHZ A;  3T8S A;  3FJH A;  2BFH A;  4USO A;  4I96 A;  3BAV A;  1HCE A;  3AKG A;  4LO3 C;  1R8N A;  1L2H A;  4FGF A;  4OEF A;  5BXT A;  4QO3 A;  3CA3 A;  4ZBV B;  4KC3 A;  1P63 A;  1FQ9 A;  1S0D A;  2MC2 A;  1DIW A;  4A7Y A;  3OBR A;  3W9T A;  2UUS A;  4DCK C;  1QXM A;  1G9A A;  1EPW A;  3CRG A;  21BI A;  4OWK A;  3P6I A;  2VSA A;  2FGF A;  4GAF A;  1G9D A;  4CJM A;  3V0A B;  5E24 E;  3IAG C;  4I4X A;  1MD6 A;  1RG8 A;  4II0 A;  3BB2 A;  3IM7 A;  2Y9W C;  4P6A A;  4I4S A;  3V0B B;  4ZFU B;  4P0L A;  3CA5 A;  3N7M A;  5BOW A;  1PUM B;  4Z9W B;  5HPZ A;  3AJ5 A;  3BA5 A;  4A7K A;  5BVP I;  1BLD A;  1WBA A;  4WBC A;  3V0A A;  4I1E A;  3VT0 A;  1QQK A;  2BEB A;  3BAH A;  2I1B A;  3NBE A;  2Z49 A;  3HN1 A;  2KKI A;  4R6U B;  4JRA A;  5FNW A;  2DRE A;  1XHB A;  4AN7 B;  1ITB A;  3IM5 A;  4GAI A;  4J2K A;  1Q03 A;  1Z2V A;  2MIB A;  5DVH A;  2WRY A;  3FJB A;  2ESU A;  3N7L A;  3OJ2 A;  3RMY A;  1R8O A;  4IZE A;  1W3G A;  1WD4 A;  2X2T A;  4P0J A;  3O49 A;  5BQU C;  4LO0 A;  1T4Q A;  3R4U A;  3H6Q A;  3FJ8 A;  1NUN A;  4P0K A;  2RQ9 A;  1DZD A;  4HA2 A;  5BP5 C;  1FMM S;  3O4B A;  4LO7 B;  3FJ9 A;  5FZY A;  4ZFW B;  3VUO A;  3AH1 A;  3F62 B;  1AFC A;  1S0B A;  3AZV A;  1J0S A;  3BAG A;  1JTC A;  2MLL B;  3BAU A;  2NZ9 A;  4ZOT A;  3A22 A;  3I2A A;  2AFG A;  3HMY A;  3UD7 A;  1Q04 A;  1W3A A;  3KMV A;  4L4H A;  1YXW A;  3BTA A;  1YYN A;  2D7R A;  3WO3 A;  3E8L C;  1HIB A;  2J3P A;  3JUT A;  4QAL A;  3PME A;  4I3N A;  1SR4 C;  1TWM A;  1WD3 A;  3FJK A;  1TIE A;  3C9Z A;  3BAD A;  4ZA3 B;  1ISW A;  3RTI B;  5BP5 A;  3BA7 A;  1ISZ A;  3FGM A;  1S0C A;  2F2F C;  1FV2 A;  1JT3 A;  3AKH A;  3TC2 A;  4F83 A;  3FJF A;  1A8D A;  3ZXG A;  2D1Z A;  1ABR B;  1HWM B;  3O3Q A;  4KEK A;  2DS0 A;  2X2S A;  2Y9G A;  1PWA A;  1I1B A;  4QKR A;  3A23 A;  4LO1 C;  2D24 A;  3QYD A;  3O4A A;  1SR4 A;  2YUG A;  1EVT A;  2E4M C;  4TLP A;  4J2X A;  2ZR1 B;  2KI6 B;  1FGA A;  3AKF A;  4I4P A;  3FUO A;  2M49 A;  31BI A;  1RZO B;  5I1B A;  4I37 A;  3AKI A;  2QYI B;  2VUA A;  2ZQO A;  1JT4 A;  1JQZ A;  3OJV A;  3N7J A;  2WBC A;  5F90 A;  3AJ6 A;  2Q9X A;  41BI A;  2IWT B;  3AZW A;  1IHK A;  5FZU A;  4Q9P A;  2AAI B;  1D0H A;  3N7K A;  2GZB A;  2NYY A;  2L5X A;  4J23 B;  1V6V A;  2E4M A;  4OEG A;  4X37 A;  1VCL A;  1K5U A;  3WA1 A;  3FUQ A;  4LO2 C;  1II4 A;  2D44 A;  1GGP B;  3D7W B;  1IRP A;  4JP0 A;  1YTO A;  1V6X A;  3RSJ A;  4Q9G A;  4LO3 A;  3ILA A;  3VEQ A;  2LIE A;  1JLX A;  3H6R A;  2D22 A;  2HWM A;  4DEN A;  1DFQ A;  3RTJ B;  3OJM A;  3R4S A;  3ZC9 A;  1G9C A;  2QN4 A;  1SZ6 B;  3AH4 A;  1S0G A;  5DZU A;  4I4Q A;  1S0E A;  3CRI A;  4YOL A;  2NVH A;  4LO2 A;  4ZGR B;  1XZZ A;  4X3A A;  4QD2 C;  3B9U A;  1OQL B;  4I8M A;  1QQL A;  3BA4 A;  3VSZ A;  2FFU A;  4EFQ A;  2VXT I;  3BRF A;  4G9N A;  3A07 A;  1IIL A;  2F8X C;  3AH2 A;  4Z8S B;  2DRY A;  1BFC A;  1IRA X;  1CVS A;  4I7I A;  4D0T A;  5D63 A;  4IQP A;  1YF8 B;  3UD8 A;  5B2H A;  4IZX A;  4EFP A;  3O5W B;  4Q91 A;  3CA0 A;  3FJC A;  2ET2 A;  1FMZ A;  1S0F A;  1EYL A;  1BFB A;  4I4O A;  3UDA A;  3MAL A;  5JMC A;  1WBC A;  4GOV A;  3FJI A;  4JQ0 A;  3WIN C;  1M16 A;  2D43 A;  3HAL A;  3IIR A;  4ISQ A;  1JT5 A;  1NZK A;  1BLA A;  2Y9X E;  3O4D A;  2FO1 A;  5EG6 C;  3P6J A;  2VXR A;  1UPS A;  3OGF A;  3FJD A;  3Q7X A;  3O44 A;  2AXM A;  4AN6 A;  4L4I A;  3WMU A;  3QR5 A;  2IHO A;  3CQA A;  4JKX B;  2NM1 A;  4OWJ A;  5BXR A;  1DZC A;  4IY9 A;  5BQU A;  3PG0 A;  1N4K A;  3O4C A;  2VU9 A;  3F1R A;  3ZC8 A;  1ONK B;  1F31 A;  5DSS B;  1IJT A;  1ISX A;  4GP3 A;  5EHA A;  1AVX B;  3WIN A;  4D8H A;  1BA7 A;  1DQG A;  2ZQN A;  3S8J A;  4A7Z A;  1S0L A;  4OWL A;  3LLP A;  4I0Y A;  5F8W A;  1ISV A;  3N0K A;  1AVA C;  1XYF A;  3BRG C;  5FZZ A;  3OGG A;  1FV3 A;  1AF9 A;  3FJA A;  3FJE A;  4LO8 B;  3CA6 A;  3UJ0 A;  1HWN B;  4HR6 C;  3H6R B;  3WO4 A;  3UJ4 A;  2F2F A;  1ISY A;  1HWO B;  3BAO A;  2Y9F A;  2R9K B;  2D23 A;  4G1R A;  3VSF A;  4JKQ A;  4XFS A;  1TFM B;  2HWA A;  2KI4 A;  4XFU A;  2Q3N B;  4GP0 A;  1HKN A;  7I1B A;  3S8K A; 
#chains in the Genus database with same CATH topology
 4I4U A;  1RY7 A;  2KH2 A;  4LO1 A;  4ISR A;  1W3F A;  3O4O A;  3VT1 A;  8I1B A;  3VT2 A;  4OUJ A;  1MC9 A;  1DJS B;  1V6U A;  3WO2 A;  4EB2 B;  1RML A;  4G9M A;  3I29 B;  2RG9 B;  4IY8 A;  4I1B A;  1M2T B;  1JT7 A;  3MPP G;  1T9F A;  3NJ5 A;  5F8S A;  3CRH A;  2VSE A;  4I4V A;  1V6W A;  4JAW A;  3NBC A;  5G00 A;  1FWU A;  2K43 A;  1Z4S A;  4KEI A;  3JRR A;  1XG6 A;  1Q1U A;  1DQO A;  1TOO A;  4FVV A;  4QD2 B;  3SNV A;  5DUY A;  1YBI A;  1FWV A;  9ILB A;  1IT0 A;  2DRZ A;  4IYB A;  1HCD A;  4JPZ A;  3HBW A;  4MZF B;  4GOY A;  4I4R A;  2Z48 A;  1AVW B;  4H9W A;  4I6I A;  3VWC A;  2BEA A;  3FJJ A;  3BRD A;  4END A;  5BXP A;  4ZKT B;  2D7I A;  3CA4 A;  4X38 A;  1KNM A;  4J2Y A;  5F8Y A;  4HJJ A;  3HSM A;  3Q7W A;  5EC5 A;  2AQZ A;  3BX1 C;  4I2S A;  4LO0 C;  2ERM A;  2LIQ A;  4XFT A;  1IOB A;  3BAQ A;  4XKI A;  4X39 A;  3UD9 A;  2P23 A;  3V0B A;  4ZLB B;  1BFF A;  4G6M A;  4IHZ A;  3IM6 A;  4EEE B;  1CE7 B;  3V79 C;  2XOA A;  4DEP A;  1E0O A;  2NP0 A;  4OW4 A;  2RST A;  4I4Y A;  1BAS A;  4OEE A;  4H04 A;  1DLL A;  4KEJ A;  3RMX A;  2NTD A;  4ZFY B;  1EV2 A;  4EFR A;  2FFV A;  1G82 A;  3PUB A;  2HW9 A;  1TP0 A;  3ZX7 A;  4D0Z A;  3LTQ A;  1I1E A;  5D62 A;  1AVU A;  1TTU A;  1JLY A;  1FN0 A;  3K1X A;  1DFC A;  3P53 A;  6I1B A;  4LO7 C;  4USP A;  4ION A;  4EKX B;  3ZXD A;  2VLC A;  5BXS A;  4QBV A;  2GO2 A;  3CU1 B;  1PUU B;  3A21 A;  3HOM A;  1Z0H A;  4QBC A;  1PC8 B;  2K4A B;  2K8R A;  3EF2 A;  4KBB A;  2P39 A;  5JLV A;  2FDB M;  3CAH A;  4QC4 A;  4F34 A;  3I2X A;  3CA1 A;  1BAR A;  2D20 A;  5GAQ A;  3Q7Y A;  5FNX A;  3WMV A;  3NBN A;  4G6J A;  1BFG A;  1K5V A;  2HZ9 A;  4QKS A;  3NBD A;  2KLL A;  1JY0 A;  1TWE A;  4PC4 A;  1AXM A;  3H6S E;  1HWP B;  1ILR 1;  1PZZ A;  3FFZ A;  4J2S A;  3OBT A;  3POK A;  5D61 A;  1G9B A;  3PHZ A;  4H75 A;  3FJH A;  2BFH A;  3T8S A;  4USO A;  4I96 A;  3BAV A;  1HCE A;  3AKG A;  4LO3 C;  1R8N A;  1L2H A;  4FGF A;  4OEF A;  5BXT A;  4QO3 A;  3CA3 A;  4ZBV B;  4KC3 A;  1P63 A;  1FQ9 A;  1S0D A;  2MC2 A;  1DIW A;  4A7Y A;  3OBR A;  3W9T A;  2UUS A;  4DCK C;  1QXM A;  1G9A A;  1EPW A;  3CRG A;  21BI A;  4OWK A;  3P6I A;  2VSA A;  2FGF A;  4GAF A;  1G9D A;  4CJM A;  3V0A B;  5E24 E;  3IAG C;  4I4X A;  1MD6 A;  1RG8 A;  2NS2 A;  3BB2 A;  4II0 A;  3IM7 A;  2Y9W C;  4P6A A;  4I4S A;  3V0B B;  4ZFU B;  4P0L A;  3CA5 A;  3N7M A;  5BOW A;  1PUM B;  4Z9W B;  5HPZ A;  3AJ5 A;  3BA5 A;  4A7K A;  5BVP I;  1BLD A;  1WBA A;  4WBC A;  3V0A A;  4I1E A;  3VT0 A;  1QQK A;  2BEB A;  3BAH A;  2I1B A;  3NBE A;  2Z49 A;  3HN1 A;  2KKI A;  4R6U B;  4JRA A;  5FNW A;  2DRE A;  1XHB A;  4AN7 B;  1ITB A;  3IM5 A;  4GAI A;  4J2K A;  1Q03 A;  1Z2V A;  2MIB A;  5DVH A;  2WRY A;  3FJB A;  2ESU A;  3N7L A;  3OJ2 A;  3RMY A;  1R8O A;  4IZE A;  1W3G A;  1WD4 A;  2X2T A;  4P0J A;  3O49 A;  5BQU C;  4LO0 A;  1T4Q A;  3R4U A;  3H6Q A;  3FJ8 A;  1NUN A;  4P0K A;  2RQ9 A;  1DZD A;  4HA2 A;  5BP5 C;  1FMM S;  3O4B A;  4LO7 B;  3FJ9 A;  5FZY A;  4ZFW B;  3VUO A;  3AH1 A;  3F62 B;  1AFC A;  1S0B A;  3AZV A;  1J0S A;  3BAG A;  1JTC A;  2MLL B;  3BAU A;  2NZ9 A;  4ZOT A;  3A22 A;  3I2A A;  2AFG A;  3HMY A;  3UD7 A;  1Q04 A;  1W3A A;  3KMV A;  4L4H A;  1YXW A;  3BTA A;  1YYN A;  2D7R A;  3WO3 A;  3E8L C;  1HIB A;  2J3P A;  3JUT A;  4QAL A;  3PME A;  4I3N A;  1SR4 C;  1TWM A;  1WD3 A;  3FJK A;  1TIE A;  3C9Z A;  3BAD A;  4ZA3 B;  1ISW A;  3RTI B;  5BP5 A;  3BA7 A;  1ISZ A;  3FGM A;  1S0C A;  2F2F C;  1FV2 A;  1JT3 A;  3AKH A;  3TC2 A;  4F83 A;  3FJF A;  1A8D A;  3ZXG A;  2D1Z A;  1ABR B;  1HWM B;  3O3Q A;  4KEK A;  2DS0 A;  2X2S A;  2Y9G A;  1PWA A;  1I1B A;  4QKR A;  3A23 A;  4LO1 C;  2D24 A;  3QYD A;  3O4A A;  1SR4 A;  2YUG A;  1EVT A;  2E4M C;  4TLP A;  4J2X A;  2ZR1 B;  2KI6 B;  1FGA A;  3AKF A;  4I4P A;  3FUO A;  2M49 A;  31BI A;  1RZO B;  5I1B A;  4I37 A;  3AKI A;  2QYI B;  2VUA A;  2ZQO A;  1JT4 A;  1JQZ A;  3OJV A;  3N7J A;  2WBC A;  5F90 A;  3AJ6 A;  2Q9X A;  41BI A;  2IWT B;  3AZW A;  1IHK A;  5FZU A;  4MZH A;  4Q9P A;  4MZG B;  2AAI B;  1D0H A;  3N7K A;  2GZB A;  2NYY A;  2L5X A;  4J23 B;  1V6V A;  2E4M A;  4OEG A;  4X37 A;  1VCL A;  1K5U A;  3WA1 A;  3FUQ A;  4LO2 C;  1II4 A;  2D44 A;  1GGP B;  3D7W B;  1IRP A;  4JP0 A;  1YTO A;  1V6X A;  3RSJ A;  4Q9G A;  4LO3 A;  3ILA A;  3VEQ A;  2LIE A;  1JLX A;  3H6R A;  2D22 A;  2HWM A;  4DEN A;  1DFQ A;  3RTJ B;  3OJM A;  3R4S A;  3ZC9 A;  1G9C A;  2QN4 A;  1SZ6 B;  3AH4 A;  1S0G A;  5DZU A;  4I4Q A;  1S0E A;  3CRI A;  4YOL A;  2NVH A;  4LO2 A;  4ZGR B;  1XZZ A;  4X3A A;  4QD2 C;  3B9U A;  1OQL B;  4I8M A;  1QQL A;  3BA4 A;  3VSZ A;  2FFU A;  4EFQ A;  2VXT I;  3BRF A;  4G9N A;  3A07 A;  1IIL A;  2F8X C;  3AH2 A;  4Z8S B;  2DRY A;  1BFC A;  1IRA X;  1CVS A;  4I7I A;  4D0T A;  5D63 A;  4IQP A;  1YF8 B;  3UD8 A;  5B2H A;  4IZX A;  4EFP A;  3O5W B;  4Q91 A;  3CA0 A;  3FJC A;  2ET2 A;  1FMZ A;  1S0F A;  1EYL A;  1BFB A;  4I4O A;  3UDA A;  3MAL A;  5JMC A;  1WBC A;  4GOV A;  3FJI A;  4JQ0 A;  3WIN C;  1M16 A;  2D43 A;  3HAL A;  3IIR A;  4ISQ A;  1JT5 A;  1NZK A;  1BLA A;  2Y9X E;  3O4D A;  2FO1 A;  5EG6 C;  3P6J A;  2VXR A;  1UPS A;  3OGF A;  3FJD A;  3Q7X A;  3O44 A;  2AXM A;  4AN6 A;  4L4I A;  3WMU A;  3QR5 A;  2IHO A;  3CQA A;  4JKX B;  2NM1 A;  4OWJ A;  5BXR A;  1DZC A;  4IY9 A;  5BQU A;  3PG0 A;  1N4K A;  3O4C A;  2VU9 A;  3F1R A;  3ZC8 A;  4UY4 A;  1ONK B;  1F31 A;  5DSS B;  1IJT A;  1ISX A;  4GP3 A;  5EHA A;  1AVX B;  3WIN A;  4D8H A;  1BA7 A;  1DQG A;  2ZQN A;  3S8J A;  4A7Z A;  1S0L A;  4OWL A;  3LLP A;  4I0Y A;  5F8W A;  1ISV A;  3N0K A;  1AVA C;  1XYF A;  3BRG C;  5FZZ A;  3OGG A;  1FV3 A;  1AF9 A;  3FJA A;  3FJE A;  4LO8 B;  3CA6 A;  3UJ0 A;  1HWN B;  4HR6 C;  3H6R B;  3WO4 A;  3UJ4 A;  2F2F A;  1ISY A;  1HWO B;  3BAO A;  2Y9F A;  2R9K B;  2D23 A;  4G1R A;  3VSF A;  4JKQ A;  4XFS A;  1TFM B;  2HWA A;  2KI4 A;  4XFU A;  2Q3N B;  4GP0 A;  1HKN A;  7I1B A;  3S8K A; 
#chains in the Genus database with same CATH homology
 4I4U A;  1RY7 A;  2KH2 A;  4LO1 A;  4ISR A;  1W3F A;  3O4O A;  3VT1 A;  8I1B A;  3VT2 A;  4OUJ A;  1MC9 A;  1DJS B;  1V6U A;  3WO2 A;  4EB2 B;  1RML A;  4G9M A;  3I29 B;  2RG9 B;  4IY8 A;  4I1B A;  1M2T B;  1JT7 A;  3MPP G;  1T9F A;  3NJ5 A;  5F8S A;  3CRH A;  2VSE A;  4I4V A;  1V6W A;  4JAW A;  3NBC A;  5G00 A;  1FWU A;  2K43 A;  1Z4S A;  4KEI A;  3JRR A;  1XG6 A;  1Q1U A;  1DQO A;  1TOO A;  4FVV A;  4QD2 B;  3SNV A;  5DUY A;  1YBI A;  1FWV A;  9ILB A;  1IT0 A;  2DRZ A;  4IYB A;  1HCD A;  4JPZ A;  3HBW A;  4MZF B;  4GOY A;  4I4R A;  2Z48 A;  1AVW B;  4H9W A;  4I6I A;  3VWC A;  2BEA A;  3FJJ A;  3BRD A;  4END A;  5BXP A;  4ZKT B;  2D7I A;  3CA4 A;  4X38 A;  1KNM A;  4J2Y A;  5F8Y A;  4HJJ A;  3HSM A;  3Q7W A;  5EC5 A;  2AQZ A;  3BX1 C;  4I2S A;  4LO0 C;  2ERM A;  2LIQ A;  4XFT A;  1IOB A;  3BAQ A;  4XKI A;  4X39 A;  3UD9 A;  2P23 A;  3V0B A;  4ZLB B;  1BFF A;  4G6M A;  4IHZ A;  3IM6 A;  4EEE B;  1CE7 B;  3V79 C;  2XOA A;  4DEP A;  1E0O A;  2NP0 A;  4OW4 A;  2RST A;  4I4Y A;  1BAS A;  4OEE A;  4H04 A;  1DLL A;  4KEJ A;  3RMX A;  2NTD A;  4ZFY B;  1EV2 A;  4EFR A;  2FFV A;  1G82 A;  3PUB A;  2HW9 A;  1TP0 A;  3ZX7 A;  4D0Z A;  3LTQ A;  1I1E A;  5D62 A;  1AVU A;  1TTU A;  1JLY A;  1FN0 A;  3K1X A;  1DFC A;  3P53 A;  6I1B A;  4LO7 C;  4USP A;  4ION A;  4EKX B;  3ZXD A;  2VLC A;  5BXS A;  4QBV A;  2GO2 A;  3CU1 B;  1PUU B;  3A21 A;  3HOM A;  1Z0H A;  4QBC A;  1PC8 B;  2K4A B;  2K8R A;  3EF2 A;  4KBB A;  2P39 A;  5JLV A;  2FDB M;  3CAH A;  4QC4 A;  4F34 A;  3I2X A;  3CA1 A;  1BAR A;  2D20 A;  5GAQ A;  3Q7Y A;  5FNX A;  3WMV A;  3NBN A;  4G6J A;  1BFG A;  1K5V A;  2HZ9 A;  4QKS A;  3NBD A;  2KLL A;  1JY0 A;  1TWE A;  4PC4 A;  1AXM A;  3H6S E;  1HWP B;  1ILR 1;  1PZZ A;  3FFZ A;  4J2S A;  3OBT A;  3POK A;  5D61 A;  1G9B A;  3PHZ A;  4H75 A;  3FJH A;  2BFH A;  3T8S A;  4USO A;  4I96 A;  3BAV A;  1HCE A;  3AKG A;  4LO3 C;  1R8N A;  1L2H A;  4FGF A;  4OEF A;  5BXT A;  4QO3 A;  3CA3 A;  4ZBV B;  4KC3 A;  1P63 A;  1FQ9 A;  1S0D A;  2MC2 A;  1DIW A;  4A7Y A;  3OBR A;  3W9T A;  2UUS A;  4DCK C;  1QXM A;  1G9A A;  1EPW A;  3CRG A;  21BI A;  4OWK A;  3P6I A;  2VSA A;  2FGF A;  4GAF A;  1G9D A;  4CJM A;  3V0A B;  5E24 E;  3IAG C;  4I4X A;  1MD6 A;  1RG8 A;  2NS2 A;  3BB2 A;  4II0 A;  3IM7 A;  2Y9W C;  4P6A A;  4I4S A;  3V0B B;  4ZFU B;  4P0L A;  3CA5 A;  3N7M A;  5BOW A;  1PUM B;  4Z9W B;  5HPZ A;  3AJ5 A;  3BA5 A;  4A7K A;  5BVP I;  1BLD A;  1WBA A;  4WBC A;  3V0A A;  4I1E A;  3VT0 A;  1QQK A;  2BEB A;  3BAH A;  2I1B A;  3NBE A;  2Z49 A;  3HN1 A;  2KKI A;  4R6U B;  4JRA A;  5FNW A;  2DRE A;  1XHB A;  4AN7 B;  1ITB A;  3IM5 A;  4GAI A;  4J2K A;  1Q03 A;  1Z2V A;  2MIB A;  5DVH A;  2WRY A;  3FJB A;  2ESU A;  3N7L A;  3OJ2 A;  3RMY A;  1R8O A;  4IZE A;  1W3G A;  1WD4 A;  2X2T A;  4P0J A;  3O49 A;  5BQU C;  4LO0 A;  1T4Q A;  3R4U A;  3H6Q A;  3FJ8 A;  1NUN A;  4P0K A;  2RQ9 A;  1DZD A;  4HA2 A;  5BP5 C;  1FMM S;  3O4B A;  4LO7 B;  3FJ9 A;  5FZY A;  4ZFW B;  3VUO A;  3AH1 A;  3F62 B;  1AFC A;  1S0B A;  3AZV A;  1J0S A;  3BAG A;  1JTC A;  2MLL B;  3BAU A;  2NZ9 A;  4ZOT A;  3A22 A;  3I2A A;  2AFG A;  3HMY A;  3UD7 A;  1Q04 A;  1W3A A;  3KMV A;  4L4H A;  1YXW A;  3BTA A;  1YYN A;  2D7R A;  3WO3 A;  3E8L C;  1HIB A;  2J3P A;  3JUT A;  4QAL A;  3PME A;  4I3N A;  1SR4 C;  1TWM A;  1WD3 A;  3FJK A;  1TIE A;  3C9Z A;  3BAD A;  4ZA3 B;  1ISW A;  3RTI B;  5BP5 A;  3BA7 A;  1ISZ A;  3FGM A;  1S0C A;  2F2F C;  1FV2 A;  1JT3 A;  3AKH A;  3TC2 A;  4F83 A;  3FJF A;  1A8D A;  3ZXG A;  2D1Z A;  1ABR B;  1HWM B;  3O3Q A;  4KEK A;  2DS0 A;  2X2S A;  2Y9G A;  1PWA A;  1I1B A;  4QKR A;  3A23 A;  4LO1 C;  2D24 A;  3QYD A;  3O4A A;  1SR4 A;  2YUG A;  1EVT A;  2E4M C;  4TLP A;  4J2X A;  2ZR1 B;  2KI6 B;  1FGA A;  3AKF A;  4I4P A;  3FUO A;  2M49 A;  31BI A;  1RZO B;  5I1B A;  4I37 A;  3AKI A;  2QYI B;  2VUA A;  2ZQO A;  1JT4 A;  1JQZ A;  3OJV A;  3N7J A;  2WBC A;  5F90 A;  3AJ6 A;  2Q9X A;  41BI A;  2IWT B;  3AZW A;  1IHK A;  5FZU A;  4MZH A;  4Q9P A;  4MZG B;  2AAI B;  1D0H A;  3N7K A;  2GZB A;  2NYY A;  2L5X A;  4J23 B;  1V6V A;  2E4M A;  4OEG A;  4X37 A;  1VCL A;  1K5U A;  3WA1 A;  3FUQ A;  4LO2 C;  1II4 A;  2D44 A;  1GGP B;  3D7W B;  1IRP A;  4JP0 A;  1YTO A;  1V6X A;  3RSJ A;  4Q9G A;  4LO3 A;  3ILA A;  3VEQ A;  2LIE A;  1JLX A;  3H6R A;  2D22 A;  2HWM A;  4DEN A;  1DFQ A;  3RTJ B;  3OJM A;  3R4S A;  3ZC9 A;  1G9C A;  2QN4 A;  1SZ6 B;  3AH4 A;  1S0G A;  5DZU A;  4I4Q A;  1S0E A;  3CRI A;  4YOL A;  2NVH A;  4LO2 A;  4ZGR B;  1XZZ A;  4X3A A;  4QD2 C;  3B9U A;  1OQL B;  4I8M A;  1QQL A;  3BA4 A;  3VSZ A;  2FFU A;  4EFQ A;  2VXT I;  3BRF A;  4G9N A;  3A07 A;  1IIL A;  2F8X C;  3AH2 A;  4Z8S B;  2DRY A;  1BFC A;  1IRA X;  1CVS A;  4I7I A;  4D0T A;  5D63 A;  4IQP A;  1YF8 B;  3UD8 A;  5B2H A;  4IZX A;  4EFP A;  3O5W B;  4Q91 A;  3CA0 A;  3FJC A;  2ET2 A;  1FMZ A;  1S0F A;  1EYL A;  1BFB A;  4I4O A;  3UDA A;  3MAL A;  5JMC A;  1WBC A;  4GOV A;  3FJI A;  4JQ0 A;  3WIN C;  1M16 A;  2D43 A;  3HAL A;  3IIR A;  4ISQ A;  1JT5 A;  1NZK A;  1BLA A;  2Y9X E;  3O4D A;  2FO1 A;  5EG6 C;  3P6J A;  2VXR A;  1UPS A;  3OGF A;  3FJD A;  3Q7X A;  3O44 A;  2AXM A;  4AN6 A;  4L4I A;  3WMU A;  3QR5 A;  2IHO A;  3CQA A;  4JKX B;  2NM1 A;  4OWJ A;  5BXR A;  1DZC A;  4IY9 A;  5BQU A;  3PG0 A;  1N4K A;  3O4C A;  2VU9 A;  3F1R A;  3ZC8 A;  4UY4 A;  1ONK B;  1F31 A;  5DSS B;  1IJT A;  1ISX A;  4GP3 A;  5EHA A;  1AVX B;  3WIN A;  4D8H A;  1BA7 A;  1DQG A;  2ZQN A;  3S8J A;  4A7Z A;  1S0L A;  4OWL A;  3LLP A;  4I0Y A;  5F8W A;  1ISV A;  3N0K A;  1AVA C;  1XYF A;  3BRG C;  5FZZ A;  3OGG A;  1FV3 A;  1AF9 A;  3FJA A;  3FJE A;  4LO8 B;  3CA6 A;  3UJ0 A;  1HWN B;  4HR6 C;  3H6R B;  3WO4 A;  3UJ4 A;  2F2F A;  1ISY A;  1HWO B;  3BAO A;  2Y9F A;  2R9K B;  2D23 A;  4G1R A;  3VSF A;  4JKQ A;  4XFS A;  1TFM B;  2HWA A;  2KI4 A;  4XFU A;  2Q3N B;  4GP0 A;  1HKN A;  7I1B A;  3S8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...